hexsha
stringlengths 40
40
| size
int64 3
1.05M
| ext
stringclasses 163
values | lang
stringclasses 53
values | max_stars_repo_path
stringlengths 3
945
| max_stars_repo_name
stringlengths 4
112
| max_stars_repo_head_hexsha
stringlengths 40
78
| max_stars_repo_licenses
listlengths 1
10
| max_stars_count
float64 1
191k
⌀ | max_stars_repo_stars_event_min_datetime
stringlengths 24
24
⌀ | max_stars_repo_stars_event_max_datetime
stringlengths 24
24
⌀ | max_issues_repo_path
stringlengths 3
945
| max_issues_repo_name
stringlengths 4
113
| max_issues_repo_head_hexsha
stringlengths 40
78
| max_issues_repo_licenses
listlengths 1
10
| max_issues_count
float64 1
116k
⌀ | max_issues_repo_issues_event_min_datetime
stringlengths 24
24
⌀ | max_issues_repo_issues_event_max_datetime
stringlengths 24
24
⌀ | max_forks_repo_path
stringlengths 3
945
| max_forks_repo_name
stringlengths 4
113
| max_forks_repo_head_hexsha
stringlengths 40
78
| max_forks_repo_licenses
listlengths 1
10
| max_forks_count
float64 1
105k
⌀ | max_forks_repo_forks_event_min_datetime
stringlengths 24
24
⌀ | max_forks_repo_forks_event_max_datetime
stringlengths 24
24
⌀ | content
stringlengths 3
1.05M
| avg_line_length
float64 1
966k
| max_line_length
int64 1
977k
| alphanum_fraction
float64 0
1
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
73db3ca9b577bc7bccfe3eda6f59b4f89672f545 | 78 | pl | Perl | perl/src/until.pl | hebostary/notes | b8aeebab4c80e80f0e5c322f29389b90772bc834 | [
"Unlicense"
]
| null | null | null | perl/src/until.pl | hebostary/notes | b8aeebab4c80e80f0e5c322f29389b90772bc834 | [
"Unlicense"
]
| null | null | null | perl/src/until.pl | hebostary/notes | b8aeebab4c80e80f0e5c322f29389b90772bc834 | [
"Unlicense"
]
| null | null | null | #!/usr/bin/perl
$a = 0;
until($a == 10){
print "$a\n";
$a = $a + 2;
}
| 11.142857 | 17 | 0.384615 |
73e4208cbe0bafc941b69de4f2da987e1d0da347 | 263 | pl | Perl | MCA/5th Sem/Theory & Practical/Compiler Design/CDPractical/cd/FINAL/unknown_user's_files/barna/del_2.pl | peace-shillong/Computer-Applications-Theory-and-Practical-Part-2 | fecab1b992fde6b7e0bdb7e93077725090b92d9b | [
"MIT"
]
| null | null | null | MCA/5th Sem/Theory & Practical/Compiler Design/CDPractical/cd/FINAL/unknown_user's_files/barna/del_2.pl | peace-shillong/Computer-Applications-Theory-and-Practical-Part-2 | fecab1b992fde6b7e0bdb7e93077725090b92d9b | [
"MIT"
]
| null | null | null | MCA/5th Sem/Theory & Practical/Compiler Design/CDPractical/cd/FINAL/unknown_user's_files/barna/del_2.pl | peace-shillong/Computer-Applications-Theory-and-Practical-Part-2 | fecab1b992fde6b7e0bdb7e93077725090b92d9b | [
"MIT"
]
| null | null | null | #!/usr/bin/perl
print"Enter a file nhame:\t";
chomp($a=<STDIN>);
open(IN,"$a");
print"Enter the word\n";
chomp($w=<STDIN>);
open(OUT,">b.txt");
while($file=<IN>)
{
if(!($file=~ m/$w/))
{
print OUT $file;
}
}
unlink $a;
rename "b.txt", $a;
unlink "b.txt";
| 12.52381 | 29 | 0.562738 |
ed055cad7619ea84055b1bab4485a9d2f5aa4098 | 1,239 | pm | Perl | genoverse/modules/EnsEMBL/Draw/GlyphSet/_variation.pm | at7/public-plugins | 189ef46fe2567a7999c216505a9f543eeb4ecfb1 | [
"Apache-2.0"
]
| null | null | null | genoverse/modules/EnsEMBL/Draw/GlyphSet/_variation.pm | at7/public-plugins | 189ef46fe2567a7999c216505a9f543eeb4ecfb1 | [
"Apache-2.0"
]
| null | null | null | genoverse/modules/EnsEMBL/Draw/GlyphSet/_variation.pm | at7/public-plugins | 189ef46fe2567a7999c216505a9f543eeb4ecfb1 | [
"Apache-2.0"
]
| null | null | null | =head1 LICENSE
Copyright [1999-2015] Wellcome Trust Sanger Institute and the EMBL-European Bioinformatics Institute
Licensed under the Apache License, Version 2.0 (the "License");
you may not use this file except in compliance with the License.
You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software
distributed under the License is distributed on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
See the License for the specific language governing permissions and
limitations under the License.
=cut
package EnsEMBL::Draw::GlyphSet::_variation;
use strict;
use Bio::EnsEMBL::Variation::Utils::Constants;
use previous qw(depth);
sub _labels { return $_[0]{'_labels'} ||= { map { $_->SO_term => $_->label } values %Bio::EnsEMBL::Variation::Utils::Constants::OVERLAP_CONSEQUENCES }; }
sub genoverse_attributes { return ( legend => $_[0]->_labels->{$_[1]->display_consequence}, id => $_[1]->dbID ); }
sub depth { return $_[0]->PREV::depth if $_[0]{'container'}; }
sub scalex { return $_[0]{'config'}{'transform'} ? $_[0]->SUPER::scalex : 1; }
1;
| 37.545455 | 166 | 0.706215 |
ed24fa1360fbae712c08179a57e32c945a75bb88 | 1,515 | pm | Perl | pdu-perl-api/Raritan/RPC/net/EapSettings_2_0_0.pm | gregoa/raritan-pdu-json-rpc-sdk | 76df982462742b97b52872aa34630140f5df7e58 | [
"BSD-3-Clause"
]
| 1 | 2021-04-29T23:04:17.000Z | 2021-04-29T23:04:17.000Z | pdu-perl-api/Raritan/RPC/net/EapSettings_2_0_0.pm | gregoa/raritan-pdu-json-rpc-sdk | 76df982462742b97b52872aa34630140f5df7e58 | [
"BSD-3-Clause"
]
| null | null | null | pdu-perl-api/Raritan/RPC/net/EapSettings_2_0_0.pm | gregoa/raritan-pdu-json-rpc-sdk | 76df982462742b97b52872aa34630140f5df7e58 | [
"BSD-3-Clause"
]
| 2 | 2020-06-20T16:21:23.000Z | 2021-09-28T19:04:44.000Z | # SPDX-License-Identifier: BSD-3-Clause
#
# Copyright 2020 Raritan Inc. All rights reserved.
#
# This file was generated by IdlC from Net.idl.
use strict;
package Raritan::RPC::net::EapSettings_2_0_0;
sub encode {
my ($in) = @_;
my $encoded = {};
$encoded->{'identity'} = "$in->{'identity'}";
$encoded->{'password'} = "$in->{'password'}";
$encoded->{'outerMethod'} = $in->{'outerMethod'};
$encoded->{'innerMethod'} = $in->{'innerMethod'};
$encoded->{'caCertificate'} = "$in->{'caCertificate'}";
$encoded->{'forceTrustedCert'} = ($in->{'forceTrustedCert'}) ? JSON::true : JSON::false;
$encoded->{'allowOffTimeRangeCerts'} = ($in->{'allowOffTimeRangeCerts'}) ? JSON::true : JSON::false;
$encoded->{'allowNotYetValidCertsIfTimeBeforeBuild'} = ($in->{'allowNotYetValidCertsIfTimeBeforeBuild'}) ? JSON::true : JSON::false;
return $encoded;
}
sub decode {
my ($agent, $in) = @_;
my $decoded = {};
$decoded->{'identity'} = $in->{'identity'};
$decoded->{'password'} = $in->{'password'};
$decoded->{'outerMethod'} = $in->{'outerMethod'};
$decoded->{'innerMethod'} = $in->{'innerMethod'};
$decoded->{'caCertificate'} = $in->{'caCertificate'};
$decoded->{'forceTrustedCert'} = ($in->{'forceTrustedCert'}) ? 1 : 0;
$decoded->{'allowOffTimeRangeCerts'} = ($in->{'allowOffTimeRangeCerts'}) ? 1 : 0;
$decoded->{'allowNotYetValidCertsIfTimeBeforeBuild'} = ($in->{'allowNotYetValidCertsIfTimeBeforeBuild'}) ? 1 : 0;
return $decoded;
}
1;
| 36.95122 | 136 | 0.620462 |
ed429b3b5cd50c80aa08b134ab2fd7b363e4bedf | 7,953 | pm | Perl | lib/EnsEMBL/REST/Model/ga4gh/references.pm | nuno-agostinho/ensembl-rest | 365c592c56656485c4a6d471d62be2953bccec29 | [
"Apache-2.0"
]
| null | null | null | lib/EnsEMBL/REST/Model/ga4gh/references.pm | nuno-agostinho/ensembl-rest | 365c592c56656485c4a6d471d62be2953bccec29 | [
"Apache-2.0"
]
| null | null | null | lib/EnsEMBL/REST/Model/ga4gh/references.pm | nuno-agostinho/ensembl-rest | 365c592c56656485c4a6d471d62be2953bccec29 | [
"Apache-2.0"
]
| null | null | null | =head
Copyright [1999-2015] Wellcome Trust Sanger Institute and the EMBL-European Bioinformatics Institute
Copyright [2016-2022] EMBL-European Bioinformatics Institute
Licensed under the Apache License, Version 2.0 (the "License");
you may not use this file except in compliance with the License.
You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software
distributed under the License is distributed on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
See the License for the specific language governing permissions and
limitations under the License.
=cut
package EnsEMBL::REST::Model::ga4gh::references;
use Moose;
extends 'Catalyst::Model';
use Catalyst::Exception;
use Scalar::Util qw/weaken/;
use Try::Tiny;
with 'Catalyst::Component::InstancePerContext';
has 'context' => (is => 'ro', weak_ref => 1);
use Bio::DB::Fasta;
use EnsEMBL::REST::Model::ga4gh::ga4gh_utils;
sub build_per_context_instance {
my ($self, $c, @args) = @_;
weaken($c);
return $self->new({ context => $c, %$self, @args });
}
## handle POST requests
sub fetch_references {
my $self = shift;
my $data = $self->context()->req->data();
return ({ references => [],
nextPageToken => $data->{pageToken} }) if $data->{pageSize} < 1;
my ($references, $nextPageToken) = $self->extract_data( $data );
return ({ references => $references,
nextPageToken => $nextPageToken});
}
### GET single reference by 'id'
sub getReference{
my ($self, $get_id, $bases ) = @_;
my $reference = $self->context->model('ga4gh::ga4gh_utils')->get_sequence($get_id);
return undef unless defined $reference && ref($reference) eq 'HASH' ;
## request for substring
if ( defined $bases){
return $self->format_base_sequence($reference);
}
else{
## request for sequence info
return $self->format_sequence($reference);
}
}
## fetch a sequence set & handle filters/paging
sub extract_data{
my $self = shift;
my $post_data = shift;
my @references;
my $count = 0;
my $nextPageToken;
## paging - set the default page token to 0 unless one is specified
$post_data->{pageToken} = 0 unless defined $post_data->{pageToken} && $post_data->{pageToken} ne '';
## look up ensembl version for the ftp site attribute
my $ens_version = $self->get_ensembl_version();
## read config and get look up from seq name to MD5
my $refSeqSet = $self->get_sequenceset($post_data->{referenceSetId});
## return empty array if no sequences for this set (behaviour not fully specified)
return ( [], $nextPageToken) unless defined $refSeqSet && ref($refSeqSet) eq 'HASH' ;
## loop through available sequences
foreach (my $n = $post_data->{pageToken}; $n < scalar(@{$refSeqSet->{sequences}} ); $n++){
my $refseq = $refSeqSet->{sequences}->[$n];
## filter by any supplied attributes
next if defined $post_data->{md5checksum} && $post_data->{md5checksum} ne ''
&& $post_data->{md5checksum} ne $refseq->{md5};
next if defined $post_data->{accession} && $post_data->{accession} ne ''
&& $post_data->{accession} ne $refseq->{sourceAccessions}->[0];
## rough paging
$count++;
if ( $count > $post_data->{pageSize}){
$nextPageToken = $n;
last;
}
$refseq->{assembly} = $refSeqSet->{id};
my $ref = $self->format_sequence($refseq, $ens_version);
push @references, $ref;
}
return (\@references, $nextPageToken ) ;
}
sub format_sequence{
my $self = shift;
my $seq = shift;
my $ens_ver = shift;
$ens_ver ||= $self->get_ensembl_version();
my %ref;
$ref{length} = $seq->{length};
$ref{id} = $seq->{md5}; ### is this the best approach?
$ref{name} = $seq->{name};
$ref{md5checksum} = $seq->{md5};
$ref{sourceAccessions} = $seq->{sourceAccessions};
$ref{isPrimary} = $seq->{isPrimary};
$ref{ncbiTaxonId} = 9606;
$ref{isDerived} = 'true'; ##ambiguity codes have been changed to Ns
$ref{sourceDivergence} = undef;
## define url - ensembl version not in config
if( $ref{sourceAccessions} && $ref{sourceAccessions}->[0] =~ /GA4GH/){
$ref{sourceURI} = "https://github.com/ga4gh/compliance/blob/master/test-data/";
}
else{
$ens_ver = 75 if $seq->{assembly} =~/GRCh37/;
$seq->{assembly} =~ s/\.p13// if $seq->{assembly} =~/GRCh37/;
## over-write stored ftp location with current for GRCh38 site
$ref{sourceURI} = 'ftp://ftp.ensembl.org/pub/release-'. $ens_ver .'/fasta/homo_sapiens/dna/Homo_sapiens.'. $seq->{assembly} .'.dna.chromosome.' . $ref{name} . '.fa.gz';
}
return \%ref;
}
sub get_ensembl_version{
my $self = shift;
my $core_ad = $self->context->model('Registry')->get_DBAdaptor($self->species(), 'core');
my $core_meta = $core_ad->get_MetaContainer();
return $core_meta->schema_version();
}
## extract specific reference set from config data
sub get_sequenceset{
my $self = shift;
my $set = shift;
my $config = $self->context->model('ga4gh::ga4gh_utils')->read_sequence_config();
return undef unless exists $config->{referenceSets};
foreach my $referenceSet (@{$config->{referenceSets}}){
return $referenceSet if $referenceSet->{id} eq $set;
}
return undef;
}
sub format_base_sequence{
my $self = shift;
my $reference = shift;
my $c = $self->context();
## do paging.. ** PICK A SENSIBLE LIMIT
## start and end are optional
my $nextPageToken;
my $current_end = $c->request->param('end')
if defined $c->request->param('end') && $c->request->param('end') =~/\d+/;
## Choose a start from the input info
my $current_start;
if (defined $c->request->param('nextPageToken') && $c->request->param('nextPageToken') =~/\d+/){
$current_start = $c->request->param('nextPageToken');
}
elsif (defined $c->request->param('start') && $c->request->param('start') =~/\d+/){
$current_start = $c->request->param('start') +1; ## convert to zero based coordinates
}
else{
$current_start = 1;
}
if( !defined $c->request->param('end') ||
$c->request->param('end') !~/\d+/ ||
$c->request->param('end') - $current_start > 1000){
$nextPageToken = $current_start + 1001;
$current_end = $current_start + 1000;
}
my $region = $reference->{name} . ":" . $current_start . "-" . $current_end ;
my $sequence;
if( $reference->{sourceAccessions}->[0] =~ /GA4GH/){
## compliance - read fasta file
$sequence = $self->fetch_ga4gh_sequence($reference, $region);
}
else{
## take from slice
$sequence = $self->fetch_ensembl_sequence($reference, $region);
}
return { offset => $current_start -1,
sequence => $sequence,
nextPageToken => $nextPageToken
};
}
sub fetch_ensembl_sequence{
my $self = shift;
my $reference = shift;
my $region = shift;
my $sla = $self->context()->model('Registry')->get_adaptor( $self->species(), 'Core', 'Slice');
my $slice = $sla->fetch_by_toplevel_location($region);
Catalyst::Exception->throw("ERROR: no sequence available for region $region")
unless defined $slice ;
return $slice->seq();
}
sub fetch_ga4gh_sequence{
my $self = shift;
my $reference = shift;
my $region = shift;
my ($seq, $current_start, $current_end) = split/\:|\-/, $region;
my $db;
try{
$db = Bio::DB::Fasta->new( $reference->{fastafile} );
}
catch{
Catalyst::Exception->throw("ERROR: finding sequence for region $region in compliance data")
};
return $db->seq( $reference->{name} , $current_start, $current_end );
}
sub species{
return 'homo_sapiens';
}
1;
| 28.102473 | 175 | 0.627436 |
73d80d026ad80e8e381bff7032b50af5552fc066 | 2,567 | pm | Perl | auto-lib/Paws/Quicksight/DescribeDataSet.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 164 | 2015-01-08T14:58:53.000Z | 2022-02-20T19:16:24.000Z | auto-lib/Paws/Quicksight/DescribeDataSet.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 348 | 2015-01-07T22:08:38.000Z | 2022-01-27T14:34:44.000Z | auto-lib/Paws/Quicksight/DescribeDataSet.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 87 | 2015-04-22T06:29:47.000Z | 2021-09-29T14:45:55.000Z |
package Paws::Quicksight::DescribeDataSet;
use Moose;
has AwsAccountId => (is => 'ro', isa => 'Str', traits => ['ParamInURI'], uri_name => 'AwsAccountId', required => 1);
has DataSetId => (is => 'ro', isa => 'Str', traits => ['ParamInURI'], uri_name => 'DataSetId', required => 1);
use MooseX::ClassAttribute;
class_has _api_call => (isa => 'Str', is => 'ro', default => 'DescribeDataSet');
class_has _api_uri => (isa => 'Str', is => 'ro', default => '/accounts/{AwsAccountId}/data-sets/{DataSetId}');
class_has _api_method => (isa => 'Str', is => 'ro', default => 'GET');
class_has _returns => (isa => 'Str', is => 'ro', default => 'Paws::Quicksight::DescribeDataSetResponse');
1;
### main pod documentation begin ###
=head1 NAME
Paws::Quicksight::DescribeDataSet - Arguments for method DescribeDataSet on L<Paws::Quicksight>
=head1 DESCRIPTION
This class represents the parameters used for calling the method DescribeDataSet on the
L<Amazon QuickSight|Paws::Quicksight> service. Use the attributes of this class
as arguments to method DescribeDataSet.
You shouldn't make instances of this class. Each attribute should be used as a named argument in the call to DescribeDataSet.
=head1 SYNOPSIS
my $quicksight = Paws->service('Quicksight');
my $DescribeDataSetResponse = $quicksight->DescribeDataSet(
AwsAccountId => 'MyAwsAccountId',
DataSetId => 'MyResourceId',
);
# Results:
my $DataSet = $DescribeDataSetResponse->DataSet;
my $RequestId = $DescribeDataSetResponse->RequestId;
my $Status = $DescribeDataSetResponse->Status;
# Returns a L<Paws::Quicksight::DescribeDataSetResponse> object.
Values for attributes that are native types (Int, String, Float, etc) can passed as-is (scalar values). Values for complex Types (objects) can be passed as a HashRef. The keys and values of the hashref will be used to instance the underlying object.
For the AWS API documentation, see L<https://docs.aws.amazon.com/goto/WebAPI/quicksight/DescribeDataSet>
=head1 ATTRIBUTES
=head2 B<REQUIRED> AwsAccountId => Str
The AWS account ID.
=head2 B<REQUIRED> DataSetId => Str
The ID for the dataset that you want to create. This ID is unique per
AWS Region for each AWS account.
=head1 SEE ALSO
This class forms part of L<Paws>, documenting arguments for method DescribeDataSet in L<Paws::Quicksight>
=head1 BUGS and CONTRIBUTIONS
The source code is located here: L<https://github.com/pplu/aws-sdk-perl>
Please report bugs to: L<https://github.com/pplu/aws-sdk-perl/issues>
=cut
| 33.337662 | 249 | 0.7164 |
ed3e47b7286055973810cfbf637b090444a316fd | 3,309 | pm | Perl | auto-lib/Paws/GameLift/UpdateGameServer.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 164 | 2015-01-08T14:58:53.000Z | 2022-02-20T19:16:24.000Z | auto-lib/Paws/GameLift/UpdateGameServer.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 348 | 2015-01-07T22:08:38.000Z | 2022-01-27T14:34:44.000Z | auto-lib/Paws/GameLift/UpdateGameServer.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 87 | 2015-04-22T06:29:47.000Z | 2021-09-29T14:45:55.000Z |
package Paws::GameLift::UpdateGameServer;
use Moose;
has GameServerData => (is => 'ro', isa => 'Str');
has GameServerGroupName => (is => 'ro', isa => 'Str', required => 1);
has GameServerId => (is => 'ro', isa => 'Str', required => 1);
has HealthCheck => (is => 'ro', isa => 'Str');
has UtilizationStatus => (is => 'ro', isa => 'Str');
use MooseX::ClassAttribute;
class_has _api_call => (isa => 'Str', is => 'ro', default => 'UpdateGameServer');
class_has _returns => (isa => 'Str', is => 'ro', default => 'Paws::GameLift::UpdateGameServerOutput');
class_has _result_key => (isa => 'Str', is => 'ro');
1;
### main pod documentation begin ###
=head1 NAME
Paws::GameLift::UpdateGameServer - Arguments for method UpdateGameServer on L<Paws::GameLift>
=head1 DESCRIPTION
This class represents the parameters used for calling the method UpdateGameServer on the
L<Amazon GameLift|Paws::GameLift> service. Use the attributes of this class
as arguments to method UpdateGameServer.
You shouldn't make instances of this class. Each attribute should be used as a named argument in the call to UpdateGameServer.
=head1 SYNOPSIS
my $gamelift = Paws->service('GameLift');
my $UpdateGameServerOutput = $gamelift->UpdateGameServer(
GameServerGroupName => 'MyGameServerGroupNameOrArn',
GameServerId => 'MyGameServerId',
GameServerData => 'MyGameServerData', # OPTIONAL
HealthCheck => 'HEALTHY', # OPTIONAL
UtilizationStatus => 'AVAILABLE', # OPTIONAL
);
# Results:
my $GameServer = $UpdateGameServerOutput->GameServer;
# Returns a L<Paws::GameLift::UpdateGameServerOutput> object.
Values for attributes that are native types (Int, String, Float, etc) can passed as-is (scalar values). Values for complex Types (objects) can be passed as a HashRef. The keys and values of the hashref will be used to instance the underlying object.
For the AWS API documentation, see L<https://docs.aws.amazon.com/goto/WebAPI/gamelift/UpdateGameServer>
=head1 ATTRIBUTES
=head2 GameServerData => Str
A set of custom game server properties, formatted as a single string
value. This data is passed to a game client or service when it requests
information on game servers using ListGameServers or ClaimGameServer.
=head2 B<REQUIRED> GameServerGroupName => Str
A unique identifier for the game server group where the game server is
running. Use either the GameServerGroup name or ARN value.
=head2 B<REQUIRED> GameServerId => Str
A custom string that uniquely identifies the game server to update.
=head2 HealthCheck => Str
Indicates health status of the game server. A request that includes
this parameter updates the game server's I<LastHealthCheckTime>
timestamp.
Valid values are: C<"HEALTHY">
=head2 UtilizationStatus => Str
Indicates whether the game server is available or is currently hosting
gameplay.
Valid values are: C<"AVAILABLE">, C<"UTILIZED">
=head1 SEE ALSO
This class forms part of L<Paws>, documenting arguments for method UpdateGameServer in L<Paws::GameLift>
=head1 BUGS and CONTRIBUTIONS
The source code is located here: L<https://github.com/pplu/aws-sdk-perl>
Please report bugs to: L<https://github.com/pplu/aws-sdk-perl/issues>
=cut
| 32.441176 | 249 | 0.715926 |
73d1c2b2eba9ab386d424e6d89f7f5c8dd3a4d75 | 299 | pl | Perl | JSON/complicate.pl | mkotoff/EPCIS | 0c6e410aebfe0cdea6a3ccaeabc08ac49ac34258 | [
"Apache-2.0"
]
| null | null | null | JSON/complicate.pl | mkotoff/EPCIS | 0c6e410aebfe0cdea6a3ccaeabc08ac49ac34258 | [
"Apache-2.0"
]
| null | null | null | JSON/complicate.pl | mkotoff/EPCIS | 0c6e410aebfe0cdea6a3ccaeabc08ac49ac34258 | [
"Apache-2.0"
]
| null | null | null | #!perl -p -i
s{https://gs1.github.io/EPCIS/epcis-context-simple.jsonld}{https://gs1.github.io/EPCIS/epcis-context.jsonld};
# s{urn:epcglobal:cbv:bizstep:}{};
# s{urn:epcglobal:cbv:disp:}{};
# s{urn:epcglobal:cbv:btt:}{};
# s{urn:epcglobal:cbv:sdt:}{};
# s{urn:epcglobal:cbv:er:}{};
# s{gs1:MT-}{};
| 29.9 | 109 | 0.655518 |
ed2b66a91d269941ce24691fedced16c47bee928 | 216 | pl | Perl | cfg/cfg.d/z_theme.pl | eprintsug/bootstrap | 708133642fc1cd7938f23cf076fd815391423d05 | [
"MIT"
]
| 2 | 2015-09-06T22:10:37.000Z | 2021-11-16T03:50:06.000Z | cfg/cfg.d/z_theme.pl | eprintsug/bootstrap | 708133642fc1cd7938f23cf076fd815391423d05 | [
"MIT"
]
| 19 | 2015-01-07T15:14:44.000Z | 2017-10-06T13:18:33.000Z | cfg/cfg.d/z_theme.pl | eprintsug/bootstrap | 708133642fc1cd7938f23cf076fd815391423d05 | [
"MIT"
]
| 4 | 2015-03-13T14:11:08.000Z | 2020-03-07T02:19:58.000Z | $c->{theme} ="bootstrap";
# To enable bootstrap login screen
$c->{plugin_alias_map}->{"Screen::Login::Internal"} = "Screen::Login::BootstrapLogin";
$c->{plugin_alias_map}->{"Screen::Login::BootstrapLogin"} = undef;
| 36 | 86 | 0.699074 |
ed41a1536ba086dcc6950a59126fbfeb5dcda633 | 4,638 | pm | Perl | vpn-gui/vpn_ipc.pm | privateon/PrivateOn-VPN | 5c1081db6b45ecef9d58c5d3c1f3fa0d42c7e9b0 | [
"Artistic-2.0"
]
| null | null | null | vpn-gui/vpn_ipc.pm | privateon/PrivateOn-VPN | 5c1081db6b45ecef9d58c5d3c1f3fa0d42c7e9b0 | [
"Artistic-2.0"
]
| 2 | 2015-02-06T20:21:01.000Z | 2016-03-05T07:22:53.000Z | vpn-gui/vpn_ipc.pm | privateon/PrivateOn-VPN | 5c1081db6b45ecef9d58c5d3c1f3fa0d42c7e9b0 | [
"Artistic-2.0"
]
| 8 | 2015-01-27T11:07:12.000Z | 2020-01-21T08:17:44.000Z | package vpn_ipc;
#
# PrivateOn-VPN -- Because privacy matters.
#
# Copyright (C) 2014-2015 PrivateOn / Tietosuojakone Oy, Helsinki, Finland
# All rights reserved. Use is subject to license terms.
#
#
# vpn-gui/vpn_ipc.pm Communication from GUI to the backend daemon
#
use strict;
use warnings;
use English;
use IO::Socket::INET;
sub import {
no strict 'refs';
foreach (@_) {
*{"vpn_window::$_"}=\&$_;
*{"vpn_tray::$_"}=\&$_;
}
}
use constant {
NET_UNPROTECTED => 1,
NET_PROTECTED => 2,
NET_NEGATIVE => 3,
NET_CONFIRMING => 4,
NET_UNCONFIRMED => 5,
NET_CRIPPLED => 6,
NET_OFFLINE => 7,
NET_BROKEN => 8,
NET_ERROR => 9,
NET_UNKNOWN => 10
};
use constant {
IPC_HOST => '127.0.0.1',
IPC_PORT => 44244
};
################ Helper subroutines ################
sub sendBackendCommand {
my ($command, $debug_flag) = @_;
# make INET connection refused nonfatal
eval {
$OUTPUT_AUTOFLUSH = 1;
my $sock = IO::Socket::INET->new(
PeerHost => IPC_HOST,
PeerPort => IPC_PORT,
Proto => 'tcp',
);
return unless $sock;
$sock->send( $command . "\n" );
shutdown($sock, 1);
$sock->close();
if ( defined($debug_flag) && $debug_flag > 1 ) {
print "\n\t\tCommand '" . $command . "' sent to vpn-monitor\n";
}
};
}
sub sendBackendQuery {
my $command = shift;
# make INET connection refused nonfatal
eval {
$OUTPUT_AUTOFLUSH = 1;
my $sock = IO::Socket::INET->new(
PeerHost => IPC_HOST,
PeerPort => IPC_PORT,
Proto => 'tcp',
);
return NET_ERROR unless $sock;
$sock->send( $command . "\n" );
shutdown($sock, 1);
my $response = "";
$sock->recv($response, 40);
$sock->close();
chomp($response);
return $response;
};
}
################ Backend Commands ################
sub takeABreak {
my $debug_flag = shift;
sendBackendCommand("take-a-break", $debug_flag);
}
sub resumeIdling {
my $debug_flag = shift;
sendBackendCommand("resume-idling", $debug_flag);
}
sub removeDispatcher {
my $debug_flag = shift;
sendBackendCommand("remove-dispatcher", $debug_flag);
}
sub disableMonitor {
my $debug_flag = shift;
sendBackendCommand("disable-monitor", $debug_flag);
}
sub enableMonitor {
my $debug_flag = shift;
sendBackendCommand("enable-monitor", $debug_flag);
}
sub undoCrippling {
my $debug_flag = shift;
sendBackendCommand("undo-crippling", $debug_flag);
}
sub forceRefresh {
my $debug_flag = shift;
sendBackendCommand("force-refresh", $debug_flag);
}
################ Backend Queries ################
sub getApiStatus {
my $response = sendBackendQuery("get-api-status");
# was response "say what?" for wrong command
if ($response =~ /say/i) {
print "\nError: backend did not understand query \"get-api-status\" \n";
return NET_UNKNOWN;
}
# if not numeric
unless ($response =~ /^\d+$/ ) {
print "\nError: backend query \"get-api-status\" gave non-numeric response \"$response\" \n";
return NET_UNKNOWN;
}
return $response;
}
sub getNetStatus {
my $response = sendBackendQuery("get-net-status");
# was response "say what?" for wrong command
if ($response =~ /say/i) {
print "\nError: backend did not understand query \"get-net-status\" \n";
return NET_UNKNOWN;
}
# if not numeric
unless ($response =~ /^\d+$/ ) {
print "\nError: backend query \"get-net-status\" gave non-numeric response \"$response\" \n";
return NET_UNKNOWN;
}
return $response;
}
sub getCripplingStatus {
my $debug_flag = shift;
my $response = sendBackendQuery("check-crippling");
if ($response) {
if ( defined($debug_flag) && $debug_flag > 0 ) {
print "\nDebug: check-crippling returned test result \"$response\" \n";
}
return 1;
}
return 0;
}
sub getMonitorState {
my $debug_flag = shift;
my $response = sendBackendQuery("monitor-state");
unless ($response =~ /\S+-\S+-\S+/) {
if ( defined($debug_flag) && $debug_flag > 0 ) {
print "\nError: monitor-state returned invalid result \"$response\" \n";
}
# if monitor is offline or unresponsive, mark all fields as unknown
$response = "Unknown-unknown-UNKNOWN";
}
return $response;
}
sub removeRoute {
my $response = sendBackendQuery("remove-route");
if ($response =~ /not ok/) {
print "\nError: could not remove bad route. Backend says: \"$response\"\n";
}
return $response;
}
sub writeDispatcher {
my $response = sendBackendQuery("write-dispatcher");
if ($response =~ /not ok/) {
print "\nError: could not write dispatcher file. Backend says: \"$response\"\n";
}
return $response;
}
sub rereadConfig {
sendBackendQuery("reread-config");
}
1;
| 20.798206 | 95 | 0.635834 |
73f7cc415c691afdeb21ed01a4b64d64a8fc4832 | 34 | t | Perl | plugins/robots/generators/iotik/iotikRuCGeneratorLibrary/templates_english/network/send.t | Victor-Y-Fadeev/qreal | 2c7f14d5eb24753d4a7c038e13a3fa3026adce18 | [
"Apache-2.0"
]
| 6 | 2017-07-03T13:55:35.000Z | 2018-11-28T03:39:51.000Z | plugins/robots/generators/iotik/iotikRuCGeneratorLibrary/templates_english/network/send.t | Victor-Y-Fadeev/qreal | 2c7f14d5eb24753d4a7c038e13a3fa3026adce18 | [
"Apache-2.0"
]
| 27 | 2017-06-29T09:36:37.000Z | 2017-11-25T14:50:04.000Z | plugins/robots/generators/iotik/iotikRuCGeneratorLibrary/templates_english/network/send.t | Victor-Y-Fadeev/qreal | 2c7f14d5eb24753d4a7c038e13a3fa3026adce18 | [
"Apache-2.0"
]
| null | null | null | blynk_send(@@PORT@@, @@VALUE@@);
| 17 | 33 | 0.558824 |
ed066f21e7e4f633829933e2c2928b6582310f33 | 3,285 | pm | Perl | examples/MSPDI/lib/MSPDI.pm | asandler/spdi | 95ffde21b86934e395028aef8dc49ddd12f0e4ca | [
"MIT"
]
| null | null | null | examples/MSPDI/lib/MSPDI.pm | asandler/spdi | 95ffde21b86934e395028aef8dc49ddd12f0e4ca | [
"MIT"
]
| null | null | null | examples/MSPDI/lib/MSPDI.pm | asandler/spdi | 95ffde21b86934e395028aef8dc49ddd12f0e4ca | [
"MIT"
]
| null | null | null | #!/usr/local/bin/perl
use strict;
my $warnings = 0;
my $spdi_header = "";
my $spdi_points = "";
my $spdi_vectors = "";
my $spdi_regions = "";
my @mspdi_vectors = ();
my @mspdi_points = ();
my $mspdi_infile = "";
my $mspdi_outfile = "";
sub constraint {
my ($name, $condition) = @_;
if (!$condition) {
error("contraint \"$name\" not satisfied");
}
}
sub warning {
my ($message) = @_;
print("Warning: $message\n");
$warnings++;
}
sub error {
my ($message) = @_;
print("Error: $message\n");
exit;
}
sub remark {
my ($message) = @_;
print("$message\n");
}
sub newRegion {
my ($vector_left, $vector_right, @pointnames) = @_;
my $newregion = "@pointnames";
$newregion =~ s/ / : /g;
$spdi_regions = "$spdi_regions$newregion, $vector_left, $vector_right\n";
}
sub newPoint {
my ($newname, $newx, $newy) = @_;
my ($name);
foreach $name (@mspdi_points) {
if ($name eq $newname) { error("redefinition of point named $name") }
}
foreach $name (@mspdi_vectors) {
if ($name eq $newname) { error("defining point with name $name which is already used as a vector name") }
}
$spdi_points = sprintf("%s%s. %f, %f\n",$spdi_points,$newname,$newx,$newy);
#$spdi_points = "$spdi_points$newname. $newx, $newy\n"
}
sub newVector {
my ($newname, $newx, $newy) = @_;
my ($name);
foreach $name (@mspdi_vectors) {
if ($name eq $newname) { error("redefinition of vector named $name") }
}
foreach $name (@mspdi_points) {
if ($name eq $newname) { error("defining vector with name $name which is already used as a point name") }
}
$spdi_vectors = sprintf("%s%s. %f, %f\n",$spdi_vectors,$newname,$newx,$newy);
#$spdi_vectors = "$spdi_vectors$newname. $newx, $newy\n"
}
sub newHeaderComment {
my ($comment) = @_;
$spdi_header = "$spdi_header* $comment\n";
}
sub newRegionComment {
my ($comment) = @_;
$spdi_regions = "$spdi_regions* $comment\n";
}
sub newPointComment {
my ($comment) = @_;
$spdi_points = "$spdi_points* $comment\n";
}
sub newVectorComment {
my ($comment) = @_;
$spdi_vectors = "$spdi_vectors* $comment\n";
}
sub startMSPDI {
# register arguments
$mspdi_infile = $0;
if ( @ARGV[0] eq "" ) {
$_ = $mspdi_infile; s/\.mspdi$//;
$mspdi_outfile = "$_.spdi";
} else {
$mspdi_outfile = @ARGV[0];
}
# the file signature
$spdi_header = "* Created by the perl mspdi library from $mspdi_infile\n\n";
# the spdi file accumulated text
$spdi_vectors = "\nVectors:\n\n";
$spdi_regions = "\nRegions:\n\n";
$spdi_points = "\nPoints:\n\n";
# the vector and point names defined
@mspdi_vectors = ();
@mspdi_points = ();
# number of warnings issued
$warnings = 0;
}
sub endMSPDI {
my $FILE;
print "MSPDI Perl Library v0.1\n\n";
print "Generating file $mspdi_outfile from $mspdi_infile\n";
open (FILE, ">$mspdi_outfile");
print FILE "$spdi_header$spdi_points$spdi_vectors$spdi_regions\n* End of spdifile\n";
close (FILE);
print "Successfully generated spdi file\n";
if ($warnings > 0) {
if ($warnings == 1) {
print "\n1 warning found\n";
} else {
print "\n$warnings warnings found\n";
}
}
}
1;
| 22.195946 | 110 | 0.598478 |
ed37fcd98cd8e2937d651525ed3e3ed40e4d5522 | 1,530 | t | Perl | applications/emf/examples/1lignedeproduits/DemoStrategy.t | rewriting/tom | 2918e95c78006f08a2a0919ef440413fa5c2342a | [
"BSD-3-Clause"
]
| 36 | 2016-02-19T12:09:49.000Z | 2022-02-03T13:13:21.000Z | applications/emf/examples/1lignedeproduits/DemoStrategy.t | rewriting/tom | 2918e95c78006f08a2a0919ef440413fa5c2342a | [
"BSD-3-Clause"
]
| null | null | null | applications/emf/examples/1lignedeproduits/DemoStrategy.t | rewriting/tom | 2918e95c78006f08a2a0919ef440413fa5c2342a | [
"BSD-3-Clause"
]
| 6 | 2017-11-30T17:07:10.000Z | 2022-03-12T14:46:21.000Z | import org.eclipse.emf.common.util.*;
import org.eclipse.emf.ecore.*;
import ligneproduitstelephones.*;
import tom.library.sl.*;
class DemoStrategy {
%include{ ligneproduitstelephonesmapping.tom }
%include { sl.tom }
public static void main(String[] args) {
Telephone iphone =`Telephone("iPhone 3GS", null, IphoneOS(1));
Telephone iphone2 =`Telephone("iPhone 2", null, IphoneOS(1));
Telephone nexus =`Telephone("Nexus", null, Android(1));
Marque google = `Marque("Google Phone", TelephoneEList(nexus));
Marque apple = `Marque("Apple", TelephoneEList(iphone));
iphone.setMarque(apple);
iphone2.setMarque(apple);
nexus.setMarque(google);
LigneProduitsTelephones lpt = `LigneProduitsTelephones("Mes produits",
TelephoneEList(iphone,iphone2,nexus),
MarqueEList(apple,google) );
try {
Telephone result = `TopDown(Try(upgradeVersion())).visitLight(nexus, new EcoreContainmentIntrospector());
System.out.println("Version après = " + result.getOS().getVersion());
} catch (VisitFailure e) {
System.out.println("failure");
}
}
%strategy upgradeVersion() extends Fail() {
visit Telephone {
Telephone(n,m,OSTelephone(version)) -> {
return `Telephone(n,m,OSTelephone(version+1));
}
}
//test
/*visit OSTelephone {
//a@OSTelephone(version) -> {
OSTelephone(version) -> {
//`a.setVersion(`version+1);
return `OSTelephone(version);
//return `a;
}
}*/
}
}
| 28.333333 | 111 | 0.648366 |
73e1527d6836dc197885e0ffbbb33fcddac2fab6 | 59,284 | pm | Perl | perl5/lib/perl5/DateTime/TimeZone/America/St_Johns.pm | jinnks/printevolve | 8c54f130000cd6ded290f5905bdc2093d9f264da | [
"Apache-2.0"
]
| null | null | null | perl5/lib/perl5/DateTime/TimeZone/America/St_Johns.pm | jinnks/printevolve | 8c54f130000cd6ded290f5905bdc2093d9f264da | [
"Apache-2.0"
]
| null | null | null | perl5/lib/perl5/DateTime/TimeZone/America/St_Johns.pm | jinnks/printevolve | 8c54f130000cd6ded290f5905bdc2093d9f264da | [
"Apache-2.0"
]
| null | null | null | # This file is auto-generated by the Perl DateTime Suite time zone
# code generator (0.08) This code generator comes with the
# DateTime::TimeZone module distribution in the tools/ directory
#
# Generated from /tmp/Kkk4myWbVM/northamerica. Olson data version 2020d
#
# Do not edit this file directly.
#
package DateTime::TimeZone::America::St_Johns;
use strict;
use warnings;
use namespace::autoclean;
our $VERSION = '2.44';
use Class::Singleton 1.03;
use DateTime::TimeZone;
use DateTime::TimeZone::OlsonDB;
@DateTime::TimeZone::America::St_Johns::ISA = ( 'Class::Singleton', 'DateTime::TimeZone' );
my $spans =
[
[
DateTime::TimeZone::NEG_INFINITY, # utc_start
59421785452, # utc_end 1884-01-01 03:30:52 (Tue)
DateTime::TimeZone::NEG_INFINITY, # local_start
59421772800, # local_end 1884-01-01 00:00:00 (Tue)
-12652,
0,
'LMT',
],
[
59421785452, # utc_start 1884-01-01 03:30:52 (Tue)
60471552652, # utc_end 1917-04-08 05:30:52 (Sun)
59421772800, # local_start 1884-01-01 00:00:00 (Tue)
60471540000, # local_end 1917-04-08 02:00:00 (Sun)
-12652,
0,
'NST',
],
[
60471552652, # utc_start 1917-04-08 05:30:52 (Sun)
60485545852, # utc_end 1917-09-17 04:30:52 (Mon)
60471543600, # local_start 1917-04-08 03:00:00 (Sun)
60485536800, # local_end 1917-09-17 02:00:00 (Mon)
-9052,
1,
'NDT',
],
[
60485545852, # utc_start 1917-09-17 04:30:52 (Mon)
60494700652, # utc_end 1918-01-01 03:30:52 (Tue)
60485533200, # local_start 1917-09-17 01:00:00 (Mon)
60494688000, # local_end 1918-01-01 00:00:00 (Tue)
-12652,
0,
'NST',
],
[
60494700652, # utc_start 1918-01-01 03:30:52 (Tue)
60503607052, # utc_end 1918-04-14 05:30:52 (Sun)
60494688000, # local_start 1918-01-01 00:00:00 (Tue)
60503594400, # local_end 1918-04-14 02:00:00 (Sun)
-12652,
0,
'NST',
],
[
60503607052, # utc_start 1918-04-14 05:30:52 (Sun)
60520537852, # utc_end 1918-10-27 04:30:52 (Sun)
60503598000, # local_start 1918-04-14 03:00:00 (Sun)
60520528800, # local_end 1918-10-27 02:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60520537852, # utc_start 1918-10-27 04:30:52 (Sun)
60526236652, # utc_end 1919-01-01 03:30:52 (Wed)
60520525200, # local_start 1918-10-27 01:00:00 (Sun)
60526224000, # local_end 1919-01-01 00:00:00 (Wed)
-12652,
0,
'NST',
],
[
60526236652, # utc_start 1919-01-01 03:30:52 (Wed)
60537033052, # utc_end 1919-05-06 02:30:52 (Tue)
60526224000, # local_start 1919-01-01 00:00:00 (Wed)
60537020400, # local_end 1919-05-05 23:00:00 (Mon)
-12652,
0,
'NST',
],
[
60537033052, # utc_start 1919-05-06 02:30:52 (Tue)
60545583052, # utc_end 1919-08-13 01:30:52 (Wed)
60537024000, # local_start 1919-05-06 00:00:00 (Tue)
60545574000, # local_end 1919-08-12 23:00:00 (Tue)
-9052,
1,
'NDT',
],
[
60545583052, # utc_start 1919-08-13 01:30:52 (Wed)
60568396252, # utc_end 1920-05-03 02:30:52 (Mon)
60545570400, # local_start 1919-08-12 22:00:00 (Tue)
60568383600, # local_end 1920-05-02 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60568396252, # utc_start 1920-05-03 02:30:52 (Mon)
60584117452, # utc_end 1920-11-01 01:30:52 (Mon)
60568387200, # local_start 1920-05-03 00:00:00 (Mon)
60584108400, # local_end 1920-10-31 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60584117452, # utc_start 1920-11-01 01:30:52 (Mon)
60599845852, # utc_end 1921-05-02 02:30:52 (Mon)
60584104800, # local_start 1920-10-31 22:00:00 (Sun)
60599833200, # local_end 1921-05-01 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60599845852, # utc_start 1921-05-02 02:30:52 (Mon)
60615567052, # utc_end 1921-10-31 01:30:52 (Mon)
60599836800, # local_start 1921-05-02 00:00:00 (Mon)
60615558000, # local_end 1921-10-30 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60615567052, # utc_start 1921-10-31 01:30:52 (Mon)
60631900252, # utc_end 1922-05-08 02:30:52 (Mon)
60615554400, # local_start 1921-10-30 22:00:00 (Sun)
60631887600, # local_end 1922-05-07 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60631900252, # utc_start 1922-05-08 02:30:52 (Mon)
60647016652, # utc_end 1922-10-30 01:30:52 (Mon)
60631891200, # local_start 1922-05-08 00:00:00 (Mon)
60647007600, # local_end 1922-10-29 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60647016652, # utc_start 1922-10-30 01:30:52 (Mon)
60663349852, # utc_end 1923-05-07 02:30:52 (Mon)
60647004000, # local_start 1922-10-29 22:00:00 (Sun)
60663337200, # local_end 1923-05-06 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60663349852, # utc_start 1923-05-07 02:30:52 (Mon)
60678466252, # utc_end 1923-10-29 01:30:52 (Mon)
60663340800, # local_start 1923-05-07 00:00:00 (Mon)
60678457200, # local_end 1923-10-28 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60678466252, # utc_start 1923-10-29 01:30:52 (Mon)
60694799452, # utc_end 1924-05-05 02:30:52 (Mon)
60678453600, # local_start 1923-10-28 22:00:00 (Sun)
60694786800, # local_end 1924-05-04 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60694799452, # utc_start 1924-05-05 02:30:52 (Mon)
60709915852, # utc_end 1924-10-27 01:30:52 (Mon)
60694790400, # local_start 1924-05-05 00:00:00 (Mon)
60709906800, # local_end 1924-10-26 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60709915852, # utc_start 1924-10-27 01:30:52 (Mon)
60726249052, # utc_end 1925-05-04 02:30:52 (Mon)
60709903200, # local_start 1924-10-26 22:00:00 (Sun)
60726236400, # local_end 1925-05-03 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60726249052, # utc_start 1925-05-04 02:30:52 (Mon)
60741365452, # utc_end 1925-10-26 01:30:52 (Mon)
60726240000, # local_start 1925-05-04 00:00:00 (Mon)
60741356400, # local_end 1925-10-25 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60741365452, # utc_start 1925-10-26 01:30:52 (Mon)
60757698652, # utc_end 1926-05-03 02:30:52 (Mon)
60741352800, # local_start 1925-10-25 22:00:00 (Sun)
60757686000, # local_end 1926-05-02 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60757698652, # utc_start 1926-05-03 02:30:52 (Mon)
60773419852, # utc_end 1926-11-01 01:30:52 (Mon)
60757689600, # local_start 1926-05-03 00:00:00 (Mon)
60773410800, # local_end 1926-10-31 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60773419852, # utc_start 1926-11-01 01:30:52 (Mon)
60789148252, # utc_end 1927-05-02 02:30:52 (Mon)
60773407200, # local_start 1926-10-31 22:00:00 (Sun)
60789135600, # local_end 1927-05-01 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60789148252, # utc_start 1927-05-02 02:30:52 (Mon)
60804869452, # utc_end 1927-10-31 01:30:52 (Mon)
60789139200, # local_start 1927-05-02 00:00:00 (Mon)
60804860400, # local_end 1927-10-30 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60804869452, # utc_start 1927-10-31 01:30:52 (Mon)
60821202652, # utc_end 1928-05-07 02:30:52 (Mon)
60804856800, # local_start 1927-10-30 22:00:00 (Sun)
60821190000, # local_end 1928-05-06 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60821202652, # utc_start 1928-05-07 02:30:52 (Mon)
60836319052, # utc_end 1928-10-29 01:30:52 (Mon)
60821193600, # local_start 1928-05-07 00:00:00 (Mon)
60836310000, # local_end 1928-10-28 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60836319052, # utc_start 1928-10-29 01:30:52 (Mon)
60852652252, # utc_end 1929-05-06 02:30:52 (Mon)
60836306400, # local_start 1928-10-28 22:00:00 (Sun)
60852639600, # local_end 1929-05-05 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60852652252, # utc_start 1929-05-06 02:30:52 (Mon)
60867768652, # utc_end 1929-10-28 01:30:52 (Mon)
60852643200, # local_start 1929-05-06 00:00:00 (Mon)
60867759600, # local_end 1929-10-27 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60867768652, # utc_start 1929-10-28 01:30:52 (Mon)
60884101852, # utc_end 1930-05-05 02:30:52 (Mon)
60867756000, # local_start 1929-10-27 22:00:00 (Sun)
60884089200, # local_end 1930-05-04 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60884101852, # utc_start 1930-05-05 02:30:52 (Mon)
60899218252, # utc_end 1930-10-27 01:30:52 (Mon)
60884092800, # local_start 1930-05-05 00:00:00 (Mon)
60899209200, # local_end 1930-10-26 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60899218252, # utc_start 1930-10-27 01:30:52 (Mon)
60915551452, # utc_end 1931-05-04 02:30:52 (Mon)
60899205600, # local_start 1930-10-26 22:00:00 (Sun)
60915538800, # local_end 1931-05-03 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60915551452, # utc_start 1931-05-04 02:30:52 (Mon)
60930667852, # utc_end 1931-10-26 01:30:52 (Mon)
60915542400, # local_start 1931-05-04 00:00:00 (Mon)
60930658800, # local_end 1931-10-25 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60930667852, # utc_start 1931-10-26 01:30:52 (Mon)
60947001052, # utc_end 1932-05-02 02:30:52 (Mon)
60930655200, # local_start 1931-10-25 22:00:00 (Sun)
60946988400, # local_end 1932-05-01 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60947001052, # utc_start 1932-05-02 02:30:52 (Mon)
60962722252, # utc_end 1932-10-31 01:30:52 (Mon)
60946992000, # local_start 1932-05-02 00:00:00 (Mon)
60962713200, # local_end 1932-10-30 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60962722252, # utc_start 1932-10-31 01:30:52 (Mon)
60979055452, # utc_end 1933-05-08 02:30:52 (Mon)
60962709600, # local_start 1932-10-30 22:00:00 (Sun)
60979042800, # local_end 1933-05-07 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
60979055452, # utc_start 1933-05-08 02:30:52 (Mon)
60994171852, # utc_end 1933-10-30 01:30:52 (Mon)
60979046400, # local_start 1933-05-08 00:00:00 (Mon)
60994162800, # local_end 1933-10-29 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60994171852, # utc_start 1933-10-30 01:30:52 (Mon)
61010505052, # utc_end 1934-05-07 02:30:52 (Mon)
60994159200, # local_start 1933-10-29 22:00:00 (Sun)
61010492400, # local_end 1934-05-06 23:00:00 (Sun)
-12652,
0,
'NST',
],
[
61010505052, # utc_start 1934-05-07 02:30:52 (Mon)
61025621452, # utc_end 1934-10-29 01:30:52 (Mon)
61010496000, # local_start 1934-05-07 00:00:00 (Mon)
61025612400, # local_end 1934-10-28 23:00:00 (Sun)
-9052,
1,
'NDT',
],
[
61025621452, # utc_start 1934-10-29 01:30:52 (Mon)
61038761452, # utc_end 1935-03-30 03:30:52 (Sat)
61025608800, # local_start 1934-10-28 22:00:00 (Sun)
61038748800, # local_end 1935-03-30 00:00:00 (Sat)
-12652,
0,
'NST',
],
[
61038761452, # utc_start 1935-03-30 03:30:52 (Sat)
61041954600, # utc_end 1935-05-06 02:30:00 (Mon)
61038748852, # local_start 1935-03-30 00:00:52 (Sat)
61041942000, # local_end 1935-05-05 23:00:00 (Sun)
-12600,
0,
'NST',
],
[
61041954600, # utc_start 1935-05-06 02:30:00 (Mon)
61057071000, # utc_end 1935-10-28 01:30:00 (Mon)
61041945600, # local_start 1935-05-06 00:00:00 (Mon)
61057062000, # local_end 1935-10-27 23:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61057071000, # utc_start 1935-10-28 01:30:00 (Mon)
61074012600, # utc_end 1936-05-11 03:30:00 (Mon)
61057058400, # local_start 1935-10-27 22:00:00 (Sun)
61074000000, # local_end 1936-05-11 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61074012600, # utc_start 1936-05-11 03:30:00 (Mon)
61086709800, # utc_end 1936-10-05 02:30:00 (Mon)
61074003600, # local_start 1936-05-11 01:00:00 (Mon)
61086700800, # local_end 1936-10-05 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61086709800, # utc_start 1936-10-05 02:30:00 (Mon)
61105462200, # utc_end 1937-05-10 03:30:00 (Mon)
61086697200, # local_start 1936-10-04 23:00:00 (Sun)
61105449600, # local_end 1937-05-10 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61105462200, # utc_start 1937-05-10 03:30:00 (Mon)
61118159400, # utc_end 1937-10-04 02:30:00 (Mon)
61105453200, # local_start 1937-05-10 01:00:00 (Mon)
61118150400, # local_end 1937-10-04 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61118159400, # utc_start 1937-10-04 02:30:00 (Mon)
61136911800, # utc_end 1938-05-09 03:30:00 (Mon)
61118146800, # local_start 1937-10-03 23:00:00 (Sun)
61136899200, # local_end 1938-05-09 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61136911800, # utc_start 1938-05-09 03:30:00 (Mon)
61149609000, # utc_end 1938-10-03 02:30:00 (Mon)
61136902800, # local_start 1938-05-09 01:00:00 (Mon)
61149600000, # local_end 1938-10-03 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61149609000, # utc_start 1938-10-03 02:30:00 (Mon)
61168966200, # utc_end 1939-05-15 03:30:00 (Mon)
61149596400, # local_start 1938-10-02 23:00:00 (Sun)
61168953600, # local_end 1939-05-15 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61168966200, # utc_start 1939-05-15 03:30:00 (Mon)
61181058600, # utc_end 1939-10-02 02:30:00 (Mon)
61168957200, # local_start 1939-05-15 01:00:00 (Mon)
61181049600, # local_end 1939-10-02 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61181058600, # utc_start 1939-10-02 02:30:00 (Mon)
61200415800, # utc_end 1940-05-13 03:30:00 (Mon)
61181046000, # local_start 1939-10-01 23:00:00 (Sun)
61200403200, # local_end 1940-05-13 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61200415800, # utc_start 1940-05-13 03:30:00 (Mon)
61213113000, # utc_end 1940-10-07 02:30:00 (Mon)
61200406800, # local_start 1940-05-13 01:00:00 (Mon)
61213104000, # local_end 1940-10-07 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61213113000, # utc_start 1940-10-07 02:30:00 (Mon)
61231865400, # utc_end 1941-05-12 03:30:00 (Mon)
61213100400, # local_start 1940-10-06 23:00:00 (Sun)
61231852800, # local_end 1941-05-12 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61231865400, # utc_start 1941-05-12 03:30:00 (Mon)
61244562600, # utc_end 1941-10-06 02:30:00 (Mon)
61231856400, # local_start 1941-05-12 01:00:00 (Mon)
61244553600, # local_end 1941-10-06 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61244562600, # utc_start 1941-10-06 02:30:00 (Mon)
61263315000, # utc_end 1942-05-11 03:30:00 (Mon)
61244550000, # local_start 1941-10-05 23:00:00 (Sun)
61263302400, # local_end 1942-05-11 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61263315000, # utc_start 1942-05-11 03:30:00 (Mon)
61366287600, # utc_end 1945-08-14 23:00:00 (Tue)
61263306000, # local_start 1942-05-11 01:00:00 (Mon)
61366278600, # local_end 1945-08-14 20:30:00 (Tue)
-9000,
1,
'NWT',
],
[
61366287600, # utc_start 1945-08-14 23:00:00 (Tue)
61370281800, # utc_end 1945-09-30 04:30:00 (Sun)
61366278600, # local_start 1945-08-14 20:30:00 (Tue)
61370272800, # local_end 1945-09-30 02:00:00 (Sun)
-9000,
1,
'NPT',
],
[
61370281800, # utc_start 1945-09-30 04:30:00 (Sun)
61378313400, # utc_end 1946-01-01 03:30:00 (Tue)
61370269200, # local_start 1945-09-30 01:00:00 (Sun)
61378300800, # local_end 1946-01-01 00:00:00 (Tue)
-12600,
0,
'NST',
],
[
61378313400, # utc_start 1946-01-01 03:30:00 (Tue)
61389639000, # utc_end 1946-05-12 05:30:00 (Sun)
61378300800, # local_start 1946-01-01 00:00:00 (Tue)
61389626400, # local_end 1946-05-12 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61389639000, # utc_start 1946-05-12 05:30:00 (Sun)
61402336200, # utc_end 1946-10-06 04:30:00 (Sun)
61389630000, # local_start 1946-05-12 03:00:00 (Sun)
61402327200, # local_end 1946-10-06 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61402336200, # utc_start 1946-10-06 04:30:00 (Sun)
61421088600, # utc_end 1947-05-11 05:30:00 (Sun)
61402323600, # local_start 1946-10-06 01:00:00 (Sun)
61421076000, # local_end 1947-05-11 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61421088600, # utc_start 1947-05-11 05:30:00 (Sun)
61433785800, # utc_end 1947-10-05 04:30:00 (Sun)
61421079600, # local_start 1947-05-11 03:00:00 (Sun)
61433776800, # local_end 1947-10-05 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61433785800, # utc_start 1947-10-05 04:30:00 (Sun)
61452538200, # utc_end 1948-05-09 05:30:00 (Sun)
61433773200, # local_start 1947-10-05 01:00:00 (Sun)
61452525600, # local_end 1948-05-09 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61452538200, # utc_start 1948-05-09 05:30:00 (Sun)
61465235400, # utc_end 1948-10-03 04:30:00 (Sun)
61452529200, # local_start 1948-05-09 03:00:00 (Sun)
61465226400, # local_end 1948-10-03 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61465235400, # utc_start 1948-10-03 04:30:00 (Sun)
61483987800, # utc_end 1949-05-08 05:30:00 (Sun)
61465222800, # local_start 1948-10-03 01:00:00 (Sun)
61483975200, # local_end 1949-05-08 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61483987800, # utc_start 1949-05-08 05:30:00 (Sun)
61496685000, # utc_end 1949-10-02 04:30:00 (Sun)
61483978800, # local_start 1949-05-08 03:00:00 (Sun)
61496676000, # local_end 1949-10-02 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61496685000, # utc_start 1949-10-02 04:30:00 (Sun)
61516042200, # utc_end 1950-05-14 05:30:00 (Sun)
61496672400, # local_start 1949-10-02 01:00:00 (Sun)
61516029600, # local_end 1950-05-14 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61516042200, # utc_start 1950-05-14 05:30:00 (Sun)
61528739400, # utc_end 1950-10-08 04:30:00 (Sun)
61516033200, # local_start 1950-05-14 03:00:00 (Sun)
61528730400, # local_end 1950-10-08 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61528739400, # utc_start 1950-10-08 04:30:00 (Sun)
61546282200, # utc_end 1951-04-29 05:30:00 (Sun)
61528726800, # local_start 1950-10-08 01:00:00 (Sun)
61546269600, # local_end 1951-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61546282200, # utc_start 1951-04-29 05:30:00 (Sun)
61559584200, # utc_end 1951-09-30 04:30:00 (Sun)
61546273200, # local_start 1951-04-29 03:00:00 (Sun)
61559575200, # local_end 1951-09-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61559584200, # utc_start 1951-09-30 04:30:00 (Sun)
61577731800, # utc_end 1952-04-27 05:30:00 (Sun)
61559571600, # local_start 1951-09-30 01:00:00 (Sun)
61577719200, # local_end 1952-04-27 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61577731800, # utc_start 1952-04-27 05:30:00 (Sun)
61591033800, # utc_end 1952-09-28 04:30:00 (Sun)
61577722800, # local_start 1952-04-27 03:00:00 (Sun)
61591024800, # local_end 1952-09-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61591033800, # utc_start 1952-09-28 04:30:00 (Sun)
61609181400, # utc_end 1953-04-26 05:30:00 (Sun)
61591021200, # local_start 1952-09-28 01:00:00 (Sun)
61609168800, # local_end 1953-04-26 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61609181400, # utc_start 1953-04-26 05:30:00 (Sun)
61622483400, # utc_end 1953-09-27 04:30:00 (Sun)
61609172400, # local_start 1953-04-26 03:00:00 (Sun)
61622474400, # local_end 1953-09-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61622483400, # utc_start 1953-09-27 04:30:00 (Sun)
61640631000, # utc_end 1954-04-25 05:30:00 (Sun)
61622470800, # local_start 1953-09-27 01:00:00 (Sun)
61640618400, # local_end 1954-04-25 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61640631000, # utc_start 1954-04-25 05:30:00 (Sun)
61653933000, # utc_end 1954-09-26 04:30:00 (Sun)
61640622000, # local_start 1954-04-25 03:00:00 (Sun)
61653924000, # local_end 1954-09-26 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61653933000, # utc_start 1954-09-26 04:30:00 (Sun)
61672080600, # utc_end 1955-04-24 05:30:00 (Sun)
61653920400, # local_start 1954-09-26 01:00:00 (Sun)
61672068000, # local_end 1955-04-24 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61672080600, # utc_start 1955-04-24 05:30:00 (Sun)
61685382600, # utc_end 1955-09-25 04:30:00 (Sun)
61672071600, # local_start 1955-04-24 03:00:00 (Sun)
61685373600, # local_end 1955-09-25 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61685382600, # utc_start 1955-09-25 04:30:00 (Sun)
61704135000, # utc_end 1956-04-29 05:30:00 (Sun)
61685370000, # local_start 1955-09-25 01:00:00 (Sun)
61704122400, # local_end 1956-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61704135000, # utc_start 1956-04-29 05:30:00 (Sun)
61717437000, # utc_end 1956-09-30 04:30:00 (Sun)
61704126000, # local_start 1956-04-29 03:00:00 (Sun)
61717428000, # local_end 1956-09-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61717437000, # utc_start 1956-09-30 04:30:00 (Sun)
61735584600, # utc_end 1957-04-28 05:30:00 (Sun)
61717424400, # local_start 1956-09-30 01:00:00 (Sun)
61735572000, # local_end 1957-04-28 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61735584600, # utc_start 1957-04-28 05:30:00 (Sun)
61748886600, # utc_end 1957-09-29 04:30:00 (Sun)
61735575600, # local_start 1957-04-28 03:00:00 (Sun)
61748877600, # local_end 1957-09-29 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61748886600, # utc_start 1957-09-29 04:30:00 (Sun)
61767034200, # utc_end 1958-04-27 05:30:00 (Sun)
61748874000, # local_start 1957-09-29 01:00:00 (Sun)
61767021600, # local_end 1958-04-27 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61767034200, # utc_start 1958-04-27 05:30:00 (Sun)
61780336200, # utc_end 1958-09-28 04:30:00 (Sun)
61767025200, # local_start 1958-04-27 03:00:00 (Sun)
61780327200, # local_end 1958-09-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61780336200, # utc_start 1958-09-28 04:30:00 (Sun)
61798483800, # utc_end 1959-04-26 05:30:00 (Sun)
61780323600, # local_start 1958-09-28 01:00:00 (Sun)
61798471200, # local_end 1959-04-26 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61798483800, # utc_start 1959-04-26 05:30:00 (Sun)
61811785800, # utc_end 1959-09-27 04:30:00 (Sun)
61798474800, # local_start 1959-04-26 03:00:00 (Sun)
61811776800, # local_end 1959-09-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61811785800, # utc_start 1959-09-27 04:30:00 (Sun)
61829933400, # utc_end 1960-04-24 05:30:00 (Sun)
61811773200, # local_start 1959-09-27 01:00:00 (Sun)
61829920800, # local_end 1960-04-24 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61829933400, # utc_start 1960-04-24 05:30:00 (Sun)
61846259400, # utc_end 1960-10-30 04:30:00 (Sun)
61829924400, # local_start 1960-04-24 03:00:00 (Sun)
61846250400, # local_end 1960-10-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61846259400, # utc_start 1960-10-30 04:30:00 (Sun)
61861987800, # utc_end 1961-04-30 05:30:00 (Sun)
61846246800, # local_start 1960-10-30 01:00:00 (Sun)
61861975200, # local_end 1961-04-30 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61861987800, # utc_start 1961-04-30 05:30:00 (Sun)
61877709000, # utc_end 1961-10-29 04:30:00 (Sun)
61861978800, # local_start 1961-04-30 03:00:00 (Sun)
61877700000, # local_end 1961-10-29 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61877709000, # utc_start 1961-10-29 04:30:00 (Sun)
61893437400, # utc_end 1962-04-29 05:30:00 (Sun)
61877696400, # local_start 1961-10-29 01:00:00 (Sun)
61893424800, # local_end 1962-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61893437400, # utc_start 1962-04-29 05:30:00 (Sun)
61909158600, # utc_end 1962-10-28 04:30:00 (Sun)
61893428400, # local_start 1962-04-29 03:00:00 (Sun)
61909149600, # local_end 1962-10-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61909158600, # utc_start 1962-10-28 04:30:00 (Sun)
61924887000, # utc_end 1963-04-28 05:30:00 (Sun)
61909146000, # local_start 1962-10-28 01:00:00 (Sun)
61924874400, # local_end 1963-04-28 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61924887000, # utc_start 1963-04-28 05:30:00 (Sun)
61940608200, # utc_end 1963-10-27 04:30:00 (Sun)
61924878000, # local_start 1963-04-28 03:00:00 (Sun)
61940599200, # local_end 1963-10-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61940608200, # utc_start 1963-10-27 04:30:00 (Sun)
61956336600, # utc_end 1964-04-26 05:30:00 (Sun)
61940595600, # local_start 1963-10-27 01:00:00 (Sun)
61956324000, # local_end 1964-04-26 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61956336600, # utc_start 1964-04-26 05:30:00 (Sun)
61972057800, # utc_end 1964-10-25 04:30:00 (Sun)
61956327600, # local_start 1964-04-26 03:00:00 (Sun)
61972048800, # local_end 1964-10-25 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61972057800, # utc_start 1964-10-25 04:30:00 (Sun)
61987786200, # utc_end 1965-04-25 05:30:00 (Sun)
61972045200, # local_start 1964-10-25 01:00:00 (Sun)
61987773600, # local_end 1965-04-25 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61987786200, # utc_start 1965-04-25 05:30:00 (Sun)
62004112200, # utc_end 1965-10-31 04:30:00 (Sun)
61987777200, # local_start 1965-04-25 03:00:00 (Sun)
62004103200, # local_end 1965-10-31 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62004112200, # utc_start 1965-10-31 04:30:00 (Sun)
62019235800, # utc_end 1966-04-24 05:30:00 (Sun)
62004099600, # local_start 1965-10-31 01:00:00 (Sun)
62019223200, # local_end 1966-04-24 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62019235800, # utc_start 1966-04-24 05:30:00 (Sun)
62035561800, # utc_end 1966-10-30 04:30:00 (Sun)
62019226800, # local_start 1966-04-24 03:00:00 (Sun)
62035552800, # local_end 1966-10-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62035561800, # utc_start 1966-10-30 04:30:00 (Sun)
62051290200, # utc_end 1967-04-30 05:30:00 (Sun)
62035549200, # local_start 1966-10-30 01:00:00 (Sun)
62051277600, # local_end 1967-04-30 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62051290200, # utc_start 1967-04-30 05:30:00 (Sun)
62067011400, # utc_end 1967-10-29 04:30:00 (Sun)
62051281200, # local_start 1967-04-30 03:00:00 (Sun)
62067002400, # local_end 1967-10-29 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62067011400, # utc_start 1967-10-29 04:30:00 (Sun)
62082739800, # utc_end 1968-04-28 05:30:00 (Sun)
62066998800, # local_start 1967-10-29 01:00:00 (Sun)
62082727200, # local_end 1968-04-28 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62082739800, # utc_start 1968-04-28 05:30:00 (Sun)
62098461000, # utc_end 1968-10-27 04:30:00 (Sun)
62082730800, # local_start 1968-04-28 03:00:00 (Sun)
62098452000, # local_end 1968-10-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62098461000, # utc_start 1968-10-27 04:30:00 (Sun)
62114189400, # utc_end 1969-04-27 05:30:00 (Sun)
62098448400, # local_start 1968-10-27 01:00:00 (Sun)
62114176800, # local_end 1969-04-27 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62114189400, # utc_start 1969-04-27 05:30:00 (Sun)
62129910600, # utc_end 1969-10-26 04:30:00 (Sun)
62114180400, # local_start 1969-04-27 03:00:00 (Sun)
62129901600, # local_end 1969-10-26 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62129910600, # utc_start 1969-10-26 04:30:00 (Sun)
62145639000, # utc_end 1970-04-26 05:30:00 (Sun)
62129898000, # local_start 1969-10-26 01:00:00 (Sun)
62145626400, # local_end 1970-04-26 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62145639000, # utc_start 1970-04-26 05:30:00 (Sun)
62161360200, # utc_end 1970-10-25 04:30:00 (Sun)
62145630000, # local_start 1970-04-26 03:00:00 (Sun)
62161351200, # local_end 1970-10-25 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62161360200, # utc_start 1970-10-25 04:30:00 (Sun)
62177088600, # utc_end 1971-04-25 05:30:00 (Sun)
62161347600, # local_start 1970-10-25 01:00:00 (Sun)
62177076000, # local_end 1971-04-25 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62177088600, # utc_start 1971-04-25 05:30:00 (Sun)
62193414600, # utc_end 1971-10-31 04:30:00 (Sun)
62177079600, # local_start 1971-04-25 03:00:00 (Sun)
62193405600, # local_end 1971-10-31 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62193414600, # utc_start 1971-10-31 04:30:00 (Sun)
62209143000, # utc_end 1972-04-30 05:30:00 (Sun)
62193402000, # local_start 1971-10-31 01:00:00 (Sun)
62209130400, # local_end 1972-04-30 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62209143000, # utc_start 1972-04-30 05:30:00 (Sun)
62224864200, # utc_end 1972-10-29 04:30:00 (Sun)
62209134000, # local_start 1972-04-30 03:00:00 (Sun)
62224855200, # local_end 1972-10-29 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62224864200, # utc_start 1972-10-29 04:30:00 (Sun)
62240592600, # utc_end 1973-04-29 05:30:00 (Sun)
62224851600, # local_start 1972-10-29 01:00:00 (Sun)
62240580000, # local_end 1973-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62240592600, # utc_start 1973-04-29 05:30:00 (Sun)
62256313800, # utc_end 1973-10-28 04:30:00 (Sun)
62240583600, # local_start 1973-04-29 03:00:00 (Sun)
62256304800, # local_end 1973-10-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62256313800, # utc_start 1973-10-28 04:30:00 (Sun)
62272042200, # utc_end 1974-04-28 05:30:00 (Sun)
62256301200, # local_start 1973-10-28 01:00:00 (Sun)
62272029600, # local_end 1974-04-28 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62272042200, # utc_start 1974-04-28 05:30:00 (Sun)
62287763400, # utc_end 1974-10-27 04:30:00 (Sun)
62272033200, # local_start 1974-04-28 03:00:00 (Sun)
62287754400, # local_end 1974-10-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62287763400, # utc_start 1974-10-27 04:30:00 (Sun)
62303491800, # utc_end 1975-04-27 05:30:00 (Sun)
62287750800, # local_start 1974-10-27 01:00:00 (Sun)
62303479200, # local_end 1975-04-27 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62303491800, # utc_start 1975-04-27 05:30:00 (Sun)
62319213000, # utc_end 1975-10-26 04:30:00 (Sun)
62303482800, # local_start 1975-04-27 03:00:00 (Sun)
62319204000, # local_end 1975-10-26 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62319213000, # utc_start 1975-10-26 04:30:00 (Sun)
62334941400, # utc_end 1976-04-25 05:30:00 (Sun)
62319200400, # local_start 1975-10-26 01:00:00 (Sun)
62334928800, # local_end 1976-04-25 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62334941400, # utc_start 1976-04-25 05:30:00 (Sun)
62351267400, # utc_end 1976-10-31 04:30:00 (Sun)
62334932400, # local_start 1976-04-25 03:00:00 (Sun)
62351258400, # local_end 1976-10-31 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62351267400, # utc_start 1976-10-31 04:30:00 (Sun)
62366391000, # utc_end 1977-04-24 05:30:00 (Sun)
62351254800, # local_start 1976-10-31 01:00:00 (Sun)
62366378400, # local_end 1977-04-24 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62366391000, # utc_start 1977-04-24 05:30:00 (Sun)
62382717000, # utc_end 1977-10-30 04:30:00 (Sun)
62366382000, # local_start 1977-04-24 03:00:00 (Sun)
62382708000, # local_end 1977-10-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62382717000, # utc_start 1977-10-30 04:30:00 (Sun)
62398445400, # utc_end 1978-04-30 05:30:00 (Sun)
62382704400, # local_start 1977-10-30 01:00:00 (Sun)
62398432800, # local_end 1978-04-30 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62398445400, # utc_start 1978-04-30 05:30:00 (Sun)
62414166600, # utc_end 1978-10-29 04:30:00 (Sun)
62398436400, # local_start 1978-04-30 03:00:00 (Sun)
62414157600, # local_end 1978-10-29 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62414166600, # utc_start 1978-10-29 04:30:00 (Sun)
62429895000, # utc_end 1979-04-29 05:30:00 (Sun)
62414154000, # local_start 1978-10-29 01:00:00 (Sun)
62429882400, # local_end 1979-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62429895000, # utc_start 1979-04-29 05:30:00 (Sun)
62445616200, # utc_end 1979-10-28 04:30:00 (Sun)
62429886000, # local_start 1979-04-29 03:00:00 (Sun)
62445607200, # local_end 1979-10-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62445616200, # utc_start 1979-10-28 04:30:00 (Sun)
62461344600, # utc_end 1980-04-27 05:30:00 (Sun)
62445603600, # local_start 1979-10-28 01:00:00 (Sun)
62461332000, # local_end 1980-04-27 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62461344600, # utc_start 1980-04-27 05:30:00 (Sun)
62477065800, # utc_end 1980-10-26 04:30:00 (Sun)
62461335600, # local_start 1980-04-27 03:00:00 (Sun)
62477056800, # local_end 1980-10-26 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62477065800, # utc_start 1980-10-26 04:30:00 (Sun)
62492794200, # utc_end 1981-04-26 05:30:00 (Sun)
62477053200, # local_start 1980-10-26 01:00:00 (Sun)
62492781600, # local_end 1981-04-26 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62492794200, # utc_start 1981-04-26 05:30:00 (Sun)
62508515400, # utc_end 1981-10-25 04:30:00 (Sun)
62492785200, # local_start 1981-04-26 03:00:00 (Sun)
62508506400, # local_end 1981-10-25 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62508515400, # utc_start 1981-10-25 04:30:00 (Sun)
62524243800, # utc_end 1982-04-25 05:30:00 (Sun)
62508502800, # local_start 1981-10-25 01:00:00 (Sun)
62524231200, # local_end 1982-04-25 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62524243800, # utc_start 1982-04-25 05:30:00 (Sun)
62540569800, # utc_end 1982-10-31 04:30:00 (Sun)
62524234800, # local_start 1982-04-25 03:00:00 (Sun)
62540560800, # local_end 1982-10-31 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62540569800, # utc_start 1982-10-31 04:30:00 (Sun)
62555693400, # utc_end 1983-04-24 05:30:00 (Sun)
62540557200, # local_start 1982-10-31 01:00:00 (Sun)
62555680800, # local_end 1983-04-24 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62555693400, # utc_start 1983-04-24 05:30:00 (Sun)
62572019400, # utc_end 1983-10-30 04:30:00 (Sun)
62555684400, # local_start 1983-04-24 03:00:00 (Sun)
62572010400, # local_end 1983-10-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62572019400, # utc_start 1983-10-30 04:30:00 (Sun)
62587747800, # utc_end 1984-04-29 05:30:00 (Sun)
62572006800, # local_start 1983-10-30 01:00:00 (Sun)
62587735200, # local_end 1984-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62587747800, # utc_start 1984-04-29 05:30:00 (Sun)
62603469000, # utc_end 1984-10-28 04:30:00 (Sun)
62587738800, # local_start 1984-04-29 03:00:00 (Sun)
62603460000, # local_end 1984-10-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62603469000, # utc_start 1984-10-28 04:30:00 (Sun)
62619197400, # utc_end 1985-04-28 05:30:00 (Sun)
62603456400, # local_start 1984-10-28 01:00:00 (Sun)
62619184800, # local_end 1985-04-28 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62619197400, # utc_start 1985-04-28 05:30:00 (Sun)
62634918600, # utc_end 1985-10-27 04:30:00 (Sun)
62619188400, # local_start 1985-04-28 03:00:00 (Sun)
62634909600, # local_end 1985-10-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62634918600, # utc_start 1985-10-27 04:30:00 (Sun)
62650647000, # utc_end 1986-04-27 05:30:00 (Sun)
62634906000, # local_start 1985-10-27 01:00:00 (Sun)
62650634400, # local_end 1986-04-27 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
62650647000, # utc_start 1986-04-27 05:30:00 (Sun)
62666368200, # utc_end 1986-10-26 04:30:00 (Sun)
62650638000, # local_start 1986-04-27 03:00:00 (Sun)
62666359200, # local_end 1986-10-26 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62666368200, # utc_start 1986-10-26 04:30:00 (Sun)
62680275060, # utc_end 1987-04-05 03:31:00 (Sun)
62666355600, # local_start 1986-10-26 01:00:00 (Sun)
62680262460, # local_end 1987-04-05 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62680275060, # utc_start 1987-04-05 03:31:00 (Sun)
62697810660, # utc_end 1987-10-25 02:31:00 (Sun)
62680266060, # local_start 1987-04-05 01:01:00 (Sun)
62697801660, # local_end 1987-10-25 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62697810660, # utc_start 1987-10-25 02:31:00 (Sun)
62711724660, # utc_end 1988-04-03 03:31:00 (Sun)
62697798060, # local_start 1987-10-24 23:01:00 (Sat)
62711712060, # local_end 1988-04-03 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62711724660, # utc_start 1988-04-03 03:31:00 (Sun)
62729861460, # utc_end 1988-10-30 01:31:00 (Sun)
62711719260, # local_start 1988-04-03 02:01:00 (Sun)
62729856060, # local_end 1988-10-30 00:01:00 (Sun)
-5400,
1,
'NDDT',
],
[
62729861460, # utc_start 1988-10-30 01:31:00 (Sun)
62743174260, # utc_end 1989-04-02 03:31:00 (Sun)
62729848860, # local_start 1988-10-29 22:01:00 (Sat)
62743161660, # local_end 1989-04-02 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62743174260, # utc_start 1989-04-02 03:31:00 (Sun)
62761314660, # utc_end 1989-10-29 02:31:00 (Sun)
62743165260, # local_start 1989-04-02 01:01:00 (Sun)
62761305660, # local_end 1989-10-29 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62761314660, # utc_start 1989-10-29 02:31:00 (Sun)
62774623860, # utc_end 1990-04-01 03:31:00 (Sun)
62761302060, # local_start 1989-10-28 23:01:00 (Sat)
62774611260, # local_end 1990-04-01 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62774623860, # utc_start 1990-04-01 03:31:00 (Sun)
62792764260, # utc_end 1990-10-28 02:31:00 (Sun)
62774614860, # local_start 1990-04-01 01:01:00 (Sun)
62792755260, # local_end 1990-10-28 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62792764260, # utc_start 1990-10-28 02:31:00 (Sun)
62806678260, # utc_end 1991-04-07 03:31:00 (Sun)
62792751660, # local_start 1990-10-27 23:01:00 (Sat)
62806665660, # local_end 1991-04-07 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62806678260, # utc_start 1991-04-07 03:31:00 (Sun)
62824213860, # utc_end 1991-10-27 02:31:00 (Sun)
62806669260, # local_start 1991-04-07 01:01:00 (Sun)
62824204860, # local_end 1991-10-27 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62824213860, # utc_start 1991-10-27 02:31:00 (Sun)
62838127860, # utc_end 1992-04-05 03:31:00 (Sun)
62824201260, # local_start 1991-10-26 23:01:00 (Sat)
62838115260, # local_end 1992-04-05 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62838127860, # utc_start 1992-04-05 03:31:00 (Sun)
62855663460, # utc_end 1992-10-25 02:31:00 (Sun)
62838118860, # local_start 1992-04-05 01:01:00 (Sun)
62855654460, # local_end 1992-10-25 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62855663460, # utc_start 1992-10-25 02:31:00 (Sun)
62869577460, # utc_end 1993-04-04 03:31:00 (Sun)
62855650860, # local_start 1992-10-24 23:01:00 (Sat)
62869564860, # local_end 1993-04-04 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62869577460, # utc_start 1993-04-04 03:31:00 (Sun)
62887717860, # utc_end 1993-10-31 02:31:00 (Sun)
62869568460, # local_start 1993-04-04 01:01:00 (Sun)
62887708860, # local_end 1993-10-31 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62887717860, # utc_start 1993-10-31 02:31:00 (Sun)
62901027060, # utc_end 1994-04-03 03:31:00 (Sun)
62887705260, # local_start 1993-10-30 23:01:00 (Sat)
62901014460, # local_end 1994-04-03 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62901027060, # utc_start 1994-04-03 03:31:00 (Sun)
62919167460, # utc_end 1994-10-30 02:31:00 (Sun)
62901018060, # local_start 1994-04-03 01:01:00 (Sun)
62919158460, # local_end 1994-10-30 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62919167460, # utc_start 1994-10-30 02:31:00 (Sun)
62932476660, # utc_end 1995-04-02 03:31:00 (Sun)
62919154860, # local_start 1994-10-29 23:01:00 (Sat)
62932464060, # local_end 1995-04-02 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62932476660, # utc_start 1995-04-02 03:31:00 (Sun)
62950617060, # utc_end 1995-10-29 02:31:00 (Sun)
62932467660, # local_start 1995-04-02 01:01:00 (Sun)
62950608060, # local_end 1995-10-29 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62950617060, # utc_start 1995-10-29 02:31:00 (Sun)
62964531060, # utc_end 1996-04-07 03:31:00 (Sun)
62950604460, # local_start 1995-10-28 23:01:00 (Sat)
62964518460, # local_end 1996-04-07 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62964531060, # utc_start 1996-04-07 03:31:00 (Sun)
62982066660, # utc_end 1996-10-27 02:31:00 (Sun)
62964522060, # local_start 1996-04-07 01:01:00 (Sun)
62982057660, # local_end 1996-10-27 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
62982066660, # utc_start 1996-10-27 02:31:00 (Sun)
62995980660, # utc_end 1997-04-06 03:31:00 (Sun)
62982054060, # local_start 1996-10-26 23:01:00 (Sat)
62995968060, # local_end 1997-04-06 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
62995980660, # utc_start 1997-04-06 03:31:00 (Sun)
63013516260, # utc_end 1997-10-26 02:31:00 (Sun)
62995971660, # local_start 1997-04-06 01:01:00 (Sun)
63013507260, # local_end 1997-10-26 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63013516260, # utc_start 1997-10-26 02:31:00 (Sun)
63027430260, # utc_end 1998-04-05 03:31:00 (Sun)
63013503660, # local_start 1997-10-25 23:01:00 (Sat)
63027417660, # local_end 1998-04-05 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63027430260, # utc_start 1998-04-05 03:31:00 (Sun)
63044965860, # utc_end 1998-10-25 02:31:00 (Sun)
63027421260, # local_start 1998-04-05 01:01:00 (Sun)
63044956860, # local_end 1998-10-25 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63044965860, # utc_start 1998-10-25 02:31:00 (Sun)
63058879860, # utc_end 1999-04-04 03:31:00 (Sun)
63044953260, # local_start 1998-10-24 23:01:00 (Sat)
63058867260, # local_end 1999-04-04 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63058879860, # utc_start 1999-04-04 03:31:00 (Sun)
63077020260, # utc_end 1999-10-31 02:31:00 (Sun)
63058870860, # local_start 1999-04-04 01:01:00 (Sun)
63077011260, # local_end 1999-10-31 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63077020260, # utc_start 1999-10-31 02:31:00 (Sun)
63090329460, # utc_end 2000-04-02 03:31:00 (Sun)
63077007660, # local_start 1999-10-30 23:01:00 (Sat)
63090316860, # local_end 2000-04-02 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63090329460, # utc_start 2000-04-02 03:31:00 (Sun)
63108469860, # utc_end 2000-10-29 02:31:00 (Sun)
63090320460, # local_start 2000-04-02 01:01:00 (Sun)
63108460860, # local_end 2000-10-29 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63108469860, # utc_start 2000-10-29 02:31:00 (Sun)
63121779060, # utc_end 2001-04-01 03:31:00 (Sun)
63108457260, # local_start 2000-10-28 23:01:00 (Sat)
63121766460, # local_end 2001-04-01 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63121779060, # utc_start 2001-04-01 03:31:00 (Sun)
63139919460, # utc_end 2001-10-28 02:31:00 (Sun)
63121770060, # local_start 2001-04-01 01:01:00 (Sun)
63139910460, # local_end 2001-10-28 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63139919460, # utc_start 2001-10-28 02:31:00 (Sun)
63153833460, # utc_end 2002-04-07 03:31:00 (Sun)
63139906860, # local_start 2001-10-27 23:01:00 (Sat)
63153820860, # local_end 2002-04-07 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63153833460, # utc_start 2002-04-07 03:31:00 (Sun)
63171369060, # utc_end 2002-10-27 02:31:00 (Sun)
63153824460, # local_start 2002-04-07 01:01:00 (Sun)
63171360060, # local_end 2002-10-27 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63171369060, # utc_start 2002-10-27 02:31:00 (Sun)
63185283060, # utc_end 2003-04-06 03:31:00 (Sun)
63171356460, # local_start 2002-10-26 23:01:00 (Sat)
63185270460, # local_end 2003-04-06 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63185283060, # utc_start 2003-04-06 03:31:00 (Sun)
63202818660, # utc_end 2003-10-26 02:31:00 (Sun)
63185274060, # local_start 2003-04-06 01:01:00 (Sun)
63202809660, # local_end 2003-10-26 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63202818660, # utc_start 2003-10-26 02:31:00 (Sun)
63216732660, # utc_end 2004-04-04 03:31:00 (Sun)
63202806060, # local_start 2003-10-25 23:01:00 (Sat)
63216720060, # local_end 2004-04-04 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63216732660, # utc_start 2004-04-04 03:31:00 (Sun)
63234873060, # utc_end 2004-10-31 02:31:00 (Sun)
63216723660, # local_start 2004-04-04 01:01:00 (Sun)
63234864060, # local_end 2004-10-31 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63234873060, # utc_start 2004-10-31 02:31:00 (Sun)
63248182260, # utc_end 2005-04-03 03:31:00 (Sun)
63234860460, # local_start 2004-10-30 23:01:00 (Sat)
63248169660, # local_end 2005-04-03 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63248182260, # utc_start 2005-04-03 03:31:00 (Sun)
63266322660, # utc_end 2005-10-30 02:31:00 (Sun)
63248173260, # local_start 2005-04-03 01:01:00 (Sun)
63266313660, # local_end 2005-10-30 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63266322660, # utc_start 2005-10-30 02:31:00 (Sun)
63279631860, # utc_end 2006-04-02 03:31:00 (Sun)
63266310060, # local_start 2005-10-29 23:01:00 (Sat)
63279619260, # local_end 2006-04-02 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63279631860, # utc_start 2006-04-02 03:31:00 (Sun)
63297772260, # utc_end 2006-10-29 02:31:00 (Sun)
63279622860, # local_start 2006-04-02 01:01:00 (Sun)
63297763260, # local_end 2006-10-29 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63297772260, # utc_start 2006-10-29 02:31:00 (Sun)
63309267060, # utc_end 2007-03-11 03:31:00 (Sun)
63297759660, # local_start 2006-10-28 23:01:00 (Sat)
63309254460, # local_end 2007-03-11 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63309267060, # utc_start 2007-03-11 03:31:00 (Sun)
63329826660, # utc_end 2007-11-04 02:31:00 (Sun)
63309258060, # local_start 2007-03-11 01:01:00 (Sun)
63329817660, # local_end 2007-11-04 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63329826660, # utc_start 2007-11-04 02:31:00 (Sun)
63340716660, # utc_end 2008-03-09 03:31:00 (Sun)
63329814060, # local_start 2007-11-03 23:01:00 (Sat)
63340704060, # local_end 2008-03-09 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63340716660, # utc_start 2008-03-09 03:31:00 (Sun)
63361276260, # utc_end 2008-11-02 02:31:00 (Sun)
63340707660, # local_start 2008-03-09 01:01:00 (Sun)
63361267260, # local_end 2008-11-02 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63361276260, # utc_start 2008-11-02 02:31:00 (Sun)
63372166260, # utc_end 2009-03-08 03:31:00 (Sun)
63361263660, # local_start 2008-11-01 23:01:00 (Sat)
63372153660, # local_end 2009-03-08 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63372166260, # utc_start 2009-03-08 03:31:00 (Sun)
63392725860, # utc_end 2009-11-01 02:31:00 (Sun)
63372157260, # local_start 2009-03-08 01:01:00 (Sun)
63392716860, # local_end 2009-11-01 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63392725860, # utc_start 2009-11-01 02:31:00 (Sun)
63404220660, # utc_end 2010-03-14 03:31:00 (Sun)
63392713260, # local_start 2009-10-31 23:01:00 (Sat)
63404208060, # local_end 2010-03-14 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63404220660, # utc_start 2010-03-14 03:31:00 (Sun)
63424780260, # utc_end 2010-11-07 02:31:00 (Sun)
63404211660, # local_start 2010-03-14 01:01:00 (Sun)
63424771260, # local_end 2010-11-07 00:01:00 (Sun)
-9000,
1,
'NDT',
],
[
63424780260, # utc_start 2010-11-07 02:31:00 (Sun)
63435670260, # utc_end 2011-03-13 03:31:00 (Sun)
63424767660, # local_start 2010-11-06 23:01:00 (Sat)
63435657660, # local_end 2011-03-13 00:01:00 (Sun)
-12600,
0,
'NST',
],
[
63435670260, # utc_start 2011-03-13 03:31:00 (Sun)
63455797800, # utc_end 2011-11-01 02:30:00 (Tue)
63435661260, # local_start 2011-03-13 01:01:00 (Sun)
63455788800, # local_end 2011-11-01 00:00:00 (Tue)
-9000,
1,
'NDT',
],
[
63455797800, # utc_start 2011-11-01 02:30:00 (Tue)
63456237000, # utc_end 2011-11-06 04:30:00 (Sun)
63455788800, # local_start 2011-11-01 00:00:00 (Tue)
63456228000, # local_end 2011-11-06 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63456237000, # utc_start 2011-11-06 04:30:00 (Sun)
63467127000, # utc_end 2012-03-11 05:30:00 (Sun)
63456224400, # local_start 2011-11-06 01:00:00 (Sun)
63467114400, # local_end 2012-03-11 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63467127000, # utc_start 2012-03-11 05:30:00 (Sun)
63487686600, # utc_end 2012-11-04 04:30:00 (Sun)
63467118000, # local_start 2012-03-11 03:00:00 (Sun)
63487677600, # local_end 2012-11-04 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63487686600, # utc_start 2012-11-04 04:30:00 (Sun)
63498576600, # utc_end 2013-03-10 05:30:00 (Sun)
63487674000, # local_start 2012-11-04 01:00:00 (Sun)
63498564000, # local_end 2013-03-10 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63498576600, # utc_start 2013-03-10 05:30:00 (Sun)
63519136200, # utc_end 2013-11-03 04:30:00 (Sun)
63498567600, # local_start 2013-03-10 03:00:00 (Sun)
63519127200, # local_end 2013-11-03 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63519136200, # utc_start 2013-11-03 04:30:00 (Sun)
63530026200, # utc_end 2014-03-09 05:30:00 (Sun)
63519123600, # local_start 2013-11-03 01:00:00 (Sun)
63530013600, # local_end 2014-03-09 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63530026200, # utc_start 2014-03-09 05:30:00 (Sun)
63550585800, # utc_end 2014-11-02 04:30:00 (Sun)
63530017200, # local_start 2014-03-09 03:00:00 (Sun)
63550576800, # local_end 2014-11-02 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63550585800, # utc_start 2014-11-02 04:30:00 (Sun)
63561475800, # utc_end 2015-03-08 05:30:00 (Sun)
63550573200, # local_start 2014-11-02 01:00:00 (Sun)
63561463200, # local_end 2015-03-08 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63561475800, # utc_start 2015-03-08 05:30:00 (Sun)
63582035400, # utc_end 2015-11-01 04:30:00 (Sun)
63561466800, # local_start 2015-03-08 03:00:00 (Sun)
63582026400, # local_end 2015-11-01 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63582035400, # utc_start 2015-11-01 04:30:00 (Sun)
63593530200, # utc_end 2016-03-13 05:30:00 (Sun)
63582022800, # local_start 2015-11-01 01:00:00 (Sun)
63593517600, # local_end 2016-03-13 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63593530200, # utc_start 2016-03-13 05:30:00 (Sun)
63614089800, # utc_end 2016-11-06 04:30:00 (Sun)
63593521200, # local_start 2016-03-13 03:00:00 (Sun)
63614080800, # local_end 2016-11-06 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63614089800, # utc_start 2016-11-06 04:30:00 (Sun)
63624979800, # utc_end 2017-03-12 05:30:00 (Sun)
63614077200, # local_start 2016-11-06 01:00:00 (Sun)
63624967200, # local_end 2017-03-12 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63624979800, # utc_start 2017-03-12 05:30:00 (Sun)
63645539400, # utc_end 2017-11-05 04:30:00 (Sun)
63624970800, # local_start 2017-03-12 03:00:00 (Sun)
63645530400, # local_end 2017-11-05 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63645539400, # utc_start 2017-11-05 04:30:00 (Sun)
63656429400, # utc_end 2018-03-11 05:30:00 (Sun)
63645526800, # local_start 2017-11-05 01:00:00 (Sun)
63656416800, # local_end 2018-03-11 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63656429400, # utc_start 2018-03-11 05:30:00 (Sun)
63676989000, # utc_end 2018-11-04 04:30:00 (Sun)
63656420400, # local_start 2018-03-11 03:00:00 (Sun)
63676980000, # local_end 2018-11-04 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63676989000, # utc_start 2018-11-04 04:30:00 (Sun)
63687879000, # utc_end 2019-03-10 05:30:00 (Sun)
63676976400, # local_start 2018-11-04 01:00:00 (Sun)
63687866400, # local_end 2019-03-10 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63687879000, # utc_start 2019-03-10 05:30:00 (Sun)
63708438600, # utc_end 2019-11-03 04:30:00 (Sun)
63687870000, # local_start 2019-03-10 03:00:00 (Sun)
63708429600, # local_end 2019-11-03 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63708438600, # utc_start 2019-11-03 04:30:00 (Sun)
63719328600, # utc_end 2020-03-08 05:30:00 (Sun)
63708426000, # local_start 2019-11-03 01:00:00 (Sun)
63719316000, # local_end 2020-03-08 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63719328600, # utc_start 2020-03-08 05:30:00 (Sun)
63739888200, # utc_end 2020-11-01 04:30:00 (Sun)
63719319600, # local_start 2020-03-08 03:00:00 (Sun)
63739879200, # local_end 2020-11-01 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63739888200, # utc_start 2020-11-01 04:30:00 (Sun)
63751383000, # utc_end 2021-03-14 05:30:00 (Sun)
63739875600, # local_start 2020-11-01 01:00:00 (Sun)
63751370400, # local_end 2021-03-14 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63751383000, # utc_start 2021-03-14 05:30:00 (Sun)
63771942600, # utc_end 2021-11-07 04:30:00 (Sun)
63751374000, # local_start 2021-03-14 03:00:00 (Sun)
63771933600, # local_end 2021-11-07 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63771942600, # utc_start 2021-11-07 04:30:00 (Sun)
63782832600, # utc_end 2022-03-13 05:30:00 (Sun)
63771930000, # local_start 2021-11-07 01:00:00 (Sun)
63782820000, # local_end 2022-03-13 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63782832600, # utc_start 2022-03-13 05:30:00 (Sun)
63803392200, # utc_end 2022-11-06 04:30:00 (Sun)
63782823600, # local_start 2022-03-13 03:00:00 (Sun)
63803383200, # local_end 2022-11-06 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63803392200, # utc_start 2022-11-06 04:30:00 (Sun)
63814282200, # utc_end 2023-03-12 05:30:00 (Sun)
63803379600, # local_start 2022-11-06 01:00:00 (Sun)
63814269600, # local_end 2023-03-12 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63814282200, # utc_start 2023-03-12 05:30:00 (Sun)
63834841800, # utc_end 2023-11-05 04:30:00 (Sun)
63814273200, # local_start 2023-03-12 03:00:00 (Sun)
63834832800, # local_end 2023-11-05 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63834841800, # utc_start 2023-11-05 04:30:00 (Sun)
63845731800, # utc_end 2024-03-10 05:30:00 (Sun)
63834829200, # local_start 2023-11-05 01:00:00 (Sun)
63845719200, # local_end 2024-03-10 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63845731800, # utc_start 2024-03-10 05:30:00 (Sun)
63866291400, # utc_end 2024-11-03 04:30:00 (Sun)
63845722800, # local_start 2024-03-10 03:00:00 (Sun)
63866282400, # local_end 2024-11-03 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63866291400, # utc_start 2024-11-03 04:30:00 (Sun)
63877181400, # utc_end 2025-03-09 05:30:00 (Sun)
63866278800, # local_start 2024-11-03 01:00:00 (Sun)
63877168800, # local_end 2025-03-09 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63877181400, # utc_start 2025-03-09 05:30:00 (Sun)
63897741000, # utc_end 2025-11-02 04:30:00 (Sun)
63877172400, # local_start 2025-03-09 03:00:00 (Sun)
63897732000, # local_end 2025-11-02 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63897741000, # utc_start 2025-11-02 04:30:00 (Sun)
63908631000, # utc_end 2026-03-08 05:30:00 (Sun)
63897728400, # local_start 2025-11-02 01:00:00 (Sun)
63908618400, # local_end 2026-03-08 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63908631000, # utc_start 2026-03-08 05:30:00 (Sun)
63929190600, # utc_end 2026-11-01 04:30:00 (Sun)
63908622000, # local_start 2026-03-08 03:00:00 (Sun)
63929181600, # local_end 2026-11-01 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63929190600, # utc_start 2026-11-01 04:30:00 (Sun)
63940685400, # utc_end 2027-03-14 05:30:00 (Sun)
63929178000, # local_start 2026-11-01 01:00:00 (Sun)
63940672800, # local_end 2027-03-14 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63940685400, # utc_start 2027-03-14 05:30:00 (Sun)
63961245000, # utc_end 2027-11-07 04:30:00 (Sun)
63940676400, # local_start 2027-03-14 03:00:00 (Sun)
63961236000, # local_end 2027-11-07 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63961245000, # utc_start 2027-11-07 04:30:00 (Sun)
63972135000, # utc_end 2028-03-12 05:30:00 (Sun)
63961232400, # local_start 2027-11-07 01:00:00 (Sun)
63972122400, # local_end 2028-03-12 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
63972135000, # utc_start 2028-03-12 05:30:00 (Sun)
63992694600, # utc_end 2028-11-05 04:30:00 (Sun)
63972126000, # local_start 2028-03-12 03:00:00 (Sun)
63992685600, # local_end 2028-11-05 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
63992694600, # utc_start 2028-11-05 04:30:00 (Sun)
64003584600, # utc_end 2029-03-11 05:30:00 (Sun)
63992682000, # local_start 2028-11-05 01:00:00 (Sun)
64003572000, # local_end 2029-03-11 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
64003584600, # utc_start 2029-03-11 05:30:00 (Sun)
64024144200, # utc_end 2029-11-04 04:30:00 (Sun)
64003575600, # local_start 2029-03-11 03:00:00 (Sun)
64024135200, # local_end 2029-11-04 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
64024144200, # utc_start 2029-11-04 04:30:00 (Sun)
64035034200, # utc_end 2030-03-10 05:30:00 (Sun)
64024131600, # local_start 2029-11-04 01:00:00 (Sun)
64035021600, # local_end 2030-03-10 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
64035034200, # utc_start 2030-03-10 05:30:00 (Sun)
64055593800, # utc_end 2030-11-03 04:30:00 (Sun)
64035025200, # local_start 2030-03-10 03:00:00 (Sun)
64055584800, # local_end 2030-11-03 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
64055593800, # utc_start 2030-11-03 04:30:00 (Sun)
64066483800, # utc_end 2031-03-09 05:30:00 (Sun)
64055581200, # local_start 2030-11-03 01:00:00 (Sun)
64066471200, # local_end 2031-03-09 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
64066483800, # utc_start 2031-03-09 05:30:00 (Sun)
64087043400, # utc_end 2031-11-02 04:30:00 (Sun)
64066474800, # local_start 2031-03-09 03:00:00 (Sun)
64087034400, # local_end 2031-11-02 02:00:00 (Sun)
-9000,
1,
'NDT',
],
];
sub olson_version {'2020d'}
sub has_dst_changes {114}
sub _max_year {2030}
sub _new_instance {
return shift->_init( @_, spans => $spans );
}
sub _last_offset { -12600 }
my $last_observance = bless( {
'format' => 'N%sT',
'gmtoff' => '-3:30',
'local_start_datetime' => bless( {
'formatter' => undef,
'local_rd_days' => 734442,
'local_rd_secs' => 0,
'offset_modifier' => 0,
'rd_nanosecs' => 0,
'tz' => bless( {
'name' => 'floating',
'offset' => 0
}, 'DateTime::TimeZone::Floating' ),
'utc_rd_days' => 734442,
'utc_rd_secs' => 0,
'utc_year' => 2012
}, 'DateTime' ),
'offset_from_std' => 0,
'offset_from_utc' => -12600,
'until' => [],
'utc_start_datetime' => bless( {
'formatter' => undef,
'local_rd_days' => 734442,
'local_rd_secs' => 9000,
'offset_modifier' => 0,
'rd_nanosecs' => 0,
'tz' => bless( {
'name' => 'floating',
'offset' => 0
}, 'DateTime::TimeZone::Floating' ),
'utc_rd_days' => 734442,
'utc_rd_secs' => 9000,
'utc_year' => 2012
}, 'DateTime' )
}, 'DateTime::TimeZone::OlsonDB::Observance' )
;
sub _last_observance { $last_observance }
my $rules = [
bless( {
'at' => '2:00',
'from' => '2007',
'in' => 'Mar',
'letter' => 'D',
'name' => 'Canada',
'offset_from_std' => 3600,
'on' => 'Sun>=8',
'save' => '1:00',
'to' => 'max'
}, 'DateTime::TimeZone::OlsonDB::Rule' ),
bless( {
'at' => '2:00',
'from' => '2007',
'in' => 'Nov',
'letter' => 'S',
'name' => 'Canada',
'offset_from_std' => 0,
'on' => 'Sun>=1',
'save' => '0',
'to' => 'max'
}, 'DateTime::TimeZone::OlsonDB::Rule' )
]
;
sub _rules { $rules }
1;
| 27.107453 | 91 | 0.632768 |
73d666445ccea6454abb5f69a6e76bdd139eaf52 | 12,796 | pm | Perl | lib/perl/TestMe/Tests/Tests.pm | DanielLazarov/test_me-server | 67986712a6cc0c705eebcea6292edf6d032b3d19 | [
"Apache-2.0"
]
| null | null | null | lib/perl/TestMe/Tests/Tests.pm | DanielLazarov/test_me-server | 67986712a6cc0c705eebcea6292edf6d032b3d19 | [
"Apache-2.0"
]
| null | null | null | lib/perl/TestMe/Tests/Tests.pm | DanielLazarov/test_me-server | 67986712a6cc0c705eebcea6292edf6d032b3d19 | [
"Apache-2.0"
]
| null | null | null | package TestMe::Tests::Tests;
use strict;
use DBI;
use Data::Dumper;
use ErrorHandle::Error::Compact;
use TestMe::Security::Security;
sub getTests($)
{
my ($app) = @_;
my $params = $$app{cgi};
ASSERT_USER(
TestMe::Security::Security::verifySession($app, $$params{account_id}, $$params{session_token}),
"Authentication Problem, please Log in Again",
"TMU001"
);
my $all_difficulties = 1;
my $all_topics = 1;
my $all_authors = 1;
my $all_ids = 1;
if($$params{difficulty})
{
$all_difficulties = 0;
}
if($$params{topic})
{
$all_topics = 0;
}
if($$params{search_account_id})
{
$all_authors = 0;
}
if($$params{test_id})
{
$all_ids = 0;
}
my $sth = $$app{dbh}->prepare(
q{
SELECT *
FROM tests_vw
WHERE (difficulty_id = ? OR ?)
AND (topic_id = ? OR ?)
AND (account_id = ? OR ?)
AND (id = ? OR ?)
}
);
$sth->execute($$params{difficulty}, $all_difficulties, $$params{topic}, $all_topics, $$params{search_account_id}, $all_authors, $$params{test_id}, $all_ids);
my $result = {};
my @arr;
while(my $row = $sth->fetchrow_hashref)
{
push @arr, $row;
}
$$result{tests} = \@arr;
TRACE("RESULT", Dumper $result);
return $result;
}
sub beginTest($)
{
my ($app) = @_;
my $params = $$app{cgi};
ASSERT($$params{random_test} || $$params{test_id}, "Missing Param");
ASSERT_USER(
TestMe::Security::Security::verifySession($app, $$params{account_id}, $$params{session_token}),
"Authentication Problem, please Log in Again",
"TMU001"
);
my $test_row;
my $sth;
if($$params{random_test} && !$$params{test_id})#Random Test
{
$sth = $$app{dbh}->prepare("
SELECT * FROM available_tests_vw OFFSET random() * (select count(*) - 1 from available_tests_vw) LIMIT 1"
);
$sth->execute();
}
else
{
$sth = $$app{dbh}->prepare("
SELECT * FROM tests WHERE id = ?
");
$sth->execute($$params{test_id});
}
ASSERT($sth->rows == 1, "No rows selected from tests");
$test_row = $sth->fetchrow_hashref;
my $expires_at = "NULL";
my $hours_left = -1;
my $minutes_left = -1;
my $seconds_left = -1;
if($$test_row{is_timed})
{
$expires_at = " now() + " . $$app{dbh}->quote($$test_row{time_minutes} . " minutes") . "::interval ";
my $time = $$test_row{time_minutes};
$minutes_left = $time % 60;
$hours_left = int($time/60);
$seconds_left = 0;
}
my @questions;
my $sth = $$app{dbh}->prepare("
SELECT * FROM questions where test_id = ?
");
$sth->execute($$test_row{id});
ASSERT_USER($sth->rows > 0, "The selected test has 0 questions");#TODO add err code
while(my $row = $sth->fetchrow_hashref)
{
push @questions, $$row{id};
}
#TODO question order may be shuflled
$sth = $$app{dbh}->prepare("
SELECT *
FROM accounts
WHERE account_id = ?
");
$sth->execute($$params{account_id});
ASSERT($sth->rows == 1, "no rows selected from accounts");
my $account_row = $sth->fetchrow_hashref;
$sth = $$app{dbh}->prepare("
INSERT INTO test_sessions
VALUES(default, ?, ?, ?, default, ?, $expires_at, default, default)
RETURNING *
");
$sth->execute(\@questions, $$test_row{id}, $$account_row{id}, undef);
ASSERT($sth->rows == 1, "Insert into test_sessions failed");
my $test_session_row = $sth->fetchrow_hashref;
my $result = {
test_session_token => $$test_session_row{session_token},
test_hours_left => $hours_left,
test_minutes_left => $minutes_left,
test_seconds_left => $seconds_left
};
TRACE("Tests::Tests::beginTest::result", Dumper $result);
return $result;
}
sub getQuestion($)
{
my ($app) = @_;
my $question_types = { #TODO sync with DB
1 => "single_answer",
2 => "multiple_answers",
3 => "free_answer",
};
my $params = $$app{cgi};
ASSERT(defined $$params{account_id} && defined $$params{session_token} && $$params{test_session_token}, "Missing Param");
ASSERT_USER(
TestMe::Security::Security::verifySession($app, $$params{account_id}, $$params{session_token}),
"Authentication Problem, please Log in Again",
"TMU001"
);
if(!defined $$params{question_number})
{
$$params{question_number} = 0;
}
my $sth = $$app{dbh}->prepare("
SELECT *,
CASE
WHEN expires_at IS NULL
THEN NULL
ELSE
(select extract('epoch' from expires_at) - extract('epoch' from now()::timestamp))
end seconds_left
FROM test_sessions
WHERE session_token = ?
");
$sth->execute($$params{test_session_token});
ASSERT($sth->rows == 1, "Incorrect session token");
my $test_session_row = $sth->fetchrow_hashref;
TRACE("TIME LEFT", $$test_session_row{seconds_left});
my $seconds_left = -1;
my $hours_left = -1;
my $minutes_left = -1;
if($$test_session_row{seconds_left})
{
$hours_left = int($$test_session_row{seconds_left}/3600);
$minutes_left = int(($$test_session_row{seconds_left}%3600)/60);
$seconds_left = int(($$test_session_row{seconds_left}%3600)%60);
}
if(scalar @{$$test_session_row{questions_id}} <= $$params{question_number})
{
return {answers => undef, type => undef, text => undef, question_number => -1};
}
$sth = $$app{dbh}->prepare("SELECT * FROM questions where id = ?");
$sth->execute($$test_session_row{questions_id}[$$params{question_number}]);
my $question_row = $sth->fetchrow_hashref;
$sth = $$app{dbh}->prepare("
SELECT text, id
FROM answers WHERE question_id = ?
");
$sth->execute($$question_row{id});
my @answers;
while(my $row = $sth->fetchrow_hashref)
{
push @answers, $row;
TRACE("Question Answer", Dumper $row)
}
my $result = {
test_hours_left => $hours_left,
test_minutes_left => $minutes_left,
test_seconds_left => $seconds_left,
answers => \@answers,
type => $$question_types{$$question_row{type_id}},
text => $$question_row{text},
question_number => $$params{question_number}
};
return $result;
}
sub submitAnswer($)
{
my ($app) = @_;
my $params = $$app{cgi};
ASSERT_USER(
TestMe::Security::Security::verifySession($app, $$params{account_id}, $$params{session_token}),
"Authentication Problem, please Log in Again",
"TMU001"
);
my $single_answer = $$params{single_answer};
my @multiple_answers;
if(defined $$params{multiple_answers})
{
@multiple_answers = split(",", $$params{multiple_answers});
}
my $free_answer = $$params{free_answer};
my $sth = $$app{dbh}->prepare("
SELECT * FROM test_sessions WHERE session_token = ?
");
$sth->execute($$params{test_session_token});
ASSERT($sth->rows == 1);
my $test_session_row = $sth->fetchrow_hashref;
my $sth = $$app{dbh}->prepare("
INSERT INTO test_session_answers
VALUES(default, ?, default, ?, null, ?, ?, ?)
");
$sth->execute($$test_session_row{id}, $$test_session_row{questions_id}[$$params{question_number}], $single_answer, (scalar @multiple_answers ? \@multiple_answers : undef), $free_answer);
ASSERT($sth->rows == 1);
$$app{cgi}{question_number}++;
return getQuestion($app);
}
sub getResult($)
{
my ($app) = @_;
my $params = $$app{cgi};
ASSERT_USER(
TestMe::Security::Security::verifySession($app, $$params{account_id}, $$params{session_token}),
"Authentication Problem, please Log in Again",
"TMU001"
);
my $sth = $$app{dbh}->prepare("
SELECT points FROM tests T JOIN test_sessions TS ON TS.test_id = T.id
WHERE TS.session_token = ?
");
$sth->execute($$params{test_session_token});
ASSERT($sth->rows == 1);
my $total_points_row = $sth->fetchrow_hashref;
my $total_points = $$total_points_row{points};
$sth = $$app{dbh}->prepare("
SELECT *,
(row__question_id).points AS points,
(row__account_id).id AS account_id,
(row__account_id).points AS account_points,
(row__correct_answer).single AS single,
(row__correct_answer).multiple AS multiple,
(row__correct_answer).free AS free
FROM test_results_vw WHERE (row__test_session_id).session_token = ?");
$sth->execute($$params{test_session_token});
my $account_points;
my $account_id;
my $earned_points = 0;
while(my $row = $sth->fetchrow_hashref)
{
$account_points = $$row{account_points};
$account_id = $$row{account_id};
if(defined $$row{single})
{
if($$row{single} == $$row{single_answer_question_answered})
{
$earned_points += $$row{points};
}
}
elsif(defined $$row{free})
{
if($$row{free} eq $$row{free_answer_question_answered})
{
$earned_points += $$row{points};
}
}
elsif(defined $$row{multiple})
{
my @answered_arr = @{$$row{multiple_answer_question_answered}};
my @correct_arr = @{$$row{multiple}};
my $eq = 1;
foreach my $answer (@answered_arr)
{
my $contains = 0;
foreach my $correct (@correct_arr)
{
if($correct == $answer)
{
$contains = 1;
last;
}
}
if(!$contains)
{
$eq = 0;
last;
}
}
if($eq)
{
$earned_points += $$row{points};
}
}
}
$account_points = $account_points + $earned_points - $total_points/2;
if($account_points < 0)
{
$account_points = 0;
}
my $rank_id;
if($account_points <= 100 )
{
$rank_id = 1;
}
elsif($account_points > 100 && $account_points <= 500)
{
$rank_id = 2;
}
elsif($account_points > 500 && $account_points <= 2500)
{
$rank_id = 3;
}
elsif($account_points > 2500 && $account_points <= 10000)
{
$rank_id = 4;
}
else
{
$rank_id = 5;
}
if(!$$params{nograde})
{
$sth = $$app{dbh}->prepare("UPDATE accounts SET points = ?, rank_id = ? WHERE id = ? RETURNING *" );
$sth->execute(int($account_points), $rank_id, $account_id);
TRACE("Result row: ", Dumper $sth->fetchrow_hashref);
TRACE("Updated rows: ", $sth->rows);
ASSERT($sth->rows == 1);
$sth = $$app{dbh}->prepare("UPDATE test_sessions SET end_timestamp = now(), is_finished = true WHERE session_token = ?");
$sth->execute($$params{test_session_token});
ASSERT($sth->rows == 1);
}
return {earned => $earned_points, total => $total_points};
}
sub getResults($)
{
my ($app) = @_;
my $params = $$app{cgi};
ASSERT_USER(
TestMe::Security::Security::verifySession($app, $$params{account_id}, $$params{session_token}),
"Authentication Problem, please Log in Again",
"TMU001"
);
my @test_results;
my $sth = $$app{dbh}->prepare("
SELECT TS.*,
TS.begin_timestamp::date AS test_date,
T.name AS row__test_id_name,
T.id AS row__test_id_id
FROM test_sessions TS
JOIN accounts A ON TS.account_id = A.id
JOIN tests T ON TS.test_id = T.id
WHERE A.account_id = ?
AND TS.is_finished = true
");
$sth->execute($$params{"account_id"});
while(my $row = $sth->fetchrow_hashref)
{
$$app{cgi}{nograde} = 1;
$$app{cgi}{test_session_token} = $$row{session_token};
my $results = getResult($app);
$$results{test_id} = $$row{row__test_id_id};
$$results{test__name} = $$row{row__test_id_name};
$$results{test_date} = $$row{test_date};
push @test_results, $results;
}
return {results => \@test_results};
}
1;
| 27.400428 | 190 | 0.548296 |
73d438dc1ec2b39b4248ada880e8ffe4c88c0bcc | 3,181 | al | Perl | ChickenManagement v3 - (documents)/1_Tables/Egg. Production Header.al | srenders/AL-Demos | aa28f3886d9da005a35cc6272ef80744e7d4670f | [
"MIT"
]
| 9 | 2019-01-18T13:00:37.000Z | 2021-03-26T02:47:21.000Z | ChickenManagement v3 - (documents)/1_Tables/Egg. Production Header.al | srenders/AL-Demos | aa28f3886d9da005a35cc6272ef80744e7d4670f | [
"MIT"
]
| null | null | null | ChickenManagement v3 - (documents)/1_Tables/Egg. Production Header.al | srenders/AL-Demos | aa28f3886d9da005a35cc6272ef80744e7d4670f | [
"MIT"
]
| 11 | 2018-06-04T21:33:41.000Z | 2021-11-23T00:30:07.000Z | table 50126 "Egg. Production Header"
{
// version EXT001
fields
{
field(1;"No.";Code[20])
{
trigger OnValidate();
begin
IF "No." <> xRec."No." THEN BEGIN
ChickenSetup.GET;
NoSeriesManagement.TestManual(ChickenSetup."Egg. Production Nos.");
"No. Series" := '';
END;
end;
}
field(2;"Document Date";Date)
{
}
field(3;"No. Series";Code[20])
{
}
field(10;"Posting Date";Date)
{
CaptionML=ENU='Posting Date';
}
field(13;"No. Printed";Integer)
{
CaptionML=ENU='No. Printed';
Editable=false;
}
field(51;"Shortcut Dimension 1 Code";Code[20])
{
CaptionClass='1,2,1';
CaptionML=ENU='Shortcut Dimension 1 Code';
TableRelation="Dimension Value".Code WHERE ("Global Dimension No."=CONST(1));
trigger OnValidate();
begin
//ValidateShortcutDimCode(1,"Shortcut Dimension 1 Code");
end;
}
field(52;"Shortcut Dimension 2 Code";Code[20])
{
CaptionClass='1,2,2';
CaptionML=ENU='Shortcut Dimension 2 Code';
TableRelation="Dimension Value".Code WHERE ("Global Dimension No."=CONST(2));
trigger OnValidate();
begin
//ValidateShortcutDimCode(2,"Shortcut Dimension 2 Code");
end;
}
field(480;"Dimension Set ID";Integer)
{
CaptionML=ENU='Dimension Set ID';
Editable=false;
TableRelation="Dimension Set Entry";
trigger OnLookup();
begin
//ShowDocDim;
end;
}
}
keys
{
key(Key1;"No.")
{
Clustered=true;
}
}
fieldgroups
{
}
trigger OnInsert();
begin
IF "No." = '' THEN BEGIN
ChickenSetup.GET;
ChickenSetup.TESTFIELD("Egg. Production Nos.");
NoSeriesManagement.InitSeries(ChickenSetup."Egg. Production Nos.",xRec."No. Series",0D,"No.","No. Series");
END;
InitRecord;
end;
var
NoSeriesManagement : Codeunit 396;
ChickenSetup : Record "Chicken Setup";
EggProductionHeader : Record "Egg. Production Header";
EggProductionLine : Record "Egg. Production Line";
PROCEDURE AssistEdit(OldEggProductionHeader : Record "Egg. Production Header") : Boolean;
var
EggProductionHeader : Record "Egg. Production Header";
begin
WITH EggProductionHeader DO BEGIN
EggProductionHeader := Rec;
ChickenSetup.GET;
ChickenSetup.TESTFIELD("Egg. Production Nos.");
IF NoSeriesManagement.SelectSeries(ChickenSetup."Egg. Production Nos.",OldEggProductionHeader."No. Series","No. Series") THEN BEGIN
NoSeriesManagement.SetSeries("No.");
Rec := EggProductionHeader;
EXIT(TRUE);
END;
END;
end;
PROCEDURE InitRecord();
begin
IF "Posting Date" = 0D THEN
"Posting Date" := WORKDATE;
"Document Date" := WORKDATE;
ChickenSetup.GET;
//NoSeriesManagement.SetDefaultSeries("Posting No. Series",ChickenSetup."Posted Egg. Production Nos.");
end;
LOCAL PROCEDURE EggProdLinesExist() : Boolean;
begin
EggProductionLine.RESET;
EggProductionLine.SETRANGE("Document No.","No.");
EXIT(EggProductionLine.FINDFIRST);
end;
}
| 23.917293 | 137 | 0.621503 |
ed3ea376549f0c2245a81cf77ba688d3c46f29e9 | 55,725 | pm | Perl | lib/DateTime/TimeZone/Europe/London.pm | gitpan/DateTime-TimeZone | bc96bd18bca94fdce254c0e457046a4034599db1 | [
"Artistic-1.0"
]
| null | null | null | lib/DateTime/TimeZone/Europe/London.pm | gitpan/DateTime-TimeZone | bc96bd18bca94fdce254c0e457046a4034599db1 | [
"Artistic-1.0"
]
| null | null | null | lib/DateTime/TimeZone/Europe/London.pm | gitpan/DateTime-TimeZone | bc96bd18bca94fdce254c0e457046a4034599db1 | [
"Artistic-1.0"
]
| null | null | null | # This file is auto-generated by the Perl DateTime Suite time zone
# code generator (0.07) This code generator comes with the
# DateTime::TimeZone module distribution in the tools/ directory
#
# Generated from /home/autarch/projects/DateTime/data/Olson/2014j/europe. Olson data version 2014j
#
# Do not edit this file directly.
#
package DateTime::TimeZone::Europe::London;
$DateTime::TimeZone::Europe::London::VERSION = '1.83';
use strict;
use Class::Singleton 1.03;
use DateTime::TimeZone;
use DateTime::TimeZone::OlsonDB;
@DateTime::TimeZone::Europe::London::ISA = ( 'Class::Singleton', 'DateTime::TimeZone' );
my $spans =
[
[
DateTime::TimeZone::NEG_INFINITY, # utc_start
58283020875, # utc_end 1847-12-01 00:01:15 (Wed)
DateTime::TimeZone::NEG_INFINITY, # local_start
58283020800, # local_end 1847-12-01 00:00:00 (Wed)
-75,
0,
'LMT',
],
[
58283020875, # utc_start 1847-12-01 00:01:15 (Wed)
60443719200, # utc_end 1916-05-21 02:00:00 (Sun)
58283020875, # local_start 1847-12-01 00:01:15 (Wed)
60443719200, # local_end 1916-05-21 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60443719200, # utc_start 1916-05-21 02:00:00 (Sun)
60455210400, # utc_end 1916-10-01 02:00:00 (Sun)
60443722800, # local_start 1916-05-21 03:00:00 (Sun)
60455214000, # local_end 1916-10-01 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60455210400, # utc_start 1916-10-01 02:00:00 (Sun)
60471540000, # utc_end 1917-04-08 02:00:00 (Sun)
60455210400, # local_start 1916-10-01 02:00:00 (Sun)
60471540000, # local_end 1917-04-08 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60471540000, # utc_start 1917-04-08 02:00:00 (Sun)
60485536800, # utc_end 1917-09-17 02:00:00 (Mon)
60471543600, # local_start 1917-04-08 03:00:00 (Sun)
60485540400, # local_end 1917-09-17 03:00:00 (Mon)
3600,
1,
'BST',
],
[
60485536800, # utc_start 1917-09-17 02:00:00 (Mon)
60501780000, # utc_end 1918-03-24 02:00:00 (Sun)
60485536800, # local_start 1917-09-17 02:00:00 (Mon)
60501780000, # local_end 1918-03-24 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60501780000, # utc_start 1918-03-24 02:00:00 (Sun)
60518196000, # utc_end 1918-09-30 02:00:00 (Mon)
60501783600, # local_start 1918-03-24 03:00:00 (Sun)
60518199600, # local_end 1918-09-30 03:00:00 (Mon)
3600,
1,
'BST',
],
[
60518196000, # utc_start 1918-09-30 02:00:00 (Mon)
60533834400, # utc_end 1919-03-30 02:00:00 (Sun)
60518196000, # local_start 1918-09-30 02:00:00 (Mon)
60533834400, # local_end 1919-03-30 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60533834400, # utc_start 1919-03-30 02:00:00 (Sun)
60549645600, # utc_end 1919-09-29 02:00:00 (Mon)
60533838000, # local_start 1919-03-30 03:00:00 (Sun)
60549649200, # local_end 1919-09-29 03:00:00 (Mon)
3600,
1,
'BST',
],
[
60549645600, # utc_start 1919-09-29 02:00:00 (Mon)
60565284000, # utc_end 1920-03-28 02:00:00 (Sun)
60549645600, # local_start 1919-09-29 02:00:00 (Mon)
60565284000, # local_end 1920-03-28 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60565284000, # utc_start 1920-03-28 02:00:00 (Sun)
60583514400, # utc_end 1920-10-25 02:00:00 (Mon)
60565287600, # local_start 1920-03-28 03:00:00 (Sun)
60583518000, # local_end 1920-10-25 03:00:00 (Mon)
3600,
1,
'BST',
],
[
60583514400, # utc_start 1920-10-25 02:00:00 (Mon)
60597338400, # utc_end 1921-04-03 02:00:00 (Sun)
60583514400, # local_start 1920-10-25 02:00:00 (Mon)
60597338400, # local_end 1921-04-03 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60597338400, # utc_start 1921-04-03 02:00:00 (Sun)
60613149600, # utc_end 1921-10-03 02:00:00 (Mon)
60597342000, # local_start 1921-04-03 03:00:00 (Sun)
60613153200, # local_end 1921-10-03 03:00:00 (Mon)
3600,
1,
'BST',
],
[
60613149600, # utc_start 1921-10-03 02:00:00 (Mon)
60628183200, # utc_end 1922-03-26 02:00:00 (Sun)
60613149600, # local_start 1921-10-03 02:00:00 (Mon)
60628183200, # local_end 1922-03-26 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60628183200, # utc_start 1922-03-26 02:00:00 (Sun)
60645117600, # utc_end 1922-10-08 02:00:00 (Sun)
60628186800, # local_start 1922-03-26 03:00:00 (Sun)
60645121200, # local_end 1922-10-08 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60645117600, # utc_start 1922-10-08 02:00:00 (Sun)
60662052000, # utc_end 1923-04-22 02:00:00 (Sun)
60645117600, # local_start 1922-10-08 02:00:00 (Sun)
60662052000, # local_end 1923-04-22 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60662052000, # utc_start 1923-04-22 02:00:00 (Sun)
60674752800, # utc_end 1923-09-16 02:00:00 (Sun)
60662055600, # local_start 1923-04-22 03:00:00 (Sun)
60674756400, # local_end 1923-09-16 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60674752800, # utc_start 1923-09-16 02:00:00 (Sun)
60692896800, # utc_end 1924-04-13 02:00:00 (Sun)
60674752800, # local_start 1923-09-16 02:00:00 (Sun)
60692896800, # local_end 1924-04-13 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60692896800, # utc_start 1924-04-13 02:00:00 (Sun)
60706807200, # utc_end 1924-09-21 02:00:00 (Sun)
60692900400, # local_start 1924-04-13 03:00:00 (Sun)
60706810800, # local_end 1924-09-21 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60706807200, # utc_start 1924-09-21 02:00:00 (Sun)
60724951200, # utc_end 1925-04-19 02:00:00 (Sun)
60706807200, # local_start 1924-09-21 02:00:00 (Sun)
60724951200, # local_end 1925-04-19 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60724951200, # utc_start 1925-04-19 02:00:00 (Sun)
60739466400, # utc_end 1925-10-04 02:00:00 (Sun)
60724954800, # local_start 1925-04-19 03:00:00 (Sun)
60739470000, # local_end 1925-10-04 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60739466400, # utc_start 1925-10-04 02:00:00 (Sun)
60756400800, # utc_end 1926-04-18 02:00:00 (Sun)
60739466400, # local_start 1925-10-04 02:00:00 (Sun)
60756400800, # local_end 1926-04-18 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60756400800, # utc_start 1926-04-18 02:00:00 (Sun)
60770916000, # utc_end 1926-10-03 02:00:00 (Sun)
60756404400, # local_start 1926-04-18 03:00:00 (Sun)
60770919600, # local_end 1926-10-03 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60770916000, # utc_start 1926-10-03 02:00:00 (Sun)
60787245600, # utc_end 1927-04-10 02:00:00 (Sun)
60770916000, # local_start 1926-10-03 02:00:00 (Sun)
60787245600, # local_end 1927-04-10 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60787245600, # utc_start 1927-04-10 02:00:00 (Sun)
60802365600, # utc_end 1927-10-02 02:00:00 (Sun)
60787249200, # local_start 1927-04-10 03:00:00 (Sun)
60802369200, # local_end 1927-10-02 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60802365600, # utc_start 1927-10-02 02:00:00 (Sun)
60819904800, # utc_end 1928-04-22 02:00:00 (Sun)
60802365600, # local_start 1927-10-02 02:00:00 (Sun)
60819904800, # local_end 1928-04-22 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60819904800, # utc_start 1928-04-22 02:00:00 (Sun)
60834420000, # utc_end 1928-10-07 02:00:00 (Sun)
60819908400, # local_start 1928-04-22 03:00:00 (Sun)
60834423600, # local_end 1928-10-07 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60834420000, # utc_start 1928-10-07 02:00:00 (Sun)
60851354400, # utc_end 1929-04-21 02:00:00 (Sun)
60834420000, # local_start 1928-10-07 02:00:00 (Sun)
60851354400, # local_end 1929-04-21 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60851354400, # utc_start 1929-04-21 02:00:00 (Sun)
60865869600, # utc_end 1929-10-06 02:00:00 (Sun)
60851358000, # local_start 1929-04-21 03:00:00 (Sun)
60865873200, # local_end 1929-10-06 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60865869600, # utc_start 1929-10-06 02:00:00 (Sun)
60882199200, # utc_end 1930-04-13 02:00:00 (Sun)
60865869600, # local_start 1929-10-06 02:00:00 (Sun)
60882199200, # local_end 1930-04-13 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60882199200, # utc_start 1930-04-13 02:00:00 (Sun)
60897319200, # utc_end 1930-10-05 02:00:00 (Sun)
60882202800, # local_start 1930-04-13 03:00:00 (Sun)
60897322800, # local_end 1930-10-05 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60897319200, # utc_start 1930-10-05 02:00:00 (Sun)
60914253600, # utc_end 1931-04-19 02:00:00 (Sun)
60897319200, # local_start 1930-10-05 02:00:00 (Sun)
60914253600, # local_end 1931-04-19 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60914253600, # utc_start 1931-04-19 02:00:00 (Sun)
60928768800, # utc_end 1931-10-04 02:00:00 (Sun)
60914257200, # local_start 1931-04-19 03:00:00 (Sun)
60928772400, # local_end 1931-10-04 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60928768800, # utc_start 1931-10-04 02:00:00 (Sun)
60945703200, # utc_end 1932-04-17 02:00:00 (Sun)
60928768800, # local_start 1931-10-04 02:00:00 (Sun)
60945703200, # local_end 1932-04-17 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60945703200, # utc_start 1932-04-17 02:00:00 (Sun)
60960218400, # utc_end 1932-10-02 02:00:00 (Sun)
60945706800, # local_start 1932-04-17 03:00:00 (Sun)
60960222000, # local_end 1932-10-02 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60960218400, # utc_start 1932-10-02 02:00:00 (Sun)
60976548000, # utc_end 1933-04-09 02:00:00 (Sun)
60960218400, # local_start 1932-10-02 02:00:00 (Sun)
60976548000, # local_end 1933-04-09 02:00:00 (Sun)
0,
0,
'GMT',
],
[
60976548000, # utc_start 1933-04-09 02:00:00 (Sun)
60992272800, # utc_end 1933-10-08 02:00:00 (Sun)
60976551600, # local_start 1933-04-09 03:00:00 (Sun)
60992276400, # local_end 1933-10-08 03:00:00 (Sun)
3600,
1,
'BST',
],
[
60992272800, # utc_start 1933-10-08 02:00:00 (Sun)
61009207200, # utc_end 1934-04-22 02:00:00 (Sun)
60992272800, # local_start 1933-10-08 02:00:00 (Sun)
61009207200, # local_end 1934-04-22 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61009207200, # utc_start 1934-04-22 02:00:00 (Sun)
61023722400, # utc_end 1934-10-07 02:00:00 (Sun)
61009210800, # local_start 1934-04-22 03:00:00 (Sun)
61023726000, # local_end 1934-10-07 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61023722400, # utc_start 1934-10-07 02:00:00 (Sun)
61040052000, # utc_end 1935-04-14 02:00:00 (Sun)
61023722400, # local_start 1934-10-07 02:00:00 (Sun)
61040052000, # local_end 1935-04-14 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61040052000, # utc_start 1935-04-14 02:00:00 (Sun)
61055172000, # utc_end 1935-10-06 02:00:00 (Sun)
61040055600, # local_start 1935-04-14 03:00:00 (Sun)
61055175600, # local_end 1935-10-06 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61055172000, # utc_start 1935-10-06 02:00:00 (Sun)
61072106400, # utc_end 1936-04-19 02:00:00 (Sun)
61055172000, # local_start 1935-10-06 02:00:00 (Sun)
61072106400, # local_end 1936-04-19 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61072106400, # utc_start 1936-04-19 02:00:00 (Sun)
61086621600, # utc_end 1936-10-04 02:00:00 (Sun)
61072110000, # local_start 1936-04-19 03:00:00 (Sun)
61086625200, # local_end 1936-10-04 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61086621600, # utc_start 1936-10-04 02:00:00 (Sun)
61103556000, # utc_end 1937-04-18 02:00:00 (Sun)
61086621600, # local_start 1936-10-04 02:00:00 (Sun)
61103556000, # local_end 1937-04-18 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61103556000, # utc_start 1937-04-18 02:00:00 (Sun)
61118071200, # utc_end 1937-10-03 02:00:00 (Sun)
61103559600, # local_start 1937-04-18 03:00:00 (Sun)
61118074800, # local_end 1937-10-03 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61118071200, # utc_start 1937-10-03 02:00:00 (Sun)
61134400800, # utc_end 1938-04-10 02:00:00 (Sun)
61118071200, # local_start 1937-10-03 02:00:00 (Sun)
61134400800, # local_end 1938-04-10 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61134400800, # utc_start 1938-04-10 02:00:00 (Sun)
61149520800, # utc_end 1938-10-02 02:00:00 (Sun)
61134404400, # local_start 1938-04-10 03:00:00 (Sun)
61149524400, # local_end 1938-10-02 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61149520800, # utc_start 1938-10-02 02:00:00 (Sun)
61166455200, # utc_end 1939-04-16 02:00:00 (Sun)
61149520800, # local_start 1938-10-02 02:00:00 (Sun)
61166455200, # local_end 1939-04-16 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61166455200, # utc_start 1939-04-16 02:00:00 (Sun)
61185204000, # utc_end 1939-11-19 02:00:00 (Sun)
61166458800, # local_start 1939-04-16 03:00:00 (Sun)
61185207600, # local_end 1939-11-19 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61185204000, # utc_start 1939-11-19 02:00:00 (Sun)
61193671200, # utc_end 1940-02-25 02:00:00 (Sun)
61185204000, # local_start 1939-11-19 02:00:00 (Sun)
61193671200, # local_end 1940-02-25 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61193671200, # utc_start 1940-02-25 02:00:00 (Sun)
61231165200, # utc_end 1941-05-04 01:00:00 (Sun)
61193674800, # local_start 1940-02-25 03:00:00 (Sun)
61231168800, # local_end 1941-05-04 02:00:00 (Sun)
3600,
1,
'BST',
],
[
61231165200, # utc_start 1941-05-04 01:00:00 (Sun)
61239632400, # utc_end 1941-08-10 01:00:00 (Sun)
61231172400, # local_start 1941-05-04 03:00:00 (Sun)
61239639600, # local_end 1941-08-10 03:00:00 (Sun)
7200,
1,
'BDST',
],
[
61239632400, # utc_start 1941-08-10 01:00:00 (Sun)
61260195600, # utc_end 1942-04-05 01:00:00 (Sun)
61239636000, # local_start 1941-08-10 02:00:00 (Sun)
61260199200, # local_end 1942-04-05 02:00:00 (Sun)
3600,
1,
'BST',
],
[
61260195600, # utc_start 1942-04-05 01:00:00 (Sun)
61271082000, # utc_end 1942-08-09 01:00:00 (Sun)
61260202800, # local_start 1942-04-05 03:00:00 (Sun)
61271089200, # local_end 1942-08-09 03:00:00 (Sun)
7200,
1,
'BDST',
],
[
61271082000, # utc_start 1942-08-09 01:00:00 (Sun)
61291645200, # utc_end 1943-04-04 01:00:00 (Sun)
61271085600, # local_start 1942-08-09 02:00:00 (Sun)
61291648800, # local_end 1943-04-04 02:00:00 (Sun)
3600,
1,
'BST',
],
[
61291645200, # utc_start 1943-04-04 01:00:00 (Sun)
61303136400, # utc_end 1943-08-15 01:00:00 (Sun)
61291652400, # local_start 1943-04-04 03:00:00 (Sun)
61303143600, # local_end 1943-08-15 03:00:00 (Sun)
7200,
1,
'BDST',
],
[
61303136400, # utc_start 1943-08-15 01:00:00 (Sun)
61323094800, # utc_end 1944-04-02 01:00:00 (Sun)
61303140000, # local_start 1943-08-15 02:00:00 (Sun)
61323098400, # local_end 1944-04-02 02:00:00 (Sun)
3600,
1,
'BST',
],
[
61323094800, # utc_start 1944-04-02 01:00:00 (Sun)
61337610000, # utc_end 1944-09-17 01:00:00 (Sun)
61323102000, # local_start 1944-04-02 03:00:00 (Sun)
61337617200, # local_end 1944-09-17 03:00:00 (Sun)
7200,
1,
'BDST',
],
[
61337610000, # utc_start 1944-09-17 01:00:00 (Sun)
61354630800, # utc_end 1945-04-02 01:00:00 (Mon)
61337613600, # local_start 1944-09-17 02:00:00 (Sun)
61354634400, # local_end 1945-04-02 02:00:00 (Mon)
3600,
1,
'BST',
],
[
61354630800, # utc_start 1945-04-02 01:00:00 (Mon)
61363616400, # utc_end 1945-07-15 01:00:00 (Sun)
61354638000, # local_start 1945-04-02 03:00:00 (Mon)
61363623600, # local_end 1945-07-15 03:00:00 (Sun)
7200,
1,
'BDST',
],
[
61363616400, # utc_start 1945-07-15 01:00:00 (Sun)
61370877600, # utc_end 1945-10-07 02:00:00 (Sun)
61363620000, # local_start 1945-07-15 02:00:00 (Sun)
61370881200, # local_end 1945-10-07 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61370877600, # utc_start 1945-10-07 02:00:00 (Sun)
61387207200, # utc_end 1946-04-14 02:00:00 (Sun)
61370877600, # local_start 1945-10-07 02:00:00 (Sun)
61387207200, # local_end 1946-04-14 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61387207200, # utc_start 1946-04-14 02:00:00 (Sun)
61402327200, # utc_end 1946-10-06 02:00:00 (Sun)
61387210800, # local_start 1946-04-14 03:00:00 (Sun)
61402330800, # local_end 1946-10-06 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61402327200, # utc_start 1946-10-06 02:00:00 (Sun)
61416237600, # utc_end 1947-03-16 02:00:00 (Sun)
61402327200, # local_start 1946-10-06 02:00:00 (Sun)
61416237600, # local_end 1947-03-16 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61416237600, # utc_start 1947-03-16 02:00:00 (Sun)
61418653200, # utc_end 1947-04-13 01:00:00 (Sun)
61416241200, # local_start 1947-03-16 03:00:00 (Sun)
61418656800, # local_end 1947-04-13 02:00:00 (Sun)
3600,
1,
'BST',
],
[
61418653200, # utc_start 1947-04-13 01:00:00 (Sun)
61428934800, # utc_end 1947-08-10 01:00:00 (Sun)
61418660400, # local_start 1947-04-13 03:00:00 (Sun)
61428942000, # local_end 1947-08-10 03:00:00 (Sun)
7200,
1,
'BDST',
],
[
61428934800, # utc_start 1947-08-10 01:00:00 (Sun)
61436196000, # utc_end 1947-11-02 02:00:00 (Sun)
61428938400, # local_start 1947-08-10 02:00:00 (Sun)
61436199600, # local_end 1947-11-02 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61436196000, # utc_start 1947-11-02 02:00:00 (Sun)
61447687200, # utc_end 1948-03-14 02:00:00 (Sun)
61436196000, # local_start 1947-11-02 02:00:00 (Sun)
61447687200, # local_end 1948-03-14 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61447687200, # utc_start 1948-03-14 02:00:00 (Sun)
61467645600, # utc_end 1948-10-31 02:00:00 (Sun)
61447690800, # local_start 1948-03-14 03:00:00 (Sun)
61467649200, # local_end 1948-10-31 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61467645600, # utc_start 1948-10-31 02:00:00 (Sun)
61480951200, # utc_end 1949-04-03 02:00:00 (Sun)
61467645600, # local_start 1948-10-31 02:00:00 (Sun)
61480951200, # local_end 1949-04-03 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61480951200, # utc_start 1949-04-03 02:00:00 (Sun)
61499095200, # utc_end 1949-10-30 02:00:00 (Sun)
61480954800, # local_start 1949-04-03 03:00:00 (Sun)
61499098800, # local_end 1949-10-30 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61499095200, # utc_start 1949-10-30 02:00:00 (Sun)
61513610400, # utc_end 1950-04-16 02:00:00 (Sun)
61499095200, # local_start 1949-10-30 02:00:00 (Sun)
61513610400, # local_end 1950-04-16 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61513610400, # utc_start 1950-04-16 02:00:00 (Sun)
61529940000, # utc_end 1950-10-22 02:00:00 (Sun)
61513614000, # local_start 1950-04-16 03:00:00 (Sun)
61529943600, # local_end 1950-10-22 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61529940000, # utc_start 1950-10-22 02:00:00 (Sun)
61545060000, # utc_end 1951-04-15 02:00:00 (Sun)
61529940000, # local_start 1950-10-22 02:00:00 (Sun)
61545060000, # local_end 1951-04-15 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61545060000, # utc_start 1951-04-15 02:00:00 (Sun)
61561389600, # utc_end 1951-10-21 02:00:00 (Sun)
61545063600, # local_start 1951-04-15 03:00:00 (Sun)
61561393200, # local_end 1951-10-21 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61561389600, # utc_start 1951-10-21 02:00:00 (Sun)
61577114400, # utc_end 1952-04-20 02:00:00 (Sun)
61561389600, # local_start 1951-10-21 02:00:00 (Sun)
61577114400, # local_end 1952-04-20 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61577114400, # utc_start 1952-04-20 02:00:00 (Sun)
61593444000, # utc_end 1952-10-26 02:00:00 (Sun)
61577118000, # local_start 1952-04-20 03:00:00 (Sun)
61593447600, # local_end 1952-10-26 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61593444000, # utc_start 1952-10-26 02:00:00 (Sun)
61608564000, # utc_end 1953-04-19 02:00:00 (Sun)
61593444000, # local_start 1952-10-26 02:00:00 (Sun)
61608564000, # local_end 1953-04-19 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61608564000, # utc_start 1953-04-19 02:00:00 (Sun)
61623079200, # utc_end 1953-10-04 02:00:00 (Sun)
61608567600, # local_start 1953-04-19 03:00:00 (Sun)
61623082800, # local_end 1953-10-04 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61623079200, # utc_start 1953-10-04 02:00:00 (Sun)
61639408800, # utc_end 1954-04-11 02:00:00 (Sun)
61623079200, # local_start 1953-10-04 02:00:00 (Sun)
61639408800, # local_end 1954-04-11 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61639408800, # utc_start 1954-04-11 02:00:00 (Sun)
61654528800, # utc_end 1954-10-03 02:00:00 (Sun)
61639412400, # local_start 1954-04-11 03:00:00 (Sun)
61654532400, # local_end 1954-10-03 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61654528800, # utc_start 1954-10-03 02:00:00 (Sun)
61671463200, # utc_end 1955-04-17 02:00:00 (Sun)
61654528800, # local_start 1954-10-03 02:00:00 (Sun)
61671463200, # local_end 1955-04-17 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61671463200, # utc_start 1955-04-17 02:00:00 (Sun)
61685978400, # utc_end 1955-10-02 02:00:00 (Sun)
61671466800, # local_start 1955-04-17 03:00:00 (Sun)
61685982000, # local_end 1955-10-02 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61685978400, # utc_start 1955-10-02 02:00:00 (Sun)
61703517600, # utc_end 1956-04-22 02:00:00 (Sun)
61685978400, # local_start 1955-10-02 02:00:00 (Sun)
61703517600, # local_end 1956-04-22 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61703517600, # utc_start 1956-04-22 02:00:00 (Sun)
61718032800, # utc_end 1956-10-07 02:00:00 (Sun)
61703521200, # local_start 1956-04-22 03:00:00 (Sun)
61718036400, # local_end 1956-10-07 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61718032800, # utc_start 1956-10-07 02:00:00 (Sun)
61734362400, # utc_end 1957-04-14 02:00:00 (Sun)
61718032800, # local_start 1956-10-07 02:00:00 (Sun)
61734362400, # local_end 1957-04-14 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61734362400, # utc_start 1957-04-14 02:00:00 (Sun)
61749482400, # utc_end 1957-10-06 02:00:00 (Sun)
61734366000, # local_start 1957-04-14 03:00:00 (Sun)
61749486000, # local_end 1957-10-06 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61749482400, # utc_start 1957-10-06 02:00:00 (Sun)
61766416800, # utc_end 1958-04-20 02:00:00 (Sun)
61749482400, # local_start 1957-10-06 02:00:00 (Sun)
61766416800, # local_end 1958-04-20 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61766416800, # utc_start 1958-04-20 02:00:00 (Sun)
61780932000, # utc_end 1958-10-05 02:00:00 (Sun)
61766420400, # local_start 1958-04-20 03:00:00 (Sun)
61780935600, # local_end 1958-10-05 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61780932000, # utc_start 1958-10-05 02:00:00 (Sun)
61797866400, # utc_end 1959-04-19 02:00:00 (Sun)
61780932000, # local_start 1958-10-05 02:00:00 (Sun)
61797866400, # local_end 1959-04-19 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61797866400, # utc_start 1959-04-19 02:00:00 (Sun)
61812381600, # utc_end 1959-10-04 02:00:00 (Sun)
61797870000, # local_start 1959-04-19 03:00:00 (Sun)
61812385200, # local_end 1959-10-04 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61812381600, # utc_start 1959-10-04 02:00:00 (Sun)
61828711200, # utc_end 1960-04-10 02:00:00 (Sun)
61812381600, # local_start 1959-10-04 02:00:00 (Sun)
61828711200, # local_end 1960-04-10 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61828711200, # utc_start 1960-04-10 02:00:00 (Sun)
61843831200, # utc_end 1960-10-02 02:00:00 (Sun)
61828714800, # local_start 1960-04-10 03:00:00 (Sun)
61843834800, # local_end 1960-10-02 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61843831200, # utc_start 1960-10-02 02:00:00 (Sun)
61858951200, # utc_end 1961-03-26 02:00:00 (Sun)
61843831200, # local_start 1960-10-02 02:00:00 (Sun)
61858951200, # local_end 1961-03-26 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61858951200, # utc_start 1961-03-26 02:00:00 (Sun)
61877700000, # utc_end 1961-10-29 02:00:00 (Sun)
61858954800, # local_start 1961-03-26 03:00:00 (Sun)
61877703600, # local_end 1961-10-29 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61877700000, # utc_start 1961-10-29 02:00:00 (Sun)
61890400800, # utc_end 1962-03-25 02:00:00 (Sun)
61877700000, # local_start 1961-10-29 02:00:00 (Sun)
61890400800, # local_end 1962-03-25 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61890400800, # utc_start 1962-03-25 02:00:00 (Sun)
61909149600, # utc_end 1962-10-28 02:00:00 (Sun)
61890404400, # local_start 1962-03-25 03:00:00 (Sun)
61909153200, # local_end 1962-10-28 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61909149600, # utc_start 1962-10-28 02:00:00 (Sun)
61922455200, # utc_end 1963-03-31 02:00:00 (Sun)
61909149600, # local_start 1962-10-28 02:00:00 (Sun)
61922455200, # local_end 1963-03-31 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61922455200, # utc_start 1963-03-31 02:00:00 (Sun)
61940599200, # utc_end 1963-10-27 02:00:00 (Sun)
61922458800, # local_start 1963-03-31 03:00:00 (Sun)
61940602800, # local_end 1963-10-27 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61940599200, # utc_start 1963-10-27 02:00:00 (Sun)
61953300000, # utc_end 1964-03-22 02:00:00 (Sun)
61940599200, # local_start 1963-10-27 02:00:00 (Sun)
61953300000, # local_end 1964-03-22 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61953300000, # utc_start 1964-03-22 02:00:00 (Sun)
61972048800, # utc_end 1964-10-25 02:00:00 (Sun)
61953303600, # local_start 1964-03-22 03:00:00 (Sun)
61972052400, # local_end 1964-10-25 03:00:00 (Sun)
3600,
1,
'BST',
],
[
61972048800, # utc_start 1964-10-25 02:00:00 (Sun)
61984749600, # utc_end 1965-03-21 02:00:00 (Sun)
61972048800, # local_start 1964-10-25 02:00:00 (Sun)
61984749600, # local_end 1965-03-21 02:00:00 (Sun)
0,
0,
'GMT',
],
[
61984749600, # utc_start 1965-03-21 02:00:00 (Sun)
62003498400, # utc_end 1965-10-24 02:00:00 (Sun)
61984753200, # local_start 1965-03-21 03:00:00 (Sun)
62003502000, # local_end 1965-10-24 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62003498400, # utc_start 1965-10-24 02:00:00 (Sun)
62016199200, # utc_end 1966-03-20 02:00:00 (Sun)
62003498400, # local_start 1965-10-24 02:00:00 (Sun)
62016199200, # local_end 1966-03-20 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62016199200, # utc_start 1966-03-20 02:00:00 (Sun)
62034948000, # utc_end 1966-10-23 02:00:00 (Sun)
62016202800, # local_start 1966-03-20 03:00:00 (Sun)
62034951600, # local_end 1966-10-23 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62034948000, # utc_start 1966-10-23 02:00:00 (Sun)
62047648800, # utc_end 1967-03-19 02:00:00 (Sun)
62034948000, # local_start 1966-10-23 02:00:00 (Sun)
62047648800, # local_end 1967-03-19 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62047648800, # utc_start 1967-03-19 02:00:00 (Sun)
62067002400, # utc_end 1967-10-29 02:00:00 (Sun)
62047652400, # local_start 1967-03-19 03:00:00 (Sun)
62067006000, # local_end 1967-10-29 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62067002400, # utc_start 1967-10-29 02:00:00 (Sun)
62076679200, # utc_end 1968-02-18 02:00:00 (Sun)
62067002400, # local_start 1967-10-29 02:00:00 (Sun)
62076679200, # local_end 1968-02-18 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62076679200, # utc_start 1968-02-18 02:00:00 (Sun)
62098441200, # utc_end 1968-10-26 23:00:00 (Sat)
62076682800, # local_start 1968-02-18 03:00:00 (Sun)
62098444800, # local_end 1968-10-27 00:00:00 (Sun)
3600,
1,
'BST',
],
[
62098441200, # utc_start 1968-10-26 23:00:00 (Sat)
62193405600, # utc_end 1971-10-31 02:00:00 (Sun)
62098444800, # local_start 1968-10-27 00:00:00 (Sun)
62193409200, # local_end 1971-10-31 03:00:00 (Sun)
3600,
0,
'BST',
],
[
62193405600, # utc_start 1971-10-31 02:00:00 (Sun)
62205501600, # utc_end 1972-03-19 02:00:00 (Sun)
62193405600, # local_start 1971-10-31 02:00:00 (Sun)
62205501600, # local_end 1972-03-19 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62205501600, # utc_start 1972-03-19 02:00:00 (Sun)
62224855200, # utc_end 1972-10-29 02:00:00 (Sun)
62205505200, # local_start 1972-03-19 03:00:00 (Sun)
62224858800, # local_end 1972-10-29 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62224855200, # utc_start 1972-10-29 02:00:00 (Sun)
62236951200, # utc_end 1973-03-18 02:00:00 (Sun)
62224855200, # local_start 1972-10-29 02:00:00 (Sun)
62236951200, # local_end 1973-03-18 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62236951200, # utc_start 1973-03-18 02:00:00 (Sun)
62256304800, # utc_end 1973-10-28 02:00:00 (Sun)
62236954800, # local_start 1973-03-18 03:00:00 (Sun)
62256308400, # local_end 1973-10-28 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62256304800, # utc_start 1973-10-28 02:00:00 (Sun)
62268400800, # utc_end 1974-03-17 02:00:00 (Sun)
62256304800, # local_start 1973-10-28 02:00:00 (Sun)
62268400800, # local_end 1974-03-17 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62268400800, # utc_start 1974-03-17 02:00:00 (Sun)
62287754400, # utc_end 1974-10-27 02:00:00 (Sun)
62268404400, # local_start 1974-03-17 03:00:00 (Sun)
62287758000, # local_end 1974-10-27 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62287754400, # utc_start 1974-10-27 02:00:00 (Sun)
62299850400, # utc_end 1975-03-16 02:00:00 (Sun)
62287754400, # local_start 1974-10-27 02:00:00 (Sun)
62299850400, # local_end 1975-03-16 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62299850400, # utc_start 1975-03-16 02:00:00 (Sun)
62319204000, # utc_end 1975-10-26 02:00:00 (Sun)
62299854000, # local_start 1975-03-16 03:00:00 (Sun)
62319207600, # local_end 1975-10-26 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62319204000, # utc_start 1975-10-26 02:00:00 (Sun)
62331904800, # utc_end 1976-03-21 02:00:00 (Sun)
62319204000, # local_start 1975-10-26 02:00:00 (Sun)
62331904800, # local_end 1976-03-21 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62331904800, # utc_start 1976-03-21 02:00:00 (Sun)
62350653600, # utc_end 1976-10-24 02:00:00 (Sun)
62331908400, # local_start 1976-03-21 03:00:00 (Sun)
62350657200, # local_end 1976-10-24 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62350653600, # utc_start 1976-10-24 02:00:00 (Sun)
62363354400, # utc_end 1977-03-20 02:00:00 (Sun)
62350653600, # local_start 1976-10-24 02:00:00 (Sun)
62363354400, # local_end 1977-03-20 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62363354400, # utc_start 1977-03-20 02:00:00 (Sun)
62382103200, # utc_end 1977-10-23 02:00:00 (Sun)
62363358000, # local_start 1977-03-20 03:00:00 (Sun)
62382106800, # local_end 1977-10-23 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62382103200, # utc_start 1977-10-23 02:00:00 (Sun)
62394804000, # utc_end 1978-03-19 02:00:00 (Sun)
62382103200, # local_start 1977-10-23 02:00:00 (Sun)
62394804000, # local_end 1978-03-19 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62394804000, # utc_start 1978-03-19 02:00:00 (Sun)
62414157600, # utc_end 1978-10-29 02:00:00 (Sun)
62394807600, # local_start 1978-03-19 03:00:00 (Sun)
62414161200, # local_end 1978-10-29 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62414157600, # utc_start 1978-10-29 02:00:00 (Sun)
62426253600, # utc_end 1979-03-18 02:00:00 (Sun)
62414157600, # local_start 1978-10-29 02:00:00 (Sun)
62426253600, # local_end 1979-03-18 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62426253600, # utc_start 1979-03-18 02:00:00 (Sun)
62445607200, # utc_end 1979-10-28 02:00:00 (Sun)
62426257200, # local_start 1979-03-18 03:00:00 (Sun)
62445610800, # local_end 1979-10-28 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62445607200, # utc_start 1979-10-28 02:00:00 (Sun)
62457703200, # utc_end 1980-03-16 02:00:00 (Sun)
62445607200, # local_start 1979-10-28 02:00:00 (Sun)
62457703200, # local_end 1980-03-16 02:00:00 (Sun)
0,
0,
'GMT',
],
[
62457703200, # utc_start 1980-03-16 02:00:00 (Sun)
62477056800, # utc_end 1980-10-26 02:00:00 (Sun)
62457706800, # local_start 1980-03-16 03:00:00 (Sun)
62477060400, # local_end 1980-10-26 03:00:00 (Sun)
3600,
1,
'BST',
],
[
62477056800, # utc_start 1980-10-26 02:00:00 (Sun)
62490358800, # utc_end 1981-03-29 01:00:00 (Sun)
62477056800, # local_start 1980-10-26 02:00:00 (Sun)
62490358800, # local_end 1981-03-29 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62490358800, # utc_start 1981-03-29 01:00:00 (Sun)
62508502800, # utc_end 1981-10-25 01:00:00 (Sun)
62490362400, # local_start 1981-03-29 02:00:00 (Sun)
62508506400, # local_end 1981-10-25 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62508502800, # utc_start 1981-10-25 01:00:00 (Sun)
62521808400, # utc_end 1982-03-28 01:00:00 (Sun)
62508502800, # local_start 1981-10-25 01:00:00 (Sun)
62521808400, # local_end 1982-03-28 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62521808400, # utc_start 1982-03-28 01:00:00 (Sun)
62539952400, # utc_end 1982-10-24 01:00:00 (Sun)
62521812000, # local_start 1982-03-28 02:00:00 (Sun)
62539956000, # local_end 1982-10-24 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62539952400, # utc_start 1982-10-24 01:00:00 (Sun)
62553258000, # utc_end 1983-03-27 01:00:00 (Sun)
62539952400, # local_start 1982-10-24 01:00:00 (Sun)
62553258000, # local_end 1983-03-27 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62553258000, # utc_start 1983-03-27 01:00:00 (Sun)
62571402000, # utc_end 1983-10-23 01:00:00 (Sun)
62553261600, # local_start 1983-03-27 02:00:00 (Sun)
62571405600, # local_end 1983-10-23 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62571402000, # utc_start 1983-10-23 01:00:00 (Sun)
62584707600, # utc_end 1984-03-25 01:00:00 (Sun)
62571402000, # local_start 1983-10-23 01:00:00 (Sun)
62584707600, # local_end 1984-03-25 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62584707600, # utc_start 1984-03-25 01:00:00 (Sun)
62603456400, # utc_end 1984-10-28 01:00:00 (Sun)
62584711200, # local_start 1984-03-25 02:00:00 (Sun)
62603460000, # local_end 1984-10-28 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62603456400, # utc_start 1984-10-28 01:00:00 (Sun)
62616762000, # utc_end 1985-03-31 01:00:00 (Sun)
62603456400, # local_start 1984-10-28 01:00:00 (Sun)
62616762000, # local_end 1985-03-31 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62616762000, # utc_start 1985-03-31 01:00:00 (Sun)
62634906000, # utc_end 1985-10-27 01:00:00 (Sun)
62616765600, # local_start 1985-03-31 02:00:00 (Sun)
62634909600, # local_end 1985-10-27 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62634906000, # utc_start 1985-10-27 01:00:00 (Sun)
62648211600, # utc_end 1986-03-30 01:00:00 (Sun)
62634906000, # local_start 1985-10-27 01:00:00 (Sun)
62648211600, # local_end 1986-03-30 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62648211600, # utc_start 1986-03-30 01:00:00 (Sun)
62666355600, # utc_end 1986-10-26 01:00:00 (Sun)
62648215200, # local_start 1986-03-30 02:00:00 (Sun)
62666359200, # local_end 1986-10-26 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62666355600, # utc_start 1986-10-26 01:00:00 (Sun)
62679661200, # utc_end 1987-03-29 01:00:00 (Sun)
62666355600, # local_start 1986-10-26 01:00:00 (Sun)
62679661200, # local_end 1987-03-29 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62679661200, # utc_start 1987-03-29 01:00:00 (Sun)
62697805200, # utc_end 1987-10-25 01:00:00 (Sun)
62679664800, # local_start 1987-03-29 02:00:00 (Sun)
62697808800, # local_end 1987-10-25 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62697805200, # utc_start 1987-10-25 01:00:00 (Sun)
62711110800, # utc_end 1988-03-27 01:00:00 (Sun)
62697805200, # local_start 1987-10-25 01:00:00 (Sun)
62711110800, # local_end 1988-03-27 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62711110800, # utc_start 1988-03-27 01:00:00 (Sun)
62729254800, # utc_end 1988-10-23 01:00:00 (Sun)
62711114400, # local_start 1988-03-27 02:00:00 (Sun)
62729258400, # local_end 1988-10-23 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62729254800, # utc_start 1988-10-23 01:00:00 (Sun)
62742560400, # utc_end 1989-03-26 01:00:00 (Sun)
62729254800, # local_start 1988-10-23 01:00:00 (Sun)
62742560400, # local_end 1989-03-26 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62742560400, # utc_start 1989-03-26 01:00:00 (Sun)
62761309200, # utc_end 1989-10-29 01:00:00 (Sun)
62742564000, # local_start 1989-03-26 02:00:00 (Sun)
62761312800, # local_end 1989-10-29 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62761309200, # utc_start 1989-10-29 01:00:00 (Sun)
62774010000, # utc_end 1990-03-25 01:00:00 (Sun)
62761309200, # local_start 1989-10-29 01:00:00 (Sun)
62774010000, # local_end 1990-03-25 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62774010000, # utc_start 1990-03-25 01:00:00 (Sun)
62792758800, # utc_end 1990-10-28 01:00:00 (Sun)
62774013600, # local_start 1990-03-25 02:00:00 (Sun)
62792762400, # local_end 1990-10-28 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62792758800, # utc_start 1990-10-28 01:00:00 (Sun)
62806064400, # utc_end 1991-03-31 01:00:00 (Sun)
62792758800, # local_start 1990-10-28 01:00:00 (Sun)
62806064400, # local_end 1991-03-31 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62806064400, # utc_start 1991-03-31 01:00:00 (Sun)
62824208400, # utc_end 1991-10-27 01:00:00 (Sun)
62806068000, # local_start 1991-03-31 02:00:00 (Sun)
62824212000, # local_end 1991-10-27 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62824208400, # utc_start 1991-10-27 01:00:00 (Sun)
62837514000, # utc_end 1992-03-29 01:00:00 (Sun)
62824208400, # local_start 1991-10-27 01:00:00 (Sun)
62837514000, # local_end 1992-03-29 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62837514000, # utc_start 1992-03-29 01:00:00 (Sun)
62855658000, # utc_end 1992-10-25 01:00:00 (Sun)
62837517600, # local_start 1992-03-29 02:00:00 (Sun)
62855661600, # local_end 1992-10-25 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62855658000, # utc_start 1992-10-25 01:00:00 (Sun)
62868963600, # utc_end 1993-03-28 01:00:00 (Sun)
62855658000, # local_start 1992-10-25 01:00:00 (Sun)
62868963600, # local_end 1993-03-28 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62868963600, # utc_start 1993-03-28 01:00:00 (Sun)
62887107600, # utc_end 1993-10-24 01:00:00 (Sun)
62868967200, # local_start 1993-03-28 02:00:00 (Sun)
62887111200, # local_end 1993-10-24 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62887107600, # utc_start 1993-10-24 01:00:00 (Sun)
62900413200, # utc_end 1994-03-27 01:00:00 (Sun)
62887107600, # local_start 1993-10-24 01:00:00 (Sun)
62900413200, # local_end 1994-03-27 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62900413200, # utc_start 1994-03-27 01:00:00 (Sun)
62918557200, # utc_end 1994-10-23 01:00:00 (Sun)
62900416800, # local_start 1994-03-27 02:00:00 (Sun)
62918560800, # local_end 1994-10-23 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62918557200, # utc_start 1994-10-23 01:00:00 (Sun)
62931862800, # utc_end 1995-03-26 01:00:00 (Sun)
62918557200, # local_start 1994-10-23 01:00:00 (Sun)
62931862800, # local_end 1995-03-26 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62931862800, # utc_start 1995-03-26 01:00:00 (Sun)
62950006800, # utc_end 1995-10-22 01:00:00 (Sun)
62931866400, # local_start 1995-03-26 02:00:00 (Sun)
62950010400, # local_end 1995-10-22 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62950006800, # utc_start 1995-10-22 01:00:00 (Sun)
62956137600, # utc_end 1996-01-01 00:00:00 (Mon)
62950006800, # local_start 1995-10-22 01:00:00 (Sun)
62956137600, # local_end 1996-01-01 00:00:00 (Mon)
0,
0,
'GMT',
],
[
62956137600, # utc_start 1996-01-01 00:00:00 (Mon)
62963917200, # utc_end 1996-03-31 01:00:00 (Sun)
62956137600, # local_start 1996-01-01 00:00:00 (Mon)
62963917200, # local_end 1996-03-31 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62963917200, # utc_start 1996-03-31 01:00:00 (Sun)
62982061200, # utc_end 1996-10-27 01:00:00 (Sun)
62963920800, # local_start 1996-03-31 02:00:00 (Sun)
62982064800, # local_end 1996-10-27 02:00:00 (Sun)
3600,
1,
'BST',
],
[
62982061200, # utc_start 1996-10-27 01:00:00 (Sun)
62995366800, # utc_end 1997-03-30 01:00:00 (Sun)
62982061200, # local_start 1996-10-27 01:00:00 (Sun)
62995366800, # local_end 1997-03-30 01:00:00 (Sun)
0,
0,
'GMT',
],
[
62995366800, # utc_start 1997-03-30 01:00:00 (Sun)
63013510800, # utc_end 1997-10-26 01:00:00 (Sun)
62995370400, # local_start 1997-03-30 02:00:00 (Sun)
63013514400, # local_end 1997-10-26 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63013510800, # utc_start 1997-10-26 01:00:00 (Sun)
63026816400, # utc_end 1998-03-29 01:00:00 (Sun)
63013510800, # local_start 1997-10-26 01:00:00 (Sun)
63026816400, # local_end 1998-03-29 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63026816400, # utc_start 1998-03-29 01:00:00 (Sun)
63044960400, # utc_end 1998-10-25 01:00:00 (Sun)
63026820000, # local_start 1998-03-29 02:00:00 (Sun)
63044964000, # local_end 1998-10-25 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63044960400, # utc_start 1998-10-25 01:00:00 (Sun)
63058266000, # utc_end 1999-03-28 01:00:00 (Sun)
63044960400, # local_start 1998-10-25 01:00:00 (Sun)
63058266000, # local_end 1999-03-28 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63058266000, # utc_start 1999-03-28 01:00:00 (Sun)
63077014800, # utc_end 1999-10-31 01:00:00 (Sun)
63058269600, # local_start 1999-03-28 02:00:00 (Sun)
63077018400, # local_end 1999-10-31 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63077014800, # utc_start 1999-10-31 01:00:00 (Sun)
63089715600, # utc_end 2000-03-26 01:00:00 (Sun)
63077014800, # local_start 1999-10-31 01:00:00 (Sun)
63089715600, # local_end 2000-03-26 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63089715600, # utc_start 2000-03-26 01:00:00 (Sun)
63108464400, # utc_end 2000-10-29 01:00:00 (Sun)
63089719200, # local_start 2000-03-26 02:00:00 (Sun)
63108468000, # local_end 2000-10-29 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63108464400, # utc_start 2000-10-29 01:00:00 (Sun)
63121165200, # utc_end 2001-03-25 01:00:00 (Sun)
63108464400, # local_start 2000-10-29 01:00:00 (Sun)
63121165200, # local_end 2001-03-25 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63121165200, # utc_start 2001-03-25 01:00:00 (Sun)
63139914000, # utc_end 2001-10-28 01:00:00 (Sun)
63121168800, # local_start 2001-03-25 02:00:00 (Sun)
63139917600, # local_end 2001-10-28 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63139914000, # utc_start 2001-10-28 01:00:00 (Sun)
63153219600, # utc_end 2002-03-31 01:00:00 (Sun)
63139914000, # local_start 2001-10-28 01:00:00 (Sun)
63153219600, # local_end 2002-03-31 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63153219600, # utc_start 2002-03-31 01:00:00 (Sun)
63171363600, # utc_end 2002-10-27 01:00:00 (Sun)
63153223200, # local_start 2002-03-31 02:00:00 (Sun)
63171367200, # local_end 2002-10-27 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63171363600, # utc_start 2002-10-27 01:00:00 (Sun)
63184669200, # utc_end 2003-03-30 01:00:00 (Sun)
63171363600, # local_start 2002-10-27 01:00:00 (Sun)
63184669200, # local_end 2003-03-30 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63184669200, # utc_start 2003-03-30 01:00:00 (Sun)
63202813200, # utc_end 2003-10-26 01:00:00 (Sun)
63184672800, # local_start 2003-03-30 02:00:00 (Sun)
63202816800, # local_end 2003-10-26 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63202813200, # utc_start 2003-10-26 01:00:00 (Sun)
63216118800, # utc_end 2004-03-28 01:00:00 (Sun)
63202813200, # local_start 2003-10-26 01:00:00 (Sun)
63216118800, # local_end 2004-03-28 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63216118800, # utc_start 2004-03-28 01:00:00 (Sun)
63234867600, # utc_end 2004-10-31 01:00:00 (Sun)
63216122400, # local_start 2004-03-28 02:00:00 (Sun)
63234871200, # local_end 2004-10-31 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63234867600, # utc_start 2004-10-31 01:00:00 (Sun)
63247568400, # utc_end 2005-03-27 01:00:00 (Sun)
63234867600, # local_start 2004-10-31 01:00:00 (Sun)
63247568400, # local_end 2005-03-27 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63247568400, # utc_start 2005-03-27 01:00:00 (Sun)
63266317200, # utc_end 2005-10-30 01:00:00 (Sun)
63247572000, # local_start 2005-03-27 02:00:00 (Sun)
63266320800, # local_end 2005-10-30 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63266317200, # utc_start 2005-10-30 01:00:00 (Sun)
63279018000, # utc_end 2006-03-26 01:00:00 (Sun)
63266317200, # local_start 2005-10-30 01:00:00 (Sun)
63279018000, # local_end 2006-03-26 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63279018000, # utc_start 2006-03-26 01:00:00 (Sun)
63297766800, # utc_end 2006-10-29 01:00:00 (Sun)
63279021600, # local_start 2006-03-26 02:00:00 (Sun)
63297770400, # local_end 2006-10-29 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63297766800, # utc_start 2006-10-29 01:00:00 (Sun)
63310467600, # utc_end 2007-03-25 01:00:00 (Sun)
63297766800, # local_start 2006-10-29 01:00:00 (Sun)
63310467600, # local_end 2007-03-25 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63310467600, # utc_start 2007-03-25 01:00:00 (Sun)
63329216400, # utc_end 2007-10-28 01:00:00 (Sun)
63310471200, # local_start 2007-03-25 02:00:00 (Sun)
63329220000, # local_end 2007-10-28 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63329216400, # utc_start 2007-10-28 01:00:00 (Sun)
63342522000, # utc_end 2008-03-30 01:00:00 (Sun)
63329216400, # local_start 2007-10-28 01:00:00 (Sun)
63342522000, # local_end 2008-03-30 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63342522000, # utc_start 2008-03-30 01:00:00 (Sun)
63360666000, # utc_end 2008-10-26 01:00:00 (Sun)
63342525600, # local_start 2008-03-30 02:00:00 (Sun)
63360669600, # local_end 2008-10-26 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63360666000, # utc_start 2008-10-26 01:00:00 (Sun)
63373971600, # utc_end 2009-03-29 01:00:00 (Sun)
63360666000, # local_start 2008-10-26 01:00:00 (Sun)
63373971600, # local_end 2009-03-29 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63373971600, # utc_start 2009-03-29 01:00:00 (Sun)
63392115600, # utc_end 2009-10-25 01:00:00 (Sun)
63373975200, # local_start 2009-03-29 02:00:00 (Sun)
63392119200, # local_end 2009-10-25 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63392115600, # utc_start 2009-10-25 01:00:00 (Sun)
63405421200, # utc_end 2010-03-28 01:00:00 (Sun)
63392115600, # local_start 2009-10-25 01:00:00 (Sun)
63405421200, # local_end 2010-03-28 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63405421200, # utc_start 2010-03-28 01:00:00 (Sun)
63424170000, # utc_end 2010-10-31 01:00:00 (Sun)
63405424800, # local_start 2010-03-28 02:00:00 (Sun)
63424173600, # local_end 2010-10-31 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63424170000, # utc_start 2010-10-31 01:00:00 (Sun)
63436870800, # utc_end 2011-03-27 01:00:00 (Sun)
63424170000, # local_start 2010-10-31 01:00:00 (Sun)
63436870800, # local_end 2011-03-27 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63436870800, # utc_start 2011-03-27 01:00:00 (Sun)
63455619600, # utc_end 2011-10-30 01:00:00 (Sun)
63436874400, # local_start 2011-03-27 02:00:00 (Sun)
63455623200, # local_end 2011-10-30 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63455619600, # utc_start 2011-10-30 01:00:00 (Sun)
63468320400, # utc_end 2012-03-25 01:00:00 (Sun)
63455619600, # local_start 2011-10-30 01:00:00 (Sun)
63468320400, # local_end 2012-03-25 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63468320400, # utc_start 2012-03-25 01:00:00 (Sun)
63487069200, # utc_end 2012-10-28 01:00:00 (Sun)
63468324000, # local_start 2012-03-25 02:00:00 (Sun)
63487072800, # local_end 2012-10-28 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63487069200, # utc_start 2012-10-28 01:00:00 (Sun)
63500374800, # utc_end 2013-03-31 01:00:00 (Sun)
63487069200, # local_start 2012-10-28 01:00:00 (Sun)
63500374800, # local_end 2013-03-31 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63500374800, # utc_start 2013-03-31 01:00:00 (Sun)
63518518800, # utc_end 2013-10-27 01:00:00 (Sun)
63500378400, # local_start 2013-03-31 02:00:00 (Sun)
63518522400, # local_end 2013-10-27 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63518518800, # utc_start 2013-10-27 01:00:00 (Sun)
63531824400, # utc_end 2014-03-30 01:00:00 (Sun)
63518518800, # local_start 2013-10-27 01:00:00 (Sun)
63531824400, # local_end 2014-03-30 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63531824400, # utc_start 2014-03-30 01:00:00 (Sun)
63549968400, # utc_end 2014-10-26 01:00:00 (Sun)
63531828000, # local_start 2014-03-30 02:00:00 (Sun)
63549972000, # local_end 2014-10-26 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63549968400, # utc_start 2014-10-26 01:00:00 (Sun)
63563274000, # utc_end 2015-03-29 01:00:00 (Sun)
63549968400, # local_start 2014-10-26 01:00:00 (Sun)
63563274000, # local_end 2015-03-29 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63563274000, # utc_start 2015-03-29 01:00:00 (Sun)
63581418000, # utc_end 2015-10-25 01:00:00 (Sun)
63563277600, # local_start 2015-03-29 02:00:00 (Sun)
63581421600, # local_end 2015-10-25 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63581418000, # utc_start 2015-10-25 01:00:00 (Sun)
63594723600, # utc_end 2016-03-27 01:00:00 (Sun)
63581418000, # local_start 2015-10-25 01:00:00 (Sun)
63594723600, # local_end 2016-03-27 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63594723600, # utc_start 2016-03-27 01:00:00 (Sun)
63613472400, # utc_end 2016-10-30 01:00:00 (Sun)
63594727200, # local_start 2016-03-27 02:00:00 (Sun)
63613476000, # local_end 2016-10-30 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63613472400, # utc_start 2016-10-30 01:00:00 (Sun)
63626173200, # utc_end 2017-03-26 01:00:00 (Sun)
63613472400, # local_start 2016-10-30 01:00:00 (Sun)
63626173200, # local_end 2017-03-26 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63626173200, # utc_start 2017-03-26 01:00:00 (Sun)
63644922000, # utc_end 2017-10-29 01:00:00 (Sun)
63626176800, # local_start 2017-03-26 02:00:00 (Sun)
63644925600, # local_end 2017-10-29 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63644922000, # utc_start 2017-10-29 01:00:00 (Sun)
63657622800, # utc_end 2018-03-25 01:00:00 (Sun)
63644922000, # local_start 2017-10-29 01:00:00 (Sun)
63657622800, # local_end 2018-03-25 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63657622800, # utc_start 2018-03-25 01:00:00 (Sun)
63676371600, # utc_end 2018-10-28 01:00:00 (Sun)
63657626400, # local_start 2018-03-25 02:00:00 (Sun)
63676375200, # local_end 2018-10-28 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63676371600, # utc_start 2018-10-28 01:00:00 (Sun)
63689677200, # utc_end 2019-03-31 01:00:00 (Sun)
63676371600, # local_start 2018-10-28 01:00:00 (Sun)
63689677200, # local_end 2019-03-31 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63689677200, # utc_start 2019-03-31 01:00:00 (Sun)
63707821200, # utc_end 2019-10-27 01:00:00 (Sun)
63689680800, # local_start 2019-03-31 02:00:00 (Sun)
63707824800, # local_end 2019-10-27 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63707821200, # utc_start 2019-10-27 01:00:00 (Sun)
63721126800, # utc_end 2020-03-29 01:00:00 (Sun)
63707821200, # local_start 2019-10-27 01:00:00 (Sun)
63721126800, # local_end 2020-03-29 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63721126800, # utc_start 2020-03-29 01:00:00 (Sun)
63739270800, # utc_end 2020-10-25 01:00:00 (Sun)
63721130400, # local_start 2020-03-29 02:00:00 (Sun)
63739274400, # local_end 2020-10-25 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63739270800, # utc_start 2020-10-25 01:00:00 (Sun)
63752576400, # utc_end 2021-03-28 01:00:00 (Sun)
63739270800, # local_start 2020-10-25 01:00:00 (Sun)
63752576400, # local_end 2021-03-28 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63752576400, # utc_start 2021-03-28 01:00:00 (Sun)
63771325200, # utc_end 2021-10-31 01:00:00 (Sun)
63752580000, # local_start 2021-03-28 02:00:00 (Sun)
63771328800, # local_end 2021-10-31 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63771325200, # utc_start 2021-10-31 01:00:00 (Sun)
63784026000, # utc_end 2022-03-27 01:00:00 (Sun)
63771325200, # local_start 2021-10-31 01:00:00 (Sun)
63784026000, # local_end 2022-03-27 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63784026000, # utc_start 2022-03-27 01:00:00 (Sun)
63802774800, # utc_end 2022-10-30 01:00:00 (Sun)
63784029600, # local_start 2022-03-27 02:00:00 (Sun)
63802778400, # local_end 2022-10-30 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63802774800, # utc_start 2022-10-30 01:00:00 (Sun)
63815475600, # utc_end 2023-03-26 01:00:00 (Sun)
63802774800, # local_start 2022-10-30 01:00:00 (Sun)
63815475600, # local_end 2023-03-26 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63815475600, # utc_start 2023-03-26 01:00:00 (Sun)
63834224400, # utc_end 2023-10-29 01:00:00 (Sun)
63815479200, # local_start 2023-03-26 02:00:00 (Sun)
63834228000, # local_end 2023-10-29 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63834224400, # utc_start 2023-10-29 01:00:00 (Sun)
63847530000, # utc_end 2024-03-31 01:00:00 (Sun)
63834224400, # local_start 2023-10-29 01:00:00 (Sun)
63847530000, # local_end 2024-03-31 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63847530000, # utc_start 2024-03-31 01:00:00 (Sun)
63865674000, # utc_end 2024-10-27 01:00:00 (Sun)
63847533600, # local_start 2024-03-31 02:00:00 (Sun)
63865677600, # local_end 2024-10-27 02:00:00 (Sun)
3600,
1,
'BST',
],
[
63865674000, # utc_start 2024-10-27 01:00:00 (Sun)
63878979600, # utc_end 2025-03-30 01:00:00 (Sun)
63865674000, # local_start 2024-10-27 01:00:00 (Sun)
63878979600, # local_end 2025-03-30 01:00:00 (Sun)
0,
0,
'GMT',
],
[
63878979600, # utc_start 2025-03-30 01:00:00 (Sun)
63897123600, # utc_end 2025-10-26 01:00:00 (Sun)
63878983200, # local_start 2025-03-30 02:00:00 (Sun)
63897127200, # local_end 2025-10-26 02:00:00 (Sun)
3600,
1,
'BST',
],
];
sub olson_version {'2014j'}
sub has_dst_changes {114}
sub _max_year {2024}
sub _new_instance {
return shift->_init( @_, spans => $spans );
}
sub _last_offset { 0 }
my $last_observance = bless( {
'format' => 'GMT/BST',
'gmtoff' => '0:00',
'local_start_datetime' => bless( {
'formatter' => undef,
'local_rd_days' => 728659,
'local_rd_secs' => 0,
'offset_modifier' => 0,
'rd_nanosecs' => 0,
'tz' => bless( {
'name' => 'floating',
'offset' => 0
}, 'DateTime::TimeZone::Floating' ),
'utc_rd_days' => 728659,
'utc_rd_secs' => 0,
'utc_year' => 1997
}, 'DateTime' ),
'offset_from_std' => 0,
'offset_from_utc' => 0,
'until' => [],
'utc_start_datetime' => bless( {
'formatter' => undef,
'local_rd_days' => 728659,
'local_rd_secs' => 0,
'offset_modifier' => 0,
'rd_nanosecs' => 0,
'tz' => bless( {
'name' => 'floating',
'offset' => 0
}, 'DateTime::TimeZone::Floating' ),
'utc_rd_days' => 728659,
'utc_rd_secs' => 0,
'utc_year' => 1997
}, 'DateTime' )
}, 'DateTime::TimeZone::OlsonDB::Observance' )
;
sub _last_observance { $last_observance }
my $rules = [
bless( {
'at' => '1:00u',
'from' => '1981',
'in' => 'Mar',
'letter' => 'S',
'name' => 'EU',
'offset_from_std' => 3600,
'on' => 'lastSun',
'save' => '1:00',
'to' => 'max',
'type' => undef
}, 'DateTime::TimeZone::OlsonDB::Rule' ),
bless( {
'at' => '1:00u',
'from' => '1996',
'in' => 'Oct',
'letter' => '',
'name' => 'EU',
'offset_from_std' => 0,
'on' => 'lastSun',
'save' => '0',
'to' => 'max',
'type' => undef
}, 'DateTime::TimeZone::OlsonDB::Rule' )
]
;
sub _rules { $rules }
1;
| 26.829562 | 99 | 0.632266 |
73e4823099b7c0f1a669b9fdf8d3f07bd962c57c | 1,606 | pm | Perl | perl/lib/AmiGO/External/HTML/Wiki/GOLD.pm | nathandunn/amigo | 7b0059fb044c695a8786cd0caa7cb5980c1e1a40 | [
"BSD-3-Clause"
]
| 24 | 2015-02-10T16:52:05.000Z | 2021-08-12T22:21:47.000Z | perl/lib/AmiGO/External/HTML/Wiki/GOLD.pm | nathandunn/amigo | 7b0059fb044c695a8786cd0caa7cb5980c1e1a40 | [
"BSD-3-Clause"
]
| 488 | 2015-01-29T23:29:59.000Z | 2022-03-31T19:58:45.000Z | perl/lib/AmiGO/External/HTML/Wiki/GOLD.pm | nathandunn/amigo | 7b0059fb044c695a8786cd0caa7cb5980c1e1a40 | [
"BSD-3-Clause"
]
| 11 | 2015-10-27T22:15:07.000Z | 2021-12-21T21:57:25.000Z | =head1 AmiGO::External::HTML::Wiki::GOLD
Defines a specific interface to contact the GO SQL examples page.
Usage:
use AmiGO::External::HTML::Wiki::GOLD;
$x = AmiGO::External::HTML::Wiki::GOLD->new();
print scalar(@{$x->extract_sql()});
print ${$x->extract()}[0]->{title};
print ${$x->extract()}[0]->{value};
=cut
use utf8;
use strict;
package AmiGO::External::HTML::Wiki::GOLD;
use base ("AmiGO::External::HTML::Wiki");
=item $URL_FOR_SQLWIKI
This is the URL that points to the GO SQL wiki.
=cut
my $URL_FOR_SQLWIKI = 'http://wiki.geneontology.org/index.php/Example_GOLD_Queries';
my $MATCH_FOR_SQLWIKI = '<span class=\"mw-headline\" id=\"[\w\s\_\-\:\;\,\.]*\">\s*([^\n]*?)<\/span><\/h[3-4]>.*?<pre>\s*(.*?)<\/pre>';
=item new
...
=cut
sub new {
##
my $class = shift;
my $self = $class->SUPER::new($URL_FOR_SQLWIKI);
bless $self, $class;
return $self;
}
=item extract
...
=cut
sub extract {
# my $self = shift;
# return $self->{AEHW_PARSER}->($self->{EXT_DATA});
my $self = shift;
#my $data = shift || die "need a data argument";
my $retval = [];
#$self->kvetch("Extracted: " . $data);
my %examples = $self->{EXT_DATA} =~ /$MATCH_FOR_SQLWIKI/gs;
foreach my $title (sort keys %examples){
#$self->kvetch("Extracted: " . $self->{EXT_DATA});
## Transform any problem causing characters.
my $munched = $examples{$title};
#$munched =~ s/ +/ /g;
#$munched =~ s/\n/\\n/g;
$munched =~ s/\t/\\t/g;
$munched =~ tr/"/\"/;
push @$retval,
{
title => $title,
sql => $munched,
};
}
return $retval;
}
1;
| 18.45977 | 135 | 0.585928 |
73de79e15454f5288be7cb18109c2c8a5bece956 | 30 | pl | Perl | messitup.pl | trevortomesh/salmonnella | 3810becb2f1cff3bfaed561ddc9fc5afecb2e1cd | [
"Unlicense"
]
| null | null | null | messitup.pl | trevortomesh/salmonnella | 3810becb2f1cff3bfaed561ddc9fc5afecb2e1cd | [
"Unlicense"
]
| null | null | null | messitup.pl | trevortomesh/salmonnella | 3810becb2f1cff3bfaed561ddc9fc5afecb2e1cd | [
"Unlicense"
]
| null | null | null | This will mess everything up!
| 15 | 29 | 0.8 |
ed2ccd4277d302483989c925bf1f91371c944d01 | 4,063 | t | Perl | share/doc/smm/18.net/e.t | weiss/original-bsd | b44636d7febc9dcf553118bd320571864188351d | [
"Unlicense"
]
| 114 | 2015-01-18T22:55:52.000Z | 2022-02-17T10:45:02.000Z | share/doc/smm/18.net/e.t | JamesLinus/original-bsd | b44636d7febc9dcf553118bd320571864188351d | [
"Unlicense"
]
| null | null | null | share/doc/smm/18.net/e.t | JamesLinus/original-bsd | b44636d7febc9dcf553118bd320571864188351d | [
"Unlicense"
]
| 29 | 2015-11-03T22:05:22.000Z | 2022-02-08T15:36:37.000Z | .\" Copyright (c) 1983, 1986, 1993
.\" The Regents of the University of California. All rights reserved.
.\"
.\" %sccs.include.redist.roff%
.\"
.\" @(#)e.t 8.1 (Berkeley) 06/08/93
.\"
.nr H2 1
.\".ds RH "Trailer protocols
.br
.ne 2i
.NH
\s+2Trailer protocols\s0
.PP
Core to core copies can be expensive.
Consequently, a great deal of effort was spent
in minimizing such operations. The VAX architecture
provides virtual memory hardware organized in
page units. To cut down on copy operations, data
is kept in page-sized units on page-aligned
boundaries whenever possible. This allows data
to be moved in memory simply by remapping the page
instead of copying. The mbuf and network
interface routines perform page table manipulations
where needed, hiding the complexities of the VAX
virtual memory hardware from higher level code.
.PP
Data enters the system in two ways: from the user,
or from the network (hardware interface). When data
is copied from the user's address space
into the system it is deposited in pages (if sufficient
data is present).
This encourages the user to transmit information in
messages which are a multiple of the system page size.
.PP
Unfortunately, performing a similar operation when taking
data from the network is very difficult.
Consider the format of an incoming packet. A packet
usually contains a local network header followed by
one or more headers used by the high level protocols.
Finally, the data, if any, follows these headers. Since
the header information may be variable length, DMA'ing the eventual
data for the user into a page aligned area of
memory is impossible without
\fIa priori\fP knowledge of the format (e.g., by supporting
only a single protocol header format).
.PP
To allow variable length header information to
be present and still ensure page alignment of data,
a special local network encapsulation may be used.
This encapsulation, termed a \fItrailer protocol\fP [Leffler84],
places the variable length header information after
the data. A fixed size local network
header is then prepended to the resultant packet.
The local network header contains the size of the
data portion (in units of 512 bytes), and a new \fItrailer protocol
header\fP, inserted before the variable length
information, contains the size of the variable length
header information. The following trailer
protocol header is used to store information
regarding the variable length protocol header:
.DS
._f
struct {
short protocol; /* original protocol no. */
short length; /* length of trailer */
};
.DE
.PP
The processing of the trailer protocol is very
simple. On output, the local network header indicates that
a trailer encapsulation is being used.
The header also includes an indication
of the number of data pages present before the trailer
protocol header. The trailer protocol header is
initialized to contain the actual protocol identifier and the
variable length header size, and is appended to the data
along with the variable length header information.
.PP
On input, the interface routines identify the
trailer encapsulation
by the protocol type stored in the local network header,
then calculate the number of
pages of data to find the beginning of the trailer.
The trailing information is copied into a separate
mbuf and linked to the front of the resultant packet.
.PP
Clearly, trailer protocols require cooperation between
source and destination. In addition, they are normally
cost effective only when sizable packets are used. The
current scheme works because the local network encapsulation
header is a fixed size, allowing DMA operations
to be performed at a known offset from the first data page
being received. Should the local network header be
variable length this scheme fails.
.PP
Statistics collected indicate that as much as 200Kb/s
can be gained by using a trailer protocol with
1Kbyte packets. The average size of the variable
length header was 40 bytes (the size of a
minimal TCP/IP packet header). If hardware
supports larger sized packets, even greater gains
may be realized.
| 39.067308 | 70 | 0.795471 |
ed11061c5b675da8c545aa7138f889fd32f96956 | 302 | pm | Perl | pdu-perl-api/Raritan/RPC/pdumodel/Pdu_4_1_5/StartupState.pm | gregoa/raritan-pdu-json-rpc-sdk | 76df982462742b97b52872aa34630140f5df7e58 | [
"BSD-3-Clause"
]
| 1 | 2021-04-29T23:04:17.000Z | 2021-04-29T23:04:17.000Z | pdu-perl-api/Raritan/RPC/pdumodel/Pdu_4_1_5/StartupState.pm | gregoa/raritan-pdu-json-rpc-sdk | 76df982462742b97b52872aa34630140f5df7e58 | [
"BSD-3-Clause"
]
| null | null | null | pdu-perl-api/Raritan/RPC/pdumodel/Pdu_4_1_5/StartupState.pm | gregoa/raritan-pdu-json-rpc-sdk | 76df982462742b97b52872aa34630140f5df7e58 | [
"BSD-3-Clause"
]
| 2 | 2020-06-20T16:21:23.000Z | 2021-09-28T19:04:44.000Z | # SPDX-License-Identifier: BSD-3-Clause
#
# Copyright 2020 Raritan Inc. All rights reserved.
#
# This file was generated by IdlC from Pdu.idl.
use strict;
package Raritan::RPC::pdumodel::Pdu_4_1_5::StartupState;
use constant SS_ON => 0;
use constant SS_OFF => 1;
use constant SS_LASTKNOWN => 2;
1;
| 18.875 | 56 | 0.735099 |
ed2abc8bfb2177590a96967d41bfd46054f10911 | 338 | pl | Perl | imsane/external/matlabmesh/data/pointsets/surfelmean.pl | K-D-Gallagher/eye-patterning | fef5ba1e4fa90f01b55b67c74bf429c6c873acc1 | [
"MIT"
]
| null | null | null | imsane/external/matlabmesh/data/pointsets/surfelmean.pl | K-D-Gallagher/eye-patterning | fef5ba1e4fa90f01b55b67c74bf429c6c873acc1 | [
"MIT"
]
| null | null | null | imsane/external/matlabmesh/data/pointsets/surfelmean.pl | K-D-Gallagher/eye-patterning | fef5ba1e4fa90f01b55b67c74bf429c6c873acc1 | [
"MIT"
]
| null | null | null |
open FILE,$ARGV[0];
$sumx = 0;
$sumy = 0;
$sumz = 0;
$count = 0;
while (<FILE>) {
$line = $_;
@data = split /\s+/,$line;
$sumx += $data[0];
$sumy += $data[1];
$sumz += $data[2];
$count++;
}
$sumx /= $count;
$sumy /= $count;
$sumz /= $count;
print "$count surfels, mean $sumx $sumy $sumz\n";
| 16.095238 | 50 | 0.45858 |
ed3a17bbe1363007b98b4ee4d523bad1cfee7761 | 398 | pl | Perl | lib/utfcpp/v2_0/buildrelease.pl | jadler/ledger | ed5886921bcce0d1a261a37aa83bf135259b7d21 | [
"BSD-3-Clause"
]
| 3,509 | 2015-01-01T11:47:51.000Z | 2022-03-30T09:22:43.000Z | lib/utfcpp/v2_0/buildrelease.pl | jadler/ledger | ed5886921bcce0d1a261a37aa83bf135259b7d21 | [
"BSD-3-Clause"
]
| 651 | 2015-01-09T16:18:10.000Z | 2022-03-26T23:52:00.000Z | lib/utfcpp/v2_0/buildrelease.pl | jadler/ledger | ed5886921bcce0d1a261a37aa83bf135259b7d21 | [
"BSD-3-Clause"
]
| 440 | 2015-01-02T21:28:11.000Z | 2022-03-25T05:38:08.000Z | #! /usr/bin/perl
$release_files = 'source/utf8.h source/utf8/core.h source/utf8/checked.h source/utf8/unchecked.h doc/utf8cpp.html doc/ReleaseNotes';
# First get the latest version
`svn update`;
# Then construct the name of the zip file
$argc = @ARGV;
if ($argc > 0) {
$zip_name = $ARGV[0];
}
else {
$zip_name = "utf8";
}
# Zip the files to an archive
`zip $zip_name $release_files`;
| 20.947368 | 133 | 0.680905 |
73f944ecb14afce067b04568aa391eaf0a869ce8 | 528 | pl | Perl | codetest.pl | atrsoftgmbh/mailclient-transfer | f53bf73dab5fc8a50f17217e1edebdf9865da252 | [
"Apache-2.0"
]
| 1 | 2018-05-03T22:52:47.000Z | 2018-05-03T22:52:47.000Z | codetest.pl | atrsoftgmbh/mailclient-transfer | f53bf73dab5fc8a50f17217e1edebdf9865da252 | [
"Apache-2.0"
]
| null | null | null | codetest.pl | atrsoftgmbh/mailclient-transfer | f53bf73dab5fc8a50f17217e1edebdf9865da252 | [
"Apache-2.0"
]
| null | null | null |
sub printout {
my $m = shift;
for (my $i = $m->{hstart}; $i <= $m->{bend} ; ++$i) {
print $m->{text} -> [$i];
}
}
sub checkfedoralist {
my $ret = 0;
my $c = shift; # the candidate line, speeds up
my $mail_r = shift ; # the whole mail
my $s = shift ; # the matcher itself
my $cnr = shift ; # my code check number to identify the check
my $lnr = shift;
my $i = index($c, 'users@lists.fedoraproject.org');
return 1 if $i == -1; # bad. no good
return $ret;
}
1;
| 15.529412 | 66 | 0.520833 |
ed1e935edad7e91ede690889d72b5940f971654d | 14,862 | pl | Perl | Results/abd_eva/TD_E/npn.spacy_lg/r200,c20_ab,ch,cKB,cT,p123.ans_KB.pl | kovvalsky/prove_SICK_NL | bc6b4d9b0865e6a82c782fa5a226947d1c0d63e6 | [
"MIT"
]
| 2 | 2021-12-09T08:52:14.000Z | 2022-02-10T14:11:54.000Z | Results/abd_eva/TD_E/npn.spacy_lg/r200,c20_ab,ch,cKB,cT,p123.ans_KB.pl | kovvalsky/prove_SICK_NL | bc6b4d9b0865e6a82c782fa5a226947d1c0d63e6 | [
"MIT"
]
| null | null | null | Results/abd_eva/TD_E/npn.spacy_lg/r200,c20_ab,ch,cKB,cT,p123.ans_KB.pl | kovvalsky/prove_SICK_NL | bc6b4d9b0865e6a82c782fa5a226947d1c0d63e6 | [
"MIT"
]
| null | null | null | %%%%%%%%%%%%% Parameters of parList %%%%%%%%%%%%%%
%%% [nil,effCr([equi,nonBr,nonProd,nonCons]),lang(nl),anno_json(SICK_NL/anno/spacy_lg.json),waif(peregrine/Results/abd_eva/TD_E/npn.spacy_lg/r200,c20_ab,ch,cKB,cT,p123.ans),complete_tree,allInt,aall,wn_ant,wn_sim,wn_der,constchck,ral(200),parallel(20),parts([train,trial])]
%%%%%%%%%%%%%%%% Induction config %%%%%%%%%%%%%%%%
%%% [align-both,constchk,constKB,compTerms,patterns-[_180,_186@_188,_198@_200@_206,_222@(_216@_218)]]
%%%%%%%%%%%%%%% Induced Knowledge %%%%%%%%%%%%%%%%
ind_rel(isa_wn(zwemmen,'bijten in_een_stok')).
ind_rel(isa_wn(zwembad,'is in@(the@(van@(the@oceaan)@buurt))')).
ind_rel(isa_wn(zwart,kleuren)).
ind_rel(isa_wn(zwart,is)).
ind_rel(isa_wn(zwart,donker)).
ind_rel(isa_wn(zwaard,speelgoedwapen)).
ind_rel(isa_wn(zwaard,mes)).
ind_rel(isa_wn(zonnebril,'donker bril')).
ind_rel(isa_wn('zitten moe',zitten)).
ind_rel(isa_wn('zitten achterna',achtervolgen)).
ind_rel(isa_wn(zitten,be)).
ind_rel(isa_wn(zijkant,berg)).
ind_rel(isa_wn(zien,snijden)).
ind_rel(isa_wn(zetten,vastmaken)).
ind_rel(isa_wn(zetten,stoppen)).
ind_rel(isa_wn(zetten,passen)).
ind_rel(isa_wn(zetten,inpakken)).
ind_rel(isa_wn(zetten,'brengen aan')).
ind_rel(isa_wn(zeggen,praten)).
ind_rel(isa_wn(zeekust,strand)).
ind_rel(isa_wn(zandstrand,zandkust)).
ind_rel(isa_wn('worden knippen',knippen)).
ind_rel(isa_wn(wit,blank)).
ind_rel(isa_wn(winkel,gebouw)).
ind_rel(isa_wn(water,waterlichaam)).
ind_rel(isa_wn(vuren,schieten)).
ind_rel(isa_wn(vuil,modderig)).
ind_rel(isa_wn(vrouw,oudje)).
ind_rel(isa_wn(vrouw,meisje)).
ind_rel(isa_wn(vrouw,kok)).
ind_rel(isa_wn(vrouw,'elegant vrouw')).
ind_rel(isa_wn(voor,naar)).
ind_rel(isa_wn(voor,bij)).
ind_rel(isa_wn(volleybal,bal)).
ind_rel(isa_wn(voetballer,voetbalspeler)).
ind_rel(isa_wn(voetbal,voetbalwedstrijd)).
ind_rel(isa_wn(voetbal,bal)).
ind_rel(isa_wn(voertuig,auto)).
ind_rel(isa_wn('voeren uit',doen)).
ind_rel(isa_wn(vlug,snel)).
ind_rel(isa_wn(vloeroefening,oefening)).
ind_rel(isa_wn(visstok,vishengel)).
ind_rel(isa_wn(verven,geel)).
ind_rel(isa_wn(verbranden,steken)).
ind_rel(isa_wn(vegen,smeren)).
ind_rel(isa_wn(vasthouden,'houden vast')).
ind_rel(isa_wn(varen,'rijden mee')).
ind_rel(isa_wn(vangen,opstaan)).
ind_rel(isa_wn(van,op)).
ind_rel(isa_wn(van,aan)).
ind_rel(isa_wn(vallen,voetballen)).
ind_rel(isa_wn(uitvoeren,'varen uit')).
ind_rel(isa_wn(trouwjurk,bruidssluier)).
ind_rel(isa_wn('trekken op',stoppen)).
ind_rel(isa_wn('treden op',spelen)).
ind_rel(isa_wn(trede,trap)).
ind_rel(isa_wn(touw,speeltje)).
ind_rel(isa_wn(tomaat,groente)).
ind_rel(isa_wn('tikken af',vallen)).
ind_rel(isa_wn('the meisje','eèn meisje')).
ind_rel(isa_wn('the figuur','enkel figuur')).
ind_rel(isa_wn('the eten','a maaltijd')).
ind_rel(isa_wn(the,twee)).
ind_rel(isa_wn(tennisbal,bal)).
ind_rel(isa_wn(tekenfilmvliegtuig,vliegtuig)).
ind_rel(isa_wn(tekenfilmvliegtuig,'tekenen vliegtuig')).
ind_rel(isa_wn(teckel,hond)).
ind_rel(isa_wn(tas,'geel tas')).
ind_rel(isa_wn(suiker,kruid)).
ind_rel(isa_wn(stuk,'worden knippen')).
ind_rel(isa_wn(stuk,'speelgoed stuk')).
ind_rel(isa_wn(stuk,schijf)).
ind_rel(isa_wn(stuk,'hout stuk')).
ind_rel(isa_wn(strooien,leggen)).
ind_rel(isa_wn(strand,zand)).
ind_rel(isa_wn(strand,wal)).
ind_rel(isa_wn(strand,fiets)).
ind_rel(isa_wn(ster,lucht)).
ind_rel(isa_wn(standbeeld,'gouden standbeeld')).
ind_rel(isa_wn('staan bij_elkaar','staan samen')).
ind_rel(isa_wn(staan,waden)).
ind_rel(isa_wn(staan,wachten)).
ind_rel(isa_wn(staan,'staat achter@haar')).
ind_rel(isa_wn(staan,'staan op_de_weg')).
ind_rel(isa_wn(staan,'staan op')).
ind_rel(isa_wn(sprint,'door@(the@gras) rennen')).
ind_rel(isa_wn(sprint,baas)).
ind_rel(isa_wn('springen hoog',springen)).
ind_rel(isa_wn('springen af',springen)).
ind_rel(isa_wn(springen,stuiteren)).
ind_rel(isa_wn(springen,'springen af')).
ind_rel(isa_wn(springen,klimmen)).
ind_rel(isa_wn(springen,duiken)).
ind_rel(isa_wn('spoelen af',spoelen)).
ind_rel(isa_wn(spoelen,'spoelen af')).
ind_rel(isa_wn(spies,spiesje)).
ind_rel(isa_wn(spetteren,spatten)).
ind_rel(isa_wn(spelen,zingen)).
ind_rel(isa_wn(spelen,tokkelen)).
ind_rel(isa_wn(spelen,'spelen the@piano')).
ind_rel(isa_wn(spelen,glijden)).
ind_rel(isa_wn(speelgoedtelefoon,'speelgoed stuk')).
ind_rel(isa_wn(speelgoedkonijn,knuffelkonijn)).
ind_rel(isa_wn(spannen,draaien)).
ind_rel(isa_wn('snowboard af','snowboardt af')).
ind_rel(isa_wn('snijden door',snijden)).
ind_rel(isa_wn(snijden,hakken)).
ind_rel(isa_wn(snijden,doorsnijden)).
ind_rel(isa_wn(snee,brood)).
ind_rel(isa_wn(slaan,'tikken af')).
ind_rel(isa_wn(slaan,'sterk kloppen')).
ind_rel(isa_wn(shirtloz,hemdloz)).
ind_rel(isa_wn(schroeven,'vastschroeven aan@(a@muur)')).
ind_rel(isa_wn(rust,'op@(the@boomstam) liggen')).
ind_rel(isa_wn(rotsklimmen,bergbeklimmen)).
ind_rel(isa_wn(rond,in)).
ind_rel(isa_wn(roeren,kloppen)).
ind_rel(isa_wn(rivier,waterlichaam)).
ind_rel(isa_wn(rijden,'rijden a@(groot@golf)')).
ind_rel(isa_wn(rijden,besturen)).
ind_rel(isa_wn(richten,trekken)).
ind_rel(isa_wn(rennen,'sprint in@(the@water)')).
ind_rel(isa_wn(rennen,lopen)).
ind_rel(isa_wn(rennen,'afrennen the@weg')).
ind_rel(isa_wn(regenpla,'regen plas')).
ind_rel(isa_wn(raken,'tikken aan')).
ind_rel(isa_wn(raceauto,racevoertuig)).
ind_rel(isa_wn(praten,telefoneren)).
ind_rel(isa_wn(praten,'met@(a@(met@(a@internetcamera)@meisje)) chat')).
ind_rel(isa_wn(praten,bellen)).
ind_rel(isa_wn(potlood,'worden slijpen')).
ind_rel(isa_wn(politiemotor,politiefiet)).
ind_rel(isa_wn(poetsen,schoonmaken)).
ind_rel(isa_wn(pizza,voedsel)).
ind_rel(isa_wn(pet,hoed)).
ind_rel(isa_wn(persoon,man)).
ind_rel(isa_wn(persoon,'klein dier')).
ind_rel(isa_wn(persoon,'inboteren a@dienblad')).
ind_rel(isa_wn(persoon,'groot persoon')).
ind_rel(isa_wn(persoon,groep)).
ind_rel(isa_wn(persoon,fietser)).
ind_rel(isa_wn(persen,knijpen)).
ind_rel(isa_wn(paneren,omhullen)).
ind_rel(isa_wn(pandabeer,'schattig panda')).
ind_rel(isa_wn(pan,pot)).
ind_rel(isa_wn(pan,koekenpan)).
ind_rel(isa_wn('pakken the@bal',speler)).
ind_rel(isa_wn(paars,kleuren)).
ind_rel(isa_wn(paard,dier)).
ind_rel(isa_wn(over,door)).
ind_rel(isa_wn(over,af)).
ind_rel(isa_wn(opblaasbaar,groen)).
ind_rel(isa_wn(op,van)).
ind_rel(isa_wn(op,naar)).
ind_rel(isa_wn(op,met)).
ind_rel(isa_wn(op,in)).
ind_rel(isa_wn(op,door)).
ind_rel(isa_wn(op,aan)).
ind_rel(isa_wn(ontwaken,'worden wakker')).
ind_rel(isa_wn('onhandig kickboksen',kickbokst)).
ind_rel(isa_wn(onbevreesd,is)).
ind_rel(isa_wn(om,voor)).
ind_rel(isa_wn(olijfolie,bakolie)).
ind_rel(isa_wn(olie,bakolie)).
ind_rel(isa_wn(oever,zand)).
ind_rel(isa_wn(oefenen,sporten)).
ind_rel(isa_wn('naar a@man','nieuwsgierig a@man')).
ind_rel(isa_wn(naar,met)).
ind_rel(isa_wn(muur,'baksteen muur')).
ind_rel(isa_wn(muis,dier)).
ind_rel(isa_wn(motorfiets,politiemotor)).
ind_rel(isa_wn(motor,fiets)).
ind_rel(isa_wn(monument,'roodsten structuur')).
ind_rel(isa_wn(met,tegen)).
ind_rel(isa_wn(met,op)).
ind_rel(isa_wn(met,naar)).
ind_rel(isa_wn(met,in)).
ind_rel(isa_wn(met,af)).
ind_rel(isa_wn(mes,wapen)).
ind_rel(isa_wn(mens,voetballer)).
ind_rel(isa_wn(menigte,mens)).
ind_rel(isa_wn(meisje,'jong dame')).
ind_rel(isa_wn(markt,winkel)).
ind_rel(isa_wn(man,speler)).
ind_rel(isa_wn(man,racer)).
ind_rel(isa_wn(man,muzikant)).
ind_rel(isa_wn(man,'dragen the@strohoed')).
ind_rel(isa_wn(man,'dragen a@helm')).
ind_rel(isa_wn(man,'aannemen a@pose')).
ind_rel(isa_wn(maki,dier)).
ind_rel(isa_wn('maken vast',vastmaken)).
ind_rel(isa_wn('maken vast','brengen aan')).
ind_rel(isa_wn('maken schoon',uitwissen)).
ind_rel(isa_wn('maken schoon',reinigen)).
ind_rel(isa_wn('maken klaar',klaarmaken)).
ind_rel(isa_wn('maken bang','doen schrikken')).
ind_rel(isa_wn(maken,tekenen)).
ind_rel(isa_wn(maken,nemen)).
ind_rel(isa_wn(machine,naaimachine)).
ind_rel(isa_wn(loungen,'loungen binnen')).
ind_rel(isa_wn('lopen rond',lopen)).
ind_rel(isa_wn(lopen,rennen)).
ind_rel(isa_wn(lopen,'lopen buiten')).
ind_rel(isa_wn(lopen,'dragen a@bikini')).
ind_rel(isa_wn(lens,cameralen)).
ind_rel(isa_wn(leggen,strooien)).
ind_rel(isa_wn(langs,over)).
ind_rel(isa_wn(landschap,sneeuwlandschap)).
ind_rel(isa_wn(lamp,lamplicht)).
ind_rel(isa_wn(krijgen,geven)).
ind_rel(isa_wn(kostuum,jurk)).
ind_rel(isa_wn(komen,'komen tevoorschijn')).
ind_rel(isa_wn(koken,roosteren)).
ind_rel(isa_wn(knuffelkonijn,knuffelhaasje)).
ind_rel(isa_wn(knippen,maaien)).
ind_rel(isa_wn(knagen,verslinden)).
ind_rel(isa_wn('klimmen af','beklimmen a@rotswand')).
ind_rel(isa_wn('klein kat',kit)).
ind_rel(isa_wn(klein,jong)).
ind_rel(isa_wn(kit,kat)).
ind_rel(isa_wn(kind,'jong kind')).
ind_rel(isa_wn(kind,'blond jongen')).
ind_rel(isa_wn('kijken@(in@(dezelfde@(binnenin@(a@bamboestructuur)@richting)))@(a@(vol@(met@(a@leerling))@klaslokaal))','aandachtig kijken@(in@(dezelfde@(binnenin@(a@bamboestructuur)@richting)))@(a@(vol@(met@(a@leerling))@klaslokaal))')).
ind_rel(isa_wn('kijken toe',kijken)).
ind_rel(isa_wn(kijken,'staart naar@(a@kalender)')).
ind_rel(isa_wn(kijken,rondkijken)).
ind_rel(isa_wn(kijken,controleren)).
ind_rel(isa_wn(kijken,bestuderen)).
ind_rel(isa_wn(kickboksgevecht,kickbokswedstrijd)).
ind_rel(isa_wn(kano,boot)).
ind_rel(isa_wn(kangoeroe,babykangoeroe)).
ind_rel(isa_wn(kangoeroe,'baby kangoeroe')).
ind_rel(isa_wn(kamer,'slecht verlichten')).
ind_rel(isa_wn(jongen,zwemmer)).
ind_rel(isa_wn(jongen,jongeman)).
ind_rel(isa_wn(jeep,voertuig)).
ind_rel(isa_wn(jagen,vangen)).
ind_rel(isa_wn(inpakken,stoppen)).
ind_rel(isa_wn('in@(a@schijf) snijden',tofu)).
ind_rel(isa_wn(in,rond)).
ind_rel(isa_wn(in,op)).
ind_rel(isa_wn(in,met)).
ind_rel(isa_wn(in,door)).
ind_rel(isa_wn(in,aan)).
ind_rel(isa_wn(huis,'stenen huis')).
ind_rel(isa_wn('houden vast',vasthouden)).
ind_rel(isa_wn('houden omhoog','houden vast')).
ind_rel(isa_wn(honkloper,speler)).
ind_rel(isa_wn(hond,'in@(the@gras) hond')).
ind_rel(isa_wn(hond,bulldog)).
ind_rel(isa_wn(hoed,cowboyhoed)).
ind_rel(isa_wn(heuvel,sneeuw)).
ind_rel(isa_wn(helling,schans)).
ind_rel(isa_wn('haveloos volleybal','breken volleybal')).
ind_rel(isa_wn('hangen rond',lopen)).
ind_rel(isa_wn(halter,gewicht)).
ind_rel(isa_wn('halen uit',springen)).
ind_rel(isa_wn(groot,fors)).
ind_rel(isa_wn(groot,enorm)).
ind_rel(isa_wn(groep,roedel)).
ind_rel(isa_wn(groep,menigte)).
ind_rel(isa_wn(groep,mengpaneel)).
ind_rel(isa_wn(groen,'groen kleuren')).
ind_rel(isa_wn(grijs,'grijs verven')).
ind_rel(isa_wn(grazen,voeden)).
ind_rel(isa_wn(gras,voetbal)).
ind_rel(isa_wn(gras,gazon)).
ind_rel(isa_wn(goochelaar,man)).
ind_rel(isa_wn(glijden,kruipen)).
ind_rel(isa_wn(gerelateerde,verwanen)).
ind_rel(isa_wn(genezen,'doen herleven')).
ind_rel(isa_wn(gebied,'besneeuwd gebied')).
ind_rel(isa_wn(gazon,gras)).
ind_rel(isa_wn(frisdrank,'hebben@(tussen@in@hen) ze')).
ind_rel(isa_wn(fret,'verschillend fret')).
ind_rel(isa_wn(fontein,grondfontein)).
ind_rel(isa_wn(fles,bierfles)).
ind_rel(isa_wn(eten,bijten)).
ind_rel(isa_wn(entiteit,vrouw)).
ind_rel(isa_wn('enkel rots','a rots')).
ind_rel(isa_wn('enkel boter@stuk','a boter@stuk')).
ind_rel(isa_wn('enkel boom','a boom')).
ind_rel(isa_wn('duiken af',duiken)).
ind_rel(isa_wn(drumstel,trommel)).
ind_rel(isa_wn(drie,enkel)).
ind_rel(isa_wn(draven,rijden)).
ind_rel(isa_wn(draaien,lopen)).
ind_rel(isa_wn(door,op)).
ind_rel(isa_wn(door,om)).
ind_rel(isa_wn(door,in)).
ind_rel(isa_wn('doen buiten',doen)).
ind_rel(isa_wn(doen,'voeren uit')).
ind_rel(isa_wn(doen,stoppen)).
ind_rel(isa_wn(doen,springen)).
ind_rel(isa_wn(dienblad,schaal)).
ind_rel(isa_wn(dichtbij,dichtbijgelegen)).
ind_rel(isa_wn(crossmotorrace,crossmotorwedstrijd)).
ind_rel(isa_wn(crosser,fietser)).
ind_rel(isa_wn('cornflakes komen',ontbijtgraan)).
ind_rel(isa_wn(cornflakes,ontbijtgraan)).
ind_rel(isa_wn(container,'plastic container')).
ind_rel(isa_wn(chef,'chef-kok')).
ind_rel(isa_wn(champignon,paddenstoel)).
ind_rel(isa_wn(camera,foto)).
ind_rel(isa_wn(buiten,rond)).
ind_rel(isa_wn(bruingeel,bruin)).
ind_rel(isa_wn(bruin,'bruin kleuren')).
ind_rel(isa_wn('brengen aan',opdoen)).
ind_rel(isa_wn(bouw,werk)).
ind_rel(isa_wn(bos,'bosrijk omgeving')).
ind_rel(isa_wn(boren,maken)).
ind_rel(isa_wn(boomtak,boomstam)).
ind_rel(isa_wn(boom,'bladloos boom')).
ind_rel(isa_wn(boa,sjaal)).
ind_rel(isa_wn(blok,schijf)).
ind_rel(isa_wn(blauw,'blauw kleuren')).
ind_rel(isa_wn(blaffen,praten)).
ind_rel(isa_wn('bij drie@(wit@hond)','dicht_bij drie@(wit@hond)')).
ind_rel(isa_wn(bij,in)).
ind_rel(isa_wn(bier,drank)).
ind_rel(isa_wn(bekijken,bijwonen)).
ind_rel(isa_wn(bamboestok,bamboe)).
ind_rel(isa_wn(bamboefluit,fluit)).
ind_rel(isa_wn(bal,'speelgoed stuk')).
ind_rel(isa_wn(badpak,zwemkleding)).
ind_rel(isa_wn(auto,voertuig)).
ind_rel(isa_wn(aubergine,groente)).
ind_rel(isa_wn(af,met)).
ind_rel(isa_wn(acteren,'treden op')).
ind_rel(isa_wn(achterwaarts,achterwaarst)).
ind_rel(isa_wn(accessoirezaak,accessoirewinkel)).
ind_rel(isa_wn(aarde,gat)).
ind_rel(isa_wn(aardappel,voedsel)).
ind_rel(isa_wn(aap,chimpansee)).
ind_rel(isa_wn(aan,van)).
ind_rel(isa_wn(aan,op)).
ind_rel(isa_wn(aan,in)).
ind_rel(isa_wn(aan,achter)).
ind_rel(isa_wn('a vrouw','twee persoon')).
ind_rel(isa_wn('a vlees','a eten')).
ind_rel(isa_wn('a tafeltennis','a pingpongen')).
ind_rel(isa_wn('a piano','a keyboard')).
ind_rel(isa_wn('a komen','a schaal')).
ind_rel(isa_wn('a komen','a kom')).
ind_rel(isa_wn('a kip','the eten')).
ind_rel(isa_wn('a gras','no hooi')).
ind_rel(isa_wn('a fluiten','a fluit')).
ind_rel(isa_wn('a fluiten','a blaasinstrument')).
ind_rel(disj(waden,zitten)).
ind_rel(disj('the park','the woonkamer')).
ind_rel(disj(schuwen,volgen)).
ind_rel(disj(rijden,stappen)).
ind_rel(disj('rennen in@(the@veld)',staan)).
ind_rel(disj(rennen,stoppen)).
ind_rel(disj('op a@stoel','van a@stoel')).
ind_rel(disj('no voedsel','the eten')).
ind_rel(disj('missen in@(the@lucht)',vangen)).
ind_rel(disj(missen,slaan)).
ind_rel(disj(missen,raken)).
ind_rel(disj('met@(a@(in@(the@bek)@tennisbal))',op)).
ind_rel(disj(mens,ver)).
ind_rel(disj('lopen weg',zetten)).
ind_rel(disj('liggen in@(the@gras)',rennen)).
ind_rel(disj(liggen,'lopen rond')).
ind_rel(disj(leeg,vol)).
ind_rel(disj(jong,'met@(a@helm)')).
ind_rel(disj(is,ver)).
ind_rel(disj('in@(the@lucht)',op)).
ind_rel(disj(gieten,halen)).
ind_rel(disj(geven,'wijzen af')).
ind_rel(disj('drinken@(a@sinaasappelsap)',lopen)).
ind_rel(disj(dier,vrouw)).
ind_rel(disj(dicht,'in@(the@gras) lopen')).
ind_rel(disj('de_nacht fietsen@(a@fietser)','overdag fietsen@(a@fietser)')).
ind_rel(disj('by@(a@vrouw)','in@(a@vuilnisbak)')).
ind_rel(disj(boren,sluiten)).
ind_rel(disj('bij a@man','in and@(a@(wit@hemd))@(a@zonnebril)')).
ind_rel(disj(bevuilen,schoonmaken)).
ind_rel(disj(bespelen,stoppen)).
ind_rel(disj(bespelen,opbergen)).
ind_rel(disj('aan a@entiteit','bij a@automaat')).
ind_rel(disj(aan,uit)).
ind_rel(disj('a tennisbal','a voetbal')).
ind_rel(disj('a tafeltennis','a tafelvoetbal')).
ind_rel(disj('a mens','no mens')).
ind_rel(disj('a fles','the kraan')).
ind_rel(disj('a badpak','no pakken')).
ind_rel(ant_wn(paars,verven)).
| 37.625316 | 273 | 0.753802 |
ed200a7c225bbafc40a0c328ed7653e0a29781df | 398,632 | pl | Perl | latex/latexmk.pl | jecb96/docker-public | 55fe00e766e403da3f376a0861062ea459e21625 | [
"MIT"
]
| null | null | null | latex/latexmk.pl | jecb96/docker-public | 55fe00e766e403da3f376a0861062ea459e21625 | [
"MIT"
]
| null | null | null | latex/latexmk.pl | jecb96/docker-public | 55fe00e766e403da3f376a0861062ea459e21625 | [
"MIT"
]
| null | null | null | #!/usr/bin/env perl
#!!!!!!!!!!!!!!!!!!!????????? CLEAN UP INITIALIZATION
#!!! See all FIX items.
# Perhaps add subroutine rdb_change_active( (rules to deactivate), (rules to activate))
# ?? Still need to fix bcf error issue.
# Don't keep looping after error
# pvc: Only re-run on USER FILE CHANGE.
# See # ??????? BCF
#!!!!!!!!??? Check @pwd_log
# !!!!!!!!!! Don't forget to document $silence_logfile_warnings.!!!
# N.B. !!!!!!!!!!! See 17 July 2012 comments !!!!!!!!!!!!!!!!!!
# On a UNIX-like system, the above enables latexmk to run independently
# of the location of the perl executable. This line relies on the
# existence of the program /usr/bin/env
# If there is a problem for any reason, you can replace the first line of
# this file by:
#!/usr/bin/perl -w
# with the path of the perl executable adjusted for your system.
use warnings;
# Delete #??!! when working
# See ?? <===============================
## ?? Issues with clean-up
## List of aux files deleted is those read, not those generated.
## Other files are generated by (pdf)latex; should they be deleted?
## (I have hooks for this).
#=======================================
#?? Force mode doesn't appear to do force (if error in latex file)
#??? Get banner back in.
#?? CORRECT DIAGNOSTICS ON CHANGED FILES IF THEY DIDN'T EXIST BEFORE
#?? Further corrections to deal with disappeared source files for custom dependencies.
# Message repeatedly appears about remake when source file of cusdep doesn't exist.
#?? logfile w/o fdb file: don't set changed file, perhaps for generated exts.
# Reconsider
#?? Do proper run-stuff for bibtex, makeindex, cus-deps. OK I think
# Parse and correctly find ist files
# ATTEMPT TO ALLOW FILENAMES WITH SPACES:
# (as of 1 Apr 2006, and then 14 Sep. 2007)
# Problems:
# A. Quoting filenames will not always work.
# a. Under UNIX, quotes are legal in filenames, so when PERL
# directly runs a binary, a quoted filename will be treated as
# as a filename containing a quote character. But when it calls
# a shell, the quotes are handled by the shell as quotes.
# b. Under MSWin32, quotes are illegal filename characters, and tend
# to be handled correctly.
# c. But under cygwin, results are not so clear (there are many
# combinations: native v. cygwin perl, native v cygwin programs
# NT v. unix scripts, which shell is called.
# B. TeX doesn't always handle filenames with spaces gracefully.
# a. UNIX/LINUX: The version on gluon2 Mar 31, 2006 to Sep. 2007)
# doesn't handle them at all. (TeX treats space as separator.)
# b. At least some later versions actually do (Brad Miller e-mail,
# Sep. 2007).
# c. fptex [[e-TeXk, Version 3.141592-2.1 (Web2c 7.5.2)] does, on
# my MSWin at home. In \input the filename must be in quotes.
# d. Bibtex [BibTeX (Web2c 7.5.2) 0.99c on my MSWin system at home,
# Sep. 2007] does not allow names of bibfiles to have spaces.
# C. =====> Using the shell for command lines is not safe, since special
# characters can cause lots of mayhem.
# It will therefore be a good idea to sanitize filenames.
#
# I've sanitized all calls out:
# a. system and exec use a single argument, which forces
# use of shell, under all circumstances
# Thus I can safely use quotes on filenames: They will be handled by
# the shell under UNIX, and simply passed on to the program under MSWin32.
# b. I reorganized Run, Run_Detached to use single command line
# c. All calls to Run and Run_Detached have quoted filenames.
# d. So if a space-free filename with wildcards is given on latexmk's
# command line, and it globs to space-containing filename(s), that
# works (fptex on home computer, native NT tex)
# e. ====> But globbing fails: the glob function takes space as filename
# separator. ====================
#================= TO DO ================
#
# 1. See ?? ESPECIALLY $MSWin_fudge_break
# 2. Check fudged conditions in looping and make_files
# 3. Should not completely abort after a run that ends in failure from latex
# Missing input files (including via custom dependency) should be checked for
# a change in status
# If sources for missing files from custom dependency
# are available, then do a rerun
# If sources of any kind become available rerun (esp. for pvc)
# rerun
# Must parse log_file after unsuccessful run of latex: it may give
# information about missing files.
# 4. Check file of bug reports and requests
# 5. Rationalize bibtex warnings and errors. Two almost identical routines.
# Should 1. Use single routine
# 2. Convert errors to failure only in calling routine
# 3. Save first warning/error.
# ?? Use of generated_exts arrays and hashes needs rationalization
# To do:
# Rationalize again handling of include files.
# Now I use kpsewhich to do searches, if file not found
# (How do I avoid getting slowed down too much?)
# Document the assumptions at each stage of processing algorithm.
# Option to restart previewer automatically, if it dies under -pvc
# Test for already running previewer gets wrong answer if another
# process has the viewed file in its command line
## Copyright John Collins 1998-2018
## (username jcc8 at node psu.edu)
## (and thanks to David Coppit (username david at node coppit.org)
## for suggestions)
## Copyright Evan McLean
## (modifications up to version 2)
## Copyright 1992 by David J. Musliner and The University of Michigan.
## (original version)
##
## This program is free software; you can redistribute it and/or modify
## it under the terms of the GNU General Public License as published by
## the Free Software Foundation; either version 2 of the License, or
## (at your option) any later version.
##
## This program is distributed in the hope that it will be useful,
## but WITHOUT ANY WARRANTY; without even the implied warranty of
## MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
## GNU General Public License for more details.
##
## You should have received a copy of the GNU General Public License
## along with this program; if not, write to the Free Software
## Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307
##
##
##
## NEW FEATURES, since v. 2.0:
## 1. Correct algorithm for deciding how many times to run latex:
## based on whether source file(s) change between runs
## 2. Continuous preview works, and can be of ps file or dvi file
## 3. pdf creation by pdflatex possible
## 4. Defaults for commands are OS dependent.
## 5. Parsing of log file instead of source file is used to
## obtain dependencies, by default.
##
## Modification log from 9 Dec 2011 onwards in detail
##
## 12 Jan 2012 STILL NEED TO DOCUMENT some items below
##
## 17 Mar 2019 John Collins Further test for problems when linking rules
## 17 Mar 2019 John Collins V. 4.63b.
## 17 Mar 2019 John Collins Fix problem revealed by bibtopic package
## 15 Mar 2019 John Collins Corrections
## 14 Mar 2019 John Collins Version to 4.63a
## 12-14 Mar 2019 John Collins Jobname has placeholder
## 8-11 Mar 2019 John Collins Correct aux-dir bugs
## 8 Mar 2019 John Collins Version to 4.63
## 1 Jan 2019 John Collins Correct bug in output switching code
## 31 Dec 2018 John Collins Correct bug that with $cleanup_includes_generated
## -c mode deletes final output files (e.g., .dvi, .pdf).
## 13 Dec 2018 John Collins Fixes, cleanup
## 12 Dec 2018 John Collins Fix rdb_read
## 11 Dec 2018 John Collins For output-switch: Reorganize initialization
## Remove possibility of more than one primary.
## 1 Dec 2018 John Collins Clean up some code.
## 30 Nov 2018 John Collins Allow any characters in directory part of tex
## filename when cd mode on. (Still standard
## set of disallowed characters applies basename.)
## 21 Nov 2018 John Collins Infrastructure finished, I think, for active flag
## Start on output switch
## 16 Nov 2018 John Collins Remove in non-diagnostics mode a warning about
## rule not in use in this session that is given
## when reading an fdb_latexmk file.
## 2 Nov 2018 John Collins Start implementing active flag for rules.
## 1 Nov 2018 John Collins Fix finding of missing files that are relative to aux_dir
## 29-31 Oct 2018 John Collins Some cleanup.
## 27,28 Oct 2018 John Collins Fix bug that in -pvc mode, after an error in
## certain rules, new rounds of compilation
## are triggered because of changes in generated
## files, instead of only by later user-generated
## changes.
## Improve linking of rules.
## 25 Oct 2018 John Collins V. 4.62
## Clean up can remove (empty) directories
## 25 Oct 2018 John Collins Fix definition of clean up substitution for %R
## so that something with intermediate %R works,
## as in 'pythontex-files-%R/*'.
##
## 1998-2018, John Collins. Many improvements and fixes.
## See CHANGE-log.txt for full list, and CHANGES for summary
##
## Modified by Evan McLean (no longer available for support)
## Original script (RCS version 2.3) called "go" written by David J. Musliner
##
##-----------------------------------------------------------------------
## Explicit exit codes:
## 10 = bad command line arguments
## 11 = file specified on command line not found
## or other file not found
## 12 = failure in some part of making files
## 13 = error in initialization file
## 20 = probable bug
## or retcode from called program.
$my_name = 'latexmk';
$My_name = 'Latexmk';
$version_num = '4.63b';
$version_details = "$My_name, John Collins, 17 March 2019";
use Config;
use File::Basename;
use File::Copy;
use File::Spec;
# If possible, use better glob, which does not use space as item separator.
# It's either File::Glob::bsd_glob or File::Glob::glob
# The first does not exist in old versions of Perl, while the second
# is deprecated in more recent versions and will be removed
$have_bsd_glob = 0;
sub my_glob {
if ($have_bsd_glob) { return bsd_glob( $_[0] ); }
else { return glob( $_[0] ); }
}
use File::Glob;
if ( eval{ File::Glob->import('bsd_glob'); 1; } ) {
# Success in importing bsd_glob
$have_bsd_glob = 1;
}
elsif ( eval{ File::Glob->import('glob'); 1; } ) {
warn "$My_name: I could not import File::Glob:bsd_glob, probably because your\n",
" Perl is too old. I have arranged to use the deprecated File::Glob:glob\n",
" instead.\n",
" WARNING: It may malfunction on clean up operation on filenames containing\n",
" spaces.\n";
$have_bsd_glob = 0;
}
else {
die "Could not import 'File::Glob:bsd_glob' or 'File::Glob:glob'\n";
}
use File::Path 2.08 qw( make_path );
use FileHandle;
use File::Find;
use List::Util qw( max );
use Cwd; # To be able to change cwd
use Cwd "chdir"; # Ensure $ENV{PWD} tracks cwd
use Digest::MD5;
#use strict;
# The following variables are assigned once and then used in symbolic
# references, so we need to avoid warnings 'name used only once':
use vars qw( $dvi_update_command $ps_update_command $pdf_update_command );
# Translation of signal names to numbers and vv:
%signo = ();
@signame = ();
if ( defined $Config{sig_name} ) {
$i = 0;
foreach $name (split('\s+', $Config{sig_name})) {
$signo{$name} = $i;
$signame[$i] = $name;
$i++;
}
}
else {
warn "Something wrong with the perl configuration: No signals?\n";
}
# Line length in log file that indicates wrapping.
# This number EXCLUDES line-end characters, and is one-based.
# It is the parameter max_print_line in the TeX program. (tex.web)
$log_wrap = 79;
#########################################################################
## Default parsing and file-handling settings
## Array of reg-exps for patterns in log-file for file-not-found
## Each item is the string in a regexp, without the enclosing slashes.
## First parenthesized part is the filename.
## Note the need to quote slashes and single right quotes to make them
## appear in the regexp.
## Add items by push, e.g.,
## push @file_not_found, '^No data file found `([^\\\']*)\\\'';
## will give match to line starting "No data file found `filename'"
@file_not_found = (
'^No file\\s*(.*)\\.$',
'^\\! LaTeX Error: File `([^\\\']*)\\\' not found\\.',
'.*?:\\d*: LaTeX Error: File `([^\\\']*)\\\' not found\\.',
'^LaTeX Warning: File `([^\\\']*)\\\' not found',
'^Package .* [fF]ile `([^\\\']*)\\\' not found',
'^Package .* No file `([^\\\']*)\\\'',
'Error: pdflatex \(file ([^\)]*)\): cannot find image file',
': File (.*) not found:\s*$',
'! Unable to load picture or PDF file \\\'([^\\\']+)\\\'.',
);
# Characters that we won't allow in the name of a TeX file.
# Notes: Some are disallowed by TeX itself.
# '\' results in TeX macro expansion
# '$' results in possible variable substitution by kpsewhich called from tex.
# '"' gets special treatment.
# See subroutine test_fix_texnames and its call for their use.
$illegal_in_texname = "\x00\t\f\n\r\$%\\~\x7F";
## Hash mapping file extension (w/o period, e.g., 'eps') to a single regexp,
# whose matching by a line in a file with that extension indicates that the
# line is to be ignored in the calculation of the hash number (md5 checksum)
# for the file. Typically used for ignoring datestamps in testing whether
# a file has changed.
# Add items e.g., by
# $hash_calc_ignore_pattern{'eps'} = '^%%CreationDate: ';
# This makes the hash calculation for an eps file ignore lines starting with
# '%%CreationDate: '
# ?? Note that a file will be considered changed if
# (a) its size changes
# or (b) its hash changes
# So it is useful to ignore lines in the hash calculation only if they
# are of a fixed size (as with a date/time stamp).
%hash_calc_ignore_pattern =();
# Specification of templates for extra rules.
# See subroutine rdb_initialize_rules for examples of rule templates, and
# how they get used to construct rules.
# (Documentation obviously needs to be improved!)
%extra_rule_spec = ();
# Hooks for customized extra processing on aux files. The following
# variable is an array of references to function. Each function is
# invoked in turn when a line of an aux file is processed (if none
# of the built-in actions have been done). On entry to the function,
# the following variables are set:
# $_ = current line of aux file
# $rule = name of rule during the invocation of which, the aux file
# was supposed to have been generated.
@aux_hooks = ();
#########################################################################
## Default document processing programs, and related settings,
## These are mostly the same on all systems.
## Most of these variables represents the external command needed to
## perform a certain action. Some represent switches.
## Which TeX distribution is being used
## E.g., "MiKTeX 2.9", "TeX Live 2018"
## "" means not determined. Obtain from first line of .log file.
$tex_distribution = '';
&std_tex_cmds;
# Possible code to execute by *latex before inputting source file.
# Not used by default.
$pre_tex_code = '';
## Default switches:
$latex_default_switches = '';
$pdflatex_default_switches = '';
$lualatex_default_switches = '';
# Note that xelatex is used to give xdv file, not pdf file, hence
# we need the -no-pdf option.
$xelatex_default_switches = '-no-pdf';
## Switch(es) to make them silent:
$latex_silent_switch = '-interaction=batchmode';
$pdflatex_silent_switch = '-interaction=batchmode';
$lualatex_silent_switch = '-interaction=batchmode';
$xelatex_silent_switch = '-interaction=batchmode';
%input_extensions = ();
# %input_extensions maps primary_rule_name to pointer to hash of file extensions
# used for extensionless files specified in the source file by constructs
# like \input{file} \includegraphics{file}
set_input_ext( 'latex', 'tex', 'eps' );
set_input_ext( 'pdflatex', 'tex', 'jpg', 'pdf', 'png' );
$input_extensions{lualatex} = $input_extensions{pdflatex};
$input_extensions{xelatex} = $input_extensions{pdflatex};
# Save these values as standards to be used when switching output,
# i.e., when actual primary rule differs from standard.
%standard_input_extensions = %input_extensions;
%allowed_output_ext = ( ".dvi" => 1, ".xdv" => 1, ".pdf" => 1 );
# Extensions of files preserved when clean up is by -c rather than -C:
%small_cleanup_preserved_exts = ();
foreach ( 'dvi', 'dviF', 'ps', 'psF', 'pdf', 'synctex.gz', 'xdv' ) {
$small_cleanup_preserved_exts{$_} = 1;
}
# Information about options to latex and pdflatex that latexmk will simply
# pass through to (pdf)latex
# Option without arg. maps to itself.
# Option with arg. maps the option part to the full specification
# e.g., -kpathsea-debug => -kpathsea-debug=NUMBER
%allowed_latex_options = ();
%allowed_latex_options_with_arg = ();
foreach (
#####
# TeXLive options
"-draftmode switch on draft mode (generates no output PDF)",
"-enc enable encTeX extensions such as \\mubyte",
"-etex enable e-TeX extensions",
"-file-line-error enable file:line:error style messages",
"-no-file-line-error disable file:line:error style messages",
"-fmt=FMTNAME use FMTNAME instead of program name or a %& line",
"-halt-on-error stop processing at the first error",
"-interaction=STRING set interaction mode (STRING=batchmode/nonstopmode/\n".
" scrollmode/errorstopmode)",
"-ipc send DVI output to a socket as well as the usual\n".
" output file",
"-ipc-start as -ipc, and also start the server at the other end",
"-kpathsea-debug=NUMBER set path searching debugging flags according to\n".
" the bits of NUMBER",
"-mktex=FMT enable mktexFMT generation (FMT=tex/tfm/pk)",
"-no-mktex=FMT disable mktexFMT generation (FMT=tex/tfm/pk)",
"-mltex enable MLTeX extensions such as \charsubdef",
"-output-comment=STRING use STRING for DVI file comment instead of date\n".
" (no effect for PDF)",
"-output-format=FORMAT use FORMAT for job output; FORMAT is `dvi\" or `pdf\"",
"-parse-first-line enable parsing of first line of input file",
"-no-parse-first-line disable parsing of first line of input file",
"-progname=STRING set program (and fmt) name to STRING",
"-shell-escape enable \\write18{SHELL COMMAND}",
"-no-shell-escape disable \\write18{SHELL COMMAND}",
"-shell-restricted enable restricted \\write18",
"-src-specials insert source specials into the DVI file",
"-src-specials=WHERE insert source specials in certain places of\n".
" the DVI file. WHERE is a comma-separated value\n".
" list: cr display hbox math par parend vbox",
"-synctex=NUMBER generate SyncTeX data for previewers if nonzero",
"-translate-file=TCXNAME use the TCX file TCXNAME",
"-8bit make all characters printable by default",
#####
# MikTeX options not in TeXLive
"-alias=app pretend to be app",
"-buf-size=n maximum number of characters simultaneously present\n".
" in current lines",
"-c-style-errors C-style error messages",
"-disable-installer disable automatic installation of missing packages",
"-disable-pipes disable input (output) from (to) child processes",
"-disable-write18 disable the \\write18{command} construct",
"-dont-parse-first-line disable checking whether the first line of the main\n".
" input file starts with %&",
"-enable-enctex enable encTeX extensions such as \\mubyte",
"-enable-installer enable automatic installation of missing packages",
"-enable-mltex enable MLTeX extensions such as \charsubdef",
"-enable-pipes enable input (output) from (to) child processes",
"-enable-write18 fully enable the \\write18{command} construct",
"-error-line=n set the width of context lines on terminal error\n".
" messages",
"-extra-mem-bot=n set the extra size (in memory words) for large data\n".
" structures",
"-extra-mem-top=n set the extra size (in memory words) for chars,\n".
" tokens, et al",
"-font-max=n set the maximum internal font number",
"-font-mem-size=n set the size, in TeX memory words, of the font memory",
"-half-error-line=n set the width of first lines of contexts in terminal\n".
" error messages",
"-hash-extra=n set the extra space for the hash table of control\n".
" sequences",
"-job-time=file set the time-stamp of all output files equal to\n".
" file's time-stamp",
"-main-memory=n change the total size (in memory words) of the main\n".
" memory array",
"-max-in-open=n set the maximum number of input files and error\n".
" insertions that can be going on simultaneously",
"-max-print-line=n set the width of longest text lines output",
"-max-strings=n set the maximum number of strings",
"-nest-size=n set the maximum number of semantic levels\n".
" simultaneously active",
"-no-c-style-errors standard error messages",
"-param-size=n set the the maximum number of simultaneous macro\n".
" parameters",
"-pool-size=n set the maximum number of characters in strings",
"-record-package-usages=file record all package usages and write them into\n".
" file",
"-restrict-write18 partially enable the \\write18{command} construct",
"-save-size=n set the the amount of space for saving values\n".
" outside of current group",
"-stack-size=n set the maximum number of simultaneous input sources",
"-string-vacancies=n set the minimum number of characters that should be\n".
" available for the user's control sequences and font\n".
" names",
"-tcx=name process the TCX table name",
"-time-statistics show processing time statistics",
"-trace enable trace messages",
"-trace=tracestreams enable trace messages. The tracestreams argument is\n".
" a comma-separated list of trace stream names",
"-trie-size=n set the amount of space for hyphenation patterns",
"-undump=name use name as the name of the format to be used,\n".
" instead of the name by which the program was\n".
" called or a %& line.",
#####
# Options passed to (pdf)latex that have special processing by latexmk,
# so they are commented out here.
#-jobname=STRING set the job name to STRING
#-aux-directory=dir Set the directory dir to which auxiliary files are written
#-output-directory=DIR use existing DIR as the directory to write files in
#-quiet
#-recorder enable filename recorder
#
# Options with different processing by latexmk than (pdf)latex
#-help
#-version
#
# Options NOT used by latexmk
#-includedirectory=dir prefix dir to the search path
#-initialize become the INI variant of the compiler
#-ini be pdfinitex, for dumping formats; this is implicitly
# true if the program name is `pdfinitex'
) {
if ( /^([^\s=]+)=/ ) {
$allowed_latex_options_with_arg{$1} = $_;
}
elsif ( /^([^\s=]+)\s/ ) {
$allowed_latex_options{$1} = $_;
}
else {
$allowed_latex_options{$_} = $_;
}
}
# Arrays of options that will be added to latex and pdflatex.
# These need to be stored until after the command line parsing is finished,
# in case the values of $latex and/or $pdflatex change after an option
# is added.
@extra_latex_options = ();
@extra_pdflatex_options = ();
@extra_lualatex_options = ();
@extra_xelatex_options = ();
## Command to invoke biber & bibtex
$biber = 'biber %O %B';
$bibtex = 'bibtex %O %B';
# Switch(es) to make biber & bibtex silent:
$bibtex_fudge = 1; # Use hack to get bibtex working in old versions that
# don't handle output-directory.
$biber_silent_switch = '--onlylog';
$bibtex_silent_switch = '-terse';
$bibtex_use = 1; # Whether to actually run bibtex to update bbl files.
# This variable is also used in deciding whether to
# delete bbl files in clean up operations.
# 0: Never run bibtex.
# Do NOT delete bbl files on clean up.
# 1: Run bibtex only if the bibfiles exists
# according to kpsewhich, and the bbl files
# appear to be out-of-date.
# Do NOT delete bbl files on clean up.
# 1.5: Run bibtex only if the bibfiles exists
# according to kpsewhich, and the bbl files
# appear to be out-of-date.
# Only delete bbl files on clean up if bibfiles exist.
# 2: Run bibtex when the bbl files are out-of-date
# Delete bbl files on clean up.
#
# In any event bibtex is only run if the log file
# indicates that the document uses bbl files.
## Command to invoke makeindex
$makeindex = 'makeindex %O -o %D %S';
# Switch(es) to make makeinex silent:
$makeindex_silent_switch = '-q';
## Command to convert dvi file to pdf file directly:
$dvipdf = 'dvipdf %O %S %D';
# N.B. Standard dvipdf runs dvips and gs with their silent switch, so for
# standard dvipdf $dvipdf_silent_switch is unneeded, but innocuous.
# But dvipdfmx can be used instead, and it has a silent switch (-q).
# So implementing $dvipdf_silent_switch is useful.
$dvipdf_silent_switch = '-q';
## Command to convert dvi file to ps file:
$dvips = 'dvips %O -o %D %S';
## Command to convert dvi file to ps file in landscape format:
$dvips_landscape = 'dvips -tlandscape %O -o %D %S';
# Switch(es) to get dvips to make ps file suitable for conversion to good pdf:
# (If this is not used, ps file and hence pdf file contains bitmap fonts
# (type 3), which look horrible under acroread. An appropriate switch
# ensures type 1 fonts are generated. You can put this switch in the
# dvips command if you prefer.)
$dvips_pdf_switch = '-P pdf';
# Switch(es) to make dvips silent:
$dvips_silent_switch = '-q';
## Command to convert ps file to pdf file:
$ps2pdf = 'ps2pdf %O %S %D';
## Command to convert xdv file to pdf file
$xdvipdfmx = 'xdvipdfmx -o %D %O %S';
$xdvipdfmx_silent_switch = '-q';
## Command to search for tex-related files
$kpsewhich = 'kpsewhich %S';
## Command to run make:
$make = 'make';
##Printing:
$print_type = 'auto'; # When printing, print the postscript file.
# Possible values: 'dvi', 'ps', 'pdf', 'auto', 'none'
# 'auto' ==> set print type according to the printable
# file(s) being made: priority 'ps', 'pdf', 'dvi'
## Which treatment of default extensions and filenames with
## multiple extensions is used, for given filename on
## tex/latex's command line? See sub find_basename for the
## possibilities.
## Current tex's treat extensions like UNIX teTeX:
$extension_treatment = 'unix';
# Viewers. These are system dependent, so default to none:
$pdf_previewer = $ps_previewer = $ps_previewer_landscape = $dvi_previewer = $dvi_previewer_landscape = "NONE";
$dvi_update_signal = undef;
$ps_update_signal = undef;
$pdf_update_signal = undef;
$dvi_update_command = undef;
$ps_update_command = undef;
$pdf_update_command = undef;
$allow_subdir_creation = 1;
$new_viewer_always = 0; # If 1, always open a new viewer in pvc mode.
# If 0, only open a new viewer if no previous
# viewer for the same file is detected.
# Commands for use in pvc mode for compiling, success, warnings, and failure;
# they default to empty, i.e., not to use:
$compiling_cmd = $success_cmd = $warning_cmd = $failure_cmd = "";
# Commands for printing are highly system dependent, so default to NONE:
$lpr = 'NONE $lpr variable is not configured to allow printing of ps files';
$lpr_dvi = 'NONE $lpr_dvi variable is not configured to allow printing of dvi files';
$lpr_pdf = 'NONE $lpr_pdf variable is not configured to allow printing of pdf files';
# The $pscmd below holds a **system-dependent** command to list running
# processes. It is used to find the process ID of the viewer looking at
# the current output file. The output of the command must include the
# process number and the command line of the processes, since the
# relevant process is identified by the name of file to be viewed.
# Its use is not essential.
$pscmd = 'NONE $pscmd variable is not configured to detect running processes';
$pid_position = -1; # offset of PID in output of pscmd.
# Negative means I cannot use ps
$quote_filenames = 1; # Quote filenames in external commands
$del_dir = ''; # Directory into which cleaned up files are to be put.
# If $del_dir is '', just delete the files
@rc_system_files = ();
#########################################################################
################################################################
## Special variables for system-dependent fudges, etc.
$log_file_binary = 0; # Whether to treat log file as binary
# Normally not, since the log file SHOULD be pure text.
# But Miktex 2.7 sometimes puts binary characters
# in it. (Typically in construct \OML ... after
# overfull box with mathmode.)
# Sometimes there is ctrl/Z, which is not only non-text,
# but is end-of-file marker for MS-Win in text mode.
$MSWin_fudge_break = 1; # Give special treatment to ctrl/C and ctrl/break
# in -pvc mode under MSWin
# Under MSWin32 (at least with perl 5.8 and WinXP)
# when latexmk is running another program, and the
# user gives ctrl/C or ctrl/break, to stop the
# daughter program, not only does it reach
# the daughter, but also latexmk/perl, so
# latexmk is stopped also. In -pvc mode,
# this is not normally desired. So when the
# $MSWin_fudge_break variable is set,
# latexmk arranges to ignore ctrl/C and
# ctrl/break during processing of files;
# only the daughter programs receive them.
# This fudge is not applied in other
# situations, since then having latexmk also
# stopping because of the ctrl/C or
# ctrl/break signal is desirable.
# The fudge is not needed under UNIX (at least
# with Perl 5.005 on Solaris 8). Only the
# daughter programs receive the signal. In
# fact the inverse would be useful: In
# normal processing, as opposed to -pvc, if
# force mode (-f) is set, a ctrl/C is
# received by a daughter program does not
# also stop latexmk. Under tcsh, we get
# back to a command prompt, while latexmk
# keeps running in the background!
## Substitute backslashes in file and directory names for
## MSWin command line
$MSWin_back_slash = 1;
## Separator of elements in search_path. Default is unix value
$search_path_separator = ':';
# Directory for temporary files. Default to current directory.
$tmpdir = ".";
# When the aux_dir is on a network share (or the like), its system
# time may differ from the system time on which latexmk is running.
# This complicates the tests of whether particular files have been
# made in a current run of a program or are left over from a previous
# run. One test, which is needed under some situations, is that a
# file was made on a previous run when the files modification time is
# less than the system time when the program is started. (See
# subroutine test_gen_file; this is only needed in a couple of
# situations.) The comparison between file and system times must be
# corrected if there is an offset between system times on the computer
# running latexmk and the computer hosting the file system containing
# aux_dir. The offset is measured in subroutine get_filetime_offset
# by writing a temporary file; the test only needs to be done once.
#
# The following variables are used. Since the system-independent
# values of system and file time are only accurate to a second (or 2
# seconds for FAT file systems), the offset is also accurate only to a
# second or two. So thresholds are needed below which differences
# are insignificant.
#
# Note that the making or not making of a file is controlled by the
# state of the document being compiled and by latexmk's configuration.
# So a file that is left over from a previous run and not overwritten
# on the current run will have a file time at least many seconds less
# than the current time, corresponding to the time scale for a human
# run-edit-run cycle.
#
$filetime_offset_measured = 0; # Measurement not yet done.
$filetime_offset = 0; # Filetime relative to system time.
$filetime_causality_threshold = 5; # Threshold for detection of left-over file.
# Should be non-negative always, and should
# be bigger than 2 secs if a remote
# filesystem or network share is used.
$filetime_offset_report_threshold = 30; # Threshold beyond which filetime offsets
# are reported; large offsets indicate
# incorrect system time on at least one system.
################################################################
# System-dependent overrides:
# Currently, the cases I have tests for are: MSWin32, cygwin, linux and
# darwin, msys, with the main complications being for MSWin32 and cygwin.
# Further special treatment may also be useful for MSYS (for which $^O reports
# "msys"). This is another *nix-emulation/system for MSWindows. At
# present it is treated as unix-like, but the environment variables
# are those of Windows. (The test for USERNAME as well as USER was
# to make latexmk work under MSYS's perl.)
#
if ( $^O eq "MSWin32" ) {
# Pure MSWindows configuration
## Configuration parameters:
## Use first existing case for $tmpdir:
$tmpdir = $ENV{TMPDIR} || $ENV{TEMP} || '.';
$log_file_binary = 1; # Protect against ctrl/Z in log file from
# Miktex 2.7.
## List of possibilities for the system-wide initialization file.
## The first one found (if any) is used.
@rc_system_files = ( "C:/latexmk/LatexMk", "C:/latexmk/latexmkrc" );
$search_path_separator = ';'; # Separator of elements in search_path
# For a pdf-file, "start x.pdf" starts the pdf viewer associated with
# pdf files, so no program name is needed:
$pdf_previewer = 'start %O %S';
$ps_previewer = 'start %O %S';
$ps_previewer_landscape = $ps_previewer;
$dvi_previewer = 'start %O %S';
$dvi_previewer_landscape = "$dvi_previewer";
# Viewer update methods:
# 0 => auto update: viewer watches file (e.g., gv)
# 1 => manual update: user must do something: e.g., click on window.
# (e.g., ghostview, MSWIN previewers, acroread under UNIX)
# 2 => send signal. Number of signal in $dvi_update_signal,
# $ps_update_signal, $pdf_update_signal
# 3 => viewer can't update, because it locks the file and the file
# cannot be updated. (acroread under MSWIN)
# 4 => run a command to force the update. The commands are
# specified by the variables $dvi_update_command,
# $ps_update_command, $pdf_update_command
$dvi_update_method = 1;
$ps_update_method = 1;
$pdf_update_method = 3; # acroread locks the pdf file
}
elsif ( $^O eq "cygwin" ) {
# The problem is a mixed MSWin32 and UNIX environment.
# Perl decides the OS is cygwin in two situations:
# 1. When latexmk is run from a cygwin shell under a cygwin
# environment. Perl behaves in a UNIX way. This is OK, since
# the user is presumably expecting UNIXy behavior.
# 2. When CYGWIN exectuables are in the path, but latexmk is run
# from a native NT shell. Presumably the user is expecting NT
# behavior. But perl behaves more UNIXy. This causes some
# clashes.
# The issues to handle are:
# 1. Perl sees both MSWin32 and cygwin filenames. This is
# normally only an advantage.
# 2. Perl uses a UNIX shell in the system command
# This is a nasty problem: under native NT, there is a
# start command that knows about NT file associations, so that
# we can do, e.g., (under native NT) system("start file.pdf");
# But this won't work when perl has decided the OS is cygwin,
# even if it is invoked from a native NT command line. An
# NT command processor must be used to deal with this.
# 3. External executables can be native NT (which only know
# NT-style file names) or cygwin executables (which normally
# know both cygwin UNIX-style file names and NT file names,
# but not always; some do not know about drive names, for
# example).
# Cygwin executables for tex and latex may only know cygwin
# filenames.
# 4. The BIBINPUTS environment variables may be
# UNIX-style or MSWin-style depending on whether native NT or
# cygwin executables are used. They are therefore parsed
# differently. Here is the clash:
# a. If a user is running under an NT shell, is using a
# native NT installation of tex (e.g., fptex or miktex),
# but has the cygwin executables in the path, then perl
# detects the OS as cygwin, but the user needs NT
# behavior from latexmk.
# b. If a user is running under an UNIX shell in a cygwin
# environment, and is using the cygwin installation of
# tex, then perl detects the OS as cygwin, and the user
# needs UNIX behavior from latexmk.
# Latexmk has no way of detecting the difference. The two
# situations may even arise for the same user on the same
# computer simply by changing the order of directories in the
# path environment variable
## Configuration parameters: We'll assume native NT executables.
## The user should override if they are not.
# This may fail: perl converts MSWin temp directory name to cygwin
# format. Names containing this string cannot be handled by native
# NT executables.
$tmpdir = $ENV{TMPDIR} || $ENV{TEMP} || '.';
## List of possibilities for the system-wide initialization file.
## The first one found (if any) is used.
## We could stay with MSWin files here, since cygwin perl understands them
## @rc_system_files = ( 'C:/latexmk/LatexMk', 'C:/latexmk/latexmkrc' );
## But they are deprecated in v. 1.7. So use the UNIX version, prefixed
## with a cygwin equivalent of the MSWin location
## In addition, we need to add the same set of possible locations as with
## unix, so that the user use a unix-style setup.
@rc_system_files = ();
foreach ( 'LatexMk', 'latexmkrc' ) {
push @rc_system_files,
( "/cygdrive/c/latexmk/$_",
"/opt/local/share/latexmk/$_",
"/usr/local/share/latexmk/$_",
"/usr/local/lib/latexmk/$_" );
}
$search_path_separator = ';'; # Separator of elements in search_path
# This is tricky. The search_path_separator depends on the kind
# of executable: native NT v. cygwin.
# So the user will have to override this.
# We will assume that files can be viewed by native NT programs.
# Then we must fix the start command/directive, so that the
# NT-native start command of a cmd.exe is used.
# For a pdf-file, "start x.pdf" starts the pdf viewer associated with
# pdf files, so no program name is needed:
$start_NT = "cmd /c start \"\"";
$pdf_previewer = "$start_NT %O %S";
$ps_previewer = "$start_NT %O %S";
$ps_previewer_landscape = $ps_previewer;
$dvi_previewer = "$start_NT %O %S";
$dvi_previewer_landscape = $dvi_previewer;
# Viewer update methods:
# 0 => auto update: viewer watches file (e.g., gv)
# 1 => manual update: user must do something: e.g., click on window.
# (e.g., ghostview, MSWIN previewers, acroread under UNIX)
# 2 => send signal. Number of signal in $dvi_update_signal,
# $ps_update_signal, $pdf_update_signal
# 3 => viewer can't update, because it locks the file and the file
# cannot be updated. (acroread under MSWIN)
$dvi_update_method = 1;
$ps_update_method = 1;
$pdf_update_method = 3; # acroread locks the pdf file
}
elsif ( $^O eq "msys" ) {
$search_path_separator = ';'; # Separator of elements in search_path
# I think MS-Win value is OK, since
# msys is running under MS-Win
$pdf_previewer = q[sh -c 'start %S'];
$ps_previewer = q[sh -c 'start %S'];
$dvi_previewer = q[sh -c 'start %S'];
$ps_previewer_landscape = $ps_previewer;
$dvi_previewer_landscape = "$dvi_previewer";
}
else {
# Assume anything else is UNIX or clone
# Do special cases (e.g., linux, darwin (i.e., OS-X)) inside this block.
## Use first existing case for $tmpdir:
$tmpdir = $ENV{TMPDIR} || '/tmp';
## List of possibilities for the system-wide initialization file.
## The first one found (if any) is used.
## Normally on a UNIX it will be in a subdirectory of /opt/local/share or
## /usr/local/share, depending on the local conventions.
## But /usr/local/lib/latexmk is put in the list for
## compatibility with older versions of latexmk.
@rc_system_files = ();
foreach ( 'LatexMk', 'latexmkrc' ) {
push @rc_system_files,
( "/opt/local/share/latexmk/$_",
"/usr/local/share/latexmk/$_",
"/usr/local/lib/latexmk/$_" );
}
$search_path_separator = ':'; # Separator of elements in search_path
$dvi_update_signal = $signo{USR1}
if ( defined $signo{USR1} ); # Suitable for xdvi
$ps_update_signal = $signo{HUP}
if ( defined $signo{HUP} ); # Suitable for gv
$pdf_update_signal = $signo{HUP}
if ( defined $signo{HUP} ); # Suitable for gv
## default document processing programs.
# Viewer update methods:
# 0 => auto update: viewer watches file (e.g., gv)
# 1 => manual update: user must do something: e.g., click on window.
# (e.g., ghostview, MSWIN previewers, acroread under UNIX)
# 2 => send signal. Number of signal in $dvi_update_signal,
# $ps_update_signal, $pdf_update_signal
# 3 => viewer can't update, because it locks the file and the file
# cannot be updated. (acroread under MSWIN)
# 4 => Run command to update. Command in $dvi_update_command,
# $ps_update_command, $pdf_update_command.
$dvi_previewer = 'start xdvi %O %S';
$dvi_previewer_landscape = 'start xdvi -paper usr %O %S';
if ( defined $dvi_update_signal ) {
$dvi_update_method = 2; # xdvi responds to signal to update
} else {
$dvi_update_method = 1;
}
# if ( defined $ps_update_signal ) {
# $ps_update_method = 2; # gv responds to signal to update
# $ps_previewer = 'start gv -nowatch';
# $ps_previewer_landscape = 'start gv -swap -nowatch';
# } else {
# $ps_update_method = 0; # gv -watch watches the ps file
# $ps_previewer = 'start gv -watch';
# $ps_previewer_landscape = 'start gv -swap -watch';
# }
# Turn off the fancy options for gv. Regular gv likes -watch etc
# GNU gv likes --watch etc. User must configure
$ps_update_method = 0; # gv -watch watches the ps file
$ps_previewer = 'start gv %O %S';
$ps_previewer_landscape = 'start gv -swap %O %S';
$pdf_previewer = 'start acroread %O %S';
$pdf_update_method = 1; # acroread under unix needs manual update
$lpr = 'lpr %O %S'; # Assume lpr command prints postscript files correctly
$lpr_dvi =
'NONE $lpr_dvi variable is not configured to allow printing of dvi files';
$lpr_pdf =
'NONE $lpr_pdf variable is not configured to allow printing of pdf files';
# The $pscmd below holds a command to list running processes. It
# is used to find the process ID of the viewer looking at the
# current output file. The output of the command must include the
# process number and the command line of the processes, since the
# relevant process is identified by the name of file to be viewed.
# Uses:
# 1. In preview_continuous mode, to save running a previewer
# when one is already running on the relevant file.
# 2. With xdvi in preview_continuous mode, xdvi must be
# signalled to make it read a new dvi file.
#
# The following works on Solaris, LINUX, HP-UX, IRIX
# Use -f to get full listing, including command line arguments.
# Use -u $ENV{USER} to get all processes started by current user (not just
# those associated with current terminal), but none of other users'
# processes.
# However, the USER environment variable may not exist. Windows uses
# USERNAME instead. (And this propagates to a situation of
# unix-emulation software running under Windows.)
if ( exists $ENV{USER} ) {
$pscmd = "ps -f -u $ENV{USER}";
}
elsif ( exists $ENV{USERNAME} ) {
$pscmd = "ps -f -u $ENV{USERNAME}";
}
else {
$pscmd = "ps -f";
}
$pid_position = 1; # offset of PID in output of pscmd; first item is 0.
if ( $^O eq "linux" ) {
# Ps on Redhat (at least v. 7.2) appears to truncate its output
# at 80 cols, so that a long command string is truncated.
# Fix this with the --width option. This option works under
# other versions of linux even if not necessary (at least
# for SUSE 7.2).
# However the option is not available under other UNIX-type
# systems, e.g., Solaris 8.
# But (19 Aug 2010), the truncation doesn't happen on RHEL4 and 5,
# unless the output is written to a terminal. So the --width
# option is now unnecessary
# $pscmd = "ps --width 200 -f -u $ENV{USER}";
}
elsif ( $^O eq "darwin" ) {
# OS-X on Macintosh
# open starts command associated with a file.
# For pdf, this is set by default to OS-X's preview, which is suitable.
# Manual update is simply by clicking on window etc, which is OK.
# For ps, this is set also to preview. This works, but since it
# converts the file to pdf and views the pdf file, it doesn't
# see updates, and a refresh cannot be done. This is far from
# optimal.
# For a full installation of MacTeX, which is probably the most common
# on OS-X, an association is created between dvi files and TeXShop.
# This also converts the file to pdf, so again while it works, it
# does not deal with changed dvi files, as far as I can see.
$pdf_previewer = 'open %S';
$pdf_update_method = 1; # manual
$dvi_previewer = $dvi_previewer_landscape = 'NONE';
$ps_previewer = $ps_previewer_landscape = 'NONE';
# Others
$lpr_pdf = 'lpr %O %S';
$pscmd = "ps -ww -u $ENV{USER}";
}
}
## default parameters
$auto_rc_use = 1; # Whether to read rc files automatically
$max_repeat = 5; # Maximum times I repeat latex. Normally
# 3 would be sufficient: 1st run generates aux file,
# 2nd run picks up aux file, and maybe toc, lof which
# contain out-of-date information, e.g., wrong page
# references in toc, lof and index, and unresolved
# references in the middle of lines. But the
# formatting is more-or-less correct. On the 3rd
# run, the page refs etc in toc, lof, etc are about
# correct, but some slight formatting changes may
# occur, which mess up page numbers in the toc and lof,
# Hence a 4th run is conceivably necessary.
# At least one document class (JHEP.cls) works
# in such a way that a 4th run is needed.
# We allow an extra run for safety for a
# maximum of 5. Needing further runs is
# usually an indication of a problem; further
# runs may not resolve the problem, and
# instead could cause an infinite loop.
$clean_ext = ""; # space separated extensions of files that are
# to be deleted when doing cleanup, beyond
# standard set
$clean_full_ext = ""; # space separated extensions of files that are
# to be deleted when doing cleanup_full, beyond
# standard set and those in $clean_ext
@cus_dep_list = (); # Custom dependency list
@default_files = ( '*.tex' ); # Array of LaTeX files to process when
# no files are specified on the command line.
# Wildcards allowed
# Best used for project specific files.
@default_excluded_files = ( );
# Array of LaTeX files to exclude when using
# @default_files, i.e., when no files are specified
# on the command line.
# Wildcards allowed
# Best used for project specific files.
$texfile_search = ""; # Specification for extra files to search for
# when no files are specified on the command line
# and the @default_files variable is empty.
# Space separated, and wildcards allowed.
# These files are IN ADDITION to *.tex in current
# directory.
# This variable is obsolete, and only in here for
# backward compatibility.
$fdb_ext = 'fdb_latexmk'; # Extension for the file for latexmk's
# file-database
# Make it long to avoid possible collisions.
$fdb_ver = 3; # Version number for kind of fdb_file.
$jobname = ''; # Jobname: as with current tex, etc indicates
# basename of generated files. Defined so
# that --jobname=STRING on latexmk's command
# line has same effect as with current tex,
# etc, with the exception listed below. (If
# $jobname is non-empty, then the
# --jobname=... option is used on tex.)
# Extension: $jobname is allowed to contain
# placeholder(s) (currently only %A),
# which allows construction of jobnames
# dependent on name of main TeX file; this is
# useful when a jobname is used and latexmk is
# invoked on multiple files.
$out_dir = ''; # Directory for output files.
# Cf. --output-directory of current (pdf)latex
$aux_dir = ''; # Directory for aux files (log, aux, etc).
# Cf. --aux-directory of current (pdf)latex in MiKTeX.
## default flag settings.
$recorder = 1; # Whether to use recorder option on latex/pdflatex
$silent = 0; # Silence latex's messages?
$warnings_as_errors = 0;# Treat warnings as errors and exit with non-zero exit code
$silence_logfile_warnings = 0; # Do list warnings in log file
$kpsewhich_show = 0; # Show calls to and results from kpsewhich
$landscape_mode = 0; # default to portrait mode
$analyze_input_log_always = 1; # Always analyze .log for input files in the
# <...> and (...) constructions. Otherwise, only
# do the analysis when fls file doesn't exist or is
# out of date.
# Under normal circumstances, the data in the fls file
# is reliable, and the test of the log file gets lots
# of false positives; usually $analyze_input_log_always
# is best set to zero. But the test of the log file
# is needed at least in the following situation:
# When a user needs to persuade latexmk that a certain
# file is a source file, and latexmk doesn't otherwise
# find it. User code causes line with (...) to be
# written to log file. One important case is for
# lualatex, which doesn't always generate lines in the
# .fls file for input lua files. (The situation with
# lualatex is HIGHLY version dependent, e.g., between
# 2016 and 2017.)
# To keep backward compatibility with older versions
# of latexmk, the default is to set
# $analyze_input_log_always to 1.
# The following two arrays contain lists of extensions (without
# period) for files that are read in during a (pdf)LaTeX run but that
# are generated automatically from the previous run, as opposed to
# being user generated files (directly or indirectly from a custom
# dependency). These files get two kinds of special treatment:
# 1. In clean up, where depending on the kind of clean up, some
# or all of these generated files are deleted.
# (Note that special treatment is given to aux files.)
# 2. In analyzing the results of a run of (pdf)LaTeX, to
# determine if another run is needed. With an error free run,
# a rerun should be provoked by a change in any source file,
# whether a user file or a generated file. But with a run
# that ends in an error, only a change in a user file during
# the run (which might correct the error) should provoke a
# rerun, but a change in a generated file should not.
# These arrays can be user-configured.
@generated_exts = ( 'aux', 'bcf', 'fls', 'idx', 'ind', 'lof', 'lot',
'out', 'toc' );
# N.B. 'out' is generated by hyperref package
# Which kinds of file do I have requests to make?
# If no requests at all are made, then I will make dvi file
# If particular requests are made then other files may also have to be
# made. E.g., ps file requires a dvi file
$dvi_mode = 0; # No dvi file requested
$postscript_mode = 0; # No postscript file requested
$pdf_mode = 0; # No pdf file requested to be made by pdflatex
# Possible values:
# 0 don't create pdf file
# 1 to create pdf file by pdflatex
# 2 to create pdf file by ps2pdf
# 3 to create pdf file by dvipdf
# 4 to create pdf file by lualatex
# 5 to create pdf file by xelatex + xdvipdfmx
$view = 'default'; # Default preview is of highest of dvi, ps, pdf
$sleep_time = 2; # time to sleep b/w checks for file changes in -pvc mode
$banner = 0; # Non-zero if we have a banner to insert
$banner_scale = 220; # Original default scale
$banner_intensity = 0.95; # Darkness of the banner message
$banner_message = 'DRAFT'; # Original default message
$do_cd = 0; # Do not do cd to directory of source file.
# Thus behave like latex.
$dependents_list = 0; # Whether to display list(s) of dependencies
$dependents_phony = 0; # Whether list(s) of dependencies includes phony targets
# (as with 'gcc -MP').
$deps_file = '-'; # File for dependency list output. Default stdout.
$rules_list = 0; # Whether to display list(s) of dependencies
@dir_stack = (); # Stack of pushed directories, each of form of
# pointer to array [ cwd, good_cwd ], where
# good_cwd differs from cwd by being converted
# to native MSWin path when cygwin is used.
$cleanup_mode = 0; # No cleanup of nonessential LaTex-related files.
# $cleanup_mode = 0: no cleanup
# $cleanup_mode = 1: full cleanup
# $cleanup_mode = 2: cleanup except for dvi,
# dviF, pdf, ps, psF & xdv
$cleanup_fdb = 0; # No removal of file for latexmk's file-database
$cleanup_only = 0; # When doing cleanup, do not go on to making files
$cleanup_includes_generated = 0;
# Determines whether cleanup deletes files generated by
# (pdf)latex (found from \openout lines in log file).
# It's more than that. BUG
$cleanup_includes_cusdep_generated = 0;
# Determines whether cleanup deletes files generated by
# custom dependencies
$diagnostics = 0;
$dvi_filter = ''; # DVI filter command
$ps_filter = ''; # Postscript filter command
$force_mode = 0; # =1 to force processing past errors
$go_mode = 0; # =1 to force processing regardless of time-stamps
# =2 full clean-up first
$preview_mode = 0;
$preview_continuous_mode = 0;
$printout_mode = 0; # Don't print the file
## Control pvc inactivity timeout:
$pvc_timeout = 0;
$pvc_timeout_mins = 30;
$show_time = 0;
@timings = ();
$processing_time1 = processing_time();
$use_make_for_missing_files = 0; # Whether to use make to try to make missing files.
# Do we make view file in temporary then move to final destination?
# (To avoid premature updating by viewer).
$always_view_file_via_temporary = 0; # Set to 1 if viewed file is always
# made through a temporary.
$pvc_view_file_via_temporary = 1; # Set to 1 if only in -pvc mode is viewed
# file made through a temporary.
# State variables initialized here:
$updated = 0; # Flags when something has been remade
# Used to allow convenient user message in -pvc mode
$waiting = 0; # Flags whether we are in loop waiting for an event
# Used to avoid unnecessary repeated o/p in wait loop
# The following are used for some results of parsing log file
# Global variables, so results can be reported in main program.
$reference_changed = 0;
$mult_defined = 0;
$bad_reference = 0;
$bad_character = 0;
$bad_citation = 0;
@primary_warning_summary = ();
# Cache of expensive-to-compute state variables, e.g., cwd in form
# fixed to deal with cygwin issues.
%cache = ();
&cache_good_cwd;
# Set search paths for includes.
# Set them early so that they can be overridden
$BIBINPUTS = $ENV{'BIBINPUTS'};
if (!$BIBINPUTS) { $BIBINPUTS = '.'; }
# Convert search paths to arrays:
# If any of the paths end in '//' then recursively search the
# directory. After these operations, @BIBINPUTS should
# have all the directories that need to be searched
@BIBINPUTS = find_dirs1( $BIBINPUTS );
######################################################################
######################################################################
#
# ??? UPDATE THE FOLLOWING!!
#
# We will need to determine whether source files for runs of various
# programs are out of date. In a normal situation, this is done by
# asking whether the times of the source files are later than the
# destination files. But this won't work for us, since a common
# situation is that a file is written on one run of latex, for
# example, and read back in on the next run (e.g., an .aux file).
# Some situations of this kind are standard in latex generally; others
# occur with particular macro packages or with particular
# postprocessors.
#
# The correct criterion for whether a source is out-of-date is
# therefore NOT that its modification time is later than the
# destination file, but whether the contents of the source file have
# changed since the last successful run. This also handles the case
# that the user undoes some changes to a source file by replacing the
# source file by reverting to an earlier version, which may well have
# an older time stamp. Since a direct comparison of old and new files
# would involve storage and access of a large number of backup files,
# we instead use the md5 signature of the files. (Previous versions
# of latexmk used the backup file method, but restricted to the case
# of .aux and .idx files, sufficient for most, but not all,
# situations.)
#
# We will have a database of (time, size, md5) for the relevant
# files. If the time and size of a file haven't changed, then the file
# is assumed not to have changed; this saves us from having to
# determine its md5 signature, which would involve reading the whole
# file, which is naturally time-consuming, especially if network file
# access to a server is needed, and many files are involved, when most
# of them don't change. It is of course possible to change a file
# without changing its size, but then to adjust its timestamp
# to what it was previously; this requires a certain amount of
# perversity. We can safely assume that if the user edits a file or
# changes its contents, then the file's timestamp changes. The
# interesting case is that the timestamp does change, because the file
# has actually been written to, but that the contents do not change;
# it is for this that we use the md5 signature. However, since
# computing the md5 signature involves reading the whole file, which
# may be large, we should avoid computing it more than necessary.
#
# So we get the following structure:
#
# 1. For each relevant run (latex, pdflatex, each instance of a
# custom dependency) we have a database of the state of the
# source files that were last used by the run.
# 2. On an initial startup, the database for a primary tex file
# is read that was created by a previous run of latex or
# pdflatex, if this exists.
# 3. If the file doesn't exist, then the criterion for
# out-of-dateness for an initial run is that it goes by file
# timestamps, as in previous versions of latexmk, with due
# (dis)regard to those files that are known to be generated by
# latex and re-read on the next run.
# 4. Immediately before a run, the database is updated to
# represent the current conditions of the run's source files.
# 5. After the run, it is determined whether any of the source
# files have changed. This covers both files written by the
# run, which are therefore in a dependency loop, and files that
# the user may have updated during the run. (The last often
# happens when latex takes a long time, for a big document,
# and the user makes edits before latex has finished. This is
# particularly prevalent when latexmk is used with
# preview-continuous mode.)
# 6. In the case of latex or pdflatex, the custom dependencies
# must also be checked and redone if out-of-date.
# 7. If any source files have changed, the run is redone,
# starting at step 1.
# 8. There is naturally a limit on the number of reruns, to avoid
# infinite loops from bugs and from pathological or unforeseen
# conditions.
# 9. After the run is done, the run's file database is updated.
# (By hypothesis, the sizes and md5s are correct, if the run
# is successful.)
# 10. To allow reuse of data from previous runs, the file database
# is written to a file after every complete set of passes
# through latex or pdflatex. (Note that there is separate
# information for latex and pdflatex; the necessary
# information won't coincide: Out-of-dateness for the files
# for each program concerns the properties of the files when
# the other program was run, and the set of source files could
# be different, e.g., for graphics files.)
#
# We therefore maintain the following data structures.:
#
# a. For each run (latex, pdflatex, each custom dependency) a
# database is maintained. This is a hash from filenames to a
# reference to an array: [time, size, md5]. The semantics of
# the database is that it represents the state of the source
# files used in the run. During a run it represents the state
# immediately before the run; after a run, with all reruns, it
# represents the state of the files used, modified by having
# the latest timestamps for generated files.
# b. There is a global database for all files, which represents
# the current state. This saves having to recompute the md5
# signatures of a changed file used in more than one run
# (e.g., latex and pdflatex).
# c. Each of latex and pdflatex has a list of the relevant custom
# dependencies.
#
# In all the following a fdb-hash is a hash of the form:
# filename -> [time, size, md5]
# If a file is found to disappear, its entry is removed from the hash.
# In returns from fdb access routines, a size entry of -1 indicates a
# non-existent file.
# List of known rules. Rule types: primary,
# external (calls program), internal (calls routine), cusdep.
%possible_primaries = ( 'latex' => 'primary', 'pdflatex' => 'primary',
'lualatex' => 'primary', 'xelatex' => 'primary' );
# Hashes, whose keys give names of particular kinds of rule, and targets.
# We use hashes for ease of lookup.
%possible_one_time = ( 'view' => 1, 'print' => 1, 'update_view' => 1, );
%target_files = (); # Hash for target files.
# The keys are the filenames and the value is
# currently irrelevant.
%target_rules = (); # Hash for target rules beyond those corresponding to files.
# The keys are the rule names and the value is
# currently irrelevant.
# The target **files** can only be set inside the FILE loop.
$current_primary = 'latex'; # Rule to compile .tex file.
# Subject to document-dependent override if .tex document
# uses metcommands andobeying them is enabled.
$pdf_method = ''; # How to make pdf file. '' if not requested,
# else 'ps2pdf', 'dvipdf', 'pdflatex', 'lualatex' or 'xelatex'
# Subject to document-dependent override if .tex document
#uses \pdfoutput or c.
%requested_filetypes = (); # Hash of requested file types (dvi, dviF, etc)
%one_time = (); # Hash for requested one-time-only rules, currently
# possible values 'print' and 'view'.
%actives = (); # Hash of active rules
$allow_switch = 1; # Allow switch of rule structure to accommodate
# changed output file name of primary. Even if
# this flag is set on, the switch may be
# prohibited by other issues.
%rule_db = (); # Database of all rules:
# Hash: rulename -> [array of rule data]
# Rule data:
# 0: [ cmd_type, ext_cmd, int_cmd, test_kind,
# source, dest, base,
# out_of_date, out_of_date_user,
# time_of_last_run, time_of_last_file_check,
# changed
# last_result, last_message,
# default_extra_generated,
# ]
# where
# cmd_type is 'primary', 'external', or 'cusdep'
# ext_cmd is string for associated external command
# with substitutions (%D for destination, %S
# for source, %B for base of current rule,
# %R for base of primary tex file, %T for
# texfile name, %O for options,
# %Y for $aux_dir1, and %Z for $out_dir1
# int_cmd specifies any internal command to be
# used to implement the application of the
# rule. If this is present, it overrides
# the external command, and it is the
# responsibility of the perl subroutine
# specified in intcmd to execute the
# external command if this is appropriate.
# This variable intcmd is a reference to an array,
# $$intcmd[0] = internal routine
# $$intcmd[1...] = its arguments (if any)
# test_kind specifies method of determining
# whether a file is out-of-date:
# 0 for never
# 1 for usual: whether there is a source
# file change
# 2 for dest earlier than source
# 3 for method 2 at first run, 1 thereafter
# (used when don't have file data from
# previous run).
# source = name of primary source file, if any
# dest = name of primary destination file,
# if any
# base = base name, if any, of files for
# this rule
# out_of_date = 1 if it has been detected that
# this rule needs to be run
# (typically because a source
# file has changed).
# Other values may be used for special cases.
# 0 otherwise
# out_of_date_user is like out_of_date, except
# that the detection of out-of-dateness
# has been made from a change of a
# putative user file, i.e., one that is
# not a generated file (e.g., aux). This
# kind of out-of-dateness should provoke a
# rerun whether or not there was an error
# during a run of (pdf)LaTeX. Normally,
# if there is an error, one should wait
# for the user to correct the error. But
# it is possible the error condition is
# already corrected during the run, e.g.,
# by the user changing a source file in
# response to an error message.
# time_of_last_run = time that this rule was
# last applied. (In standard units
# from perl, to be directly compared
# with file modification times.)
# time_of_last_file_check = last time that a check
# was made for changes in source files.
# changed flags whether special changes have been made
# that require file-existence status to be ignored
# last_result is
# -1 if no run has been made,
# 0 if the last run was successful
# 1 if last run was successful, but
# failed to create an output file
# 2 if last run failed
# 200 if last run gave a warning that is
# important enough to be reported with
# the error summary. The warning
# message is stored in last_message.
# last_message is error message for last run
# default_extra_generated is a reference to an array
# of specifications of extra generated files (beyond
# the main dest file. Standard place holders are used.
# active (1 or 0) is whether the rule is currently active
# and hence accessed in recursion and linked to
#
# Example ['%Y%R.log'] for (pdf)latex, and ['%R.blg']
# for bibtex. (There's no need for '%R.aux', here,
# since such generated files are detected dynamically.)
# 1: {Hash sourcefile -> [source-file data] }
# Source-file data array:
# 0: time
# 1: size
# 2: md5
# 3: name of rule to make this file
# 4: whether the file is of the kind made by epstopdf.sty
# during a primary run. It will have been read during
# the run, so that even though the file changes during
# a primary run, there is no need to trigger another
# run because of this.
# Size and md5 correspond to the values at the last run.
# But time may be updated to correspond to the time
# for the file, if the file is otherwise unchanged.
# This saves excessive md5 calculations, which would
# otherwise be done everytime the file is checked,
# in the following situation:
# When the file has been rewritten after a run
# has started (commonly aux, bbl files etc),
# but the actual file contents haven't
# changed. Then because the filetime has
# changed, on every file-change check latexmk
# would normally redo the md5 calculation to
# test for actual changes. Once one such
# check is done, and the contents are
# unchanged, later checks are superfluous, and
# can be avoided by changing the file's time
# in the source-file list.
# 2: {Hash generated_file -> 1 }
# This lists all generated files; the values
# are currently unused, only the keys
%fdb_current = (); # Hash of information for all files used.
# It maps filename to a reference to an array
# (time, size, md5_checksum).
@nofile = (0,-1,0); # What we use for initializing a new entry in fdb
# or flagging non-existent file.
# The following provide information about the structure of the network of rules
# and files. They are set by the routine rdb_set_rule_net
%from_rules = (); # Used to optimize test for whether a file is generated.
# This maps files to rules that generate them. (Files
# anywhere in %$PHdest.)
%from_rules_main = (); # Used to optimize test for whether a file is generated.
# This maps files to rules that generate them as the
# MAIN output. (I.e., file $$Pdest only.)
# Classification of rules, for determining order of application
%current_primaries = (); # Keys are primary rules (latex, etc) that are currently in use.
@pre_primary = (); # Array of rules that are thought of as pre-primary
@post_primary = (); # Array of rules that are thought of as post-primary
@unusual_one_time = (); # Array of rules that are special cases of one-time rules.
# Currently not used.
# User's home directory
$HOME = '';
if (exists $ENV{'HOME'} ) {
$HOME = $ENV{'HOME'};
}
elsif (exists $ENV{'USERPROFILE'} ) {
$HOME = $ENV{'USERPROFILE'};
}
# XDG configuration home
$XDG_CONFIG_HOME = '';
if (exists $ENV{'XDG_CONFIG_HOME'} ) {
$XDG_CONFIG_HOME = $ENV{'XDG_CONFIG_HOME'};
}
elsif ($HOME ne '') {
if ( -d "$HOME/.config") {
$XDG_CONFIG_HOME = "$HOME/.config";
}
}
#==================================================
# Options that are to be obeyed before rc files are read:
foreach $_ ( @ARGV )
{
if (/^-{1,2}norc$/ ) {
$auto_rc_use = 0;
}
}
#==================================================
## Read rc files with this subroutine
sub read_first_rc_file_in_list {
foreach my $rc_file ( @_ ) {
#print "===Testing for rc file \"$rc_file\" ...\n";
if ( -d $rc_file ) {
warn "$My_name: I have found a DIRECTORY named \"$rc_file\".\n",
" Have you perhaps misunderstood latexmk's documentation?\n",
" This name is normally used for a latexmk configuration (rc) file,\n",
" and in that case it should be a regular text file, not a directory.\n";
}
elsif ( -e $rc_file ) {
#print "===Reading rc file \"$rc_file\" ...\n";
process_rc_file( $rc_file );
return;
}
}
}
# Note that each rc file may unset $auto_rc_use to
# prevent lower-level rc files from being read.
# So test on $auto_rc_use in each case.
if ( $auto_rc_use ) {
# System rc file:
if (exists $ENV{LATEXMKRCSYS} ) {
push @rc_system_files, $ENV{LATEXMKRCSYS};
if ( !-e $ENV{LATEXMKRCSYS} ) {
warn "$My_name: you've specified a system rc file `$ENV{LATEXMKRCSYS}`\n",
" in environment variable LATEXMKRCSYS, but the file doesn't exist.\n",
" I won't read any system rc file.\n";
}
else {
process_rc_file( $ENV{LATEXMKRCSYS} );
}
}
else {
read_first_rc_file_in_list( @rc_system_files );
}
}
if ( $auto_rc_use && ($HOME ne "" ) ) {
# User rc file:
@user_rc = ();
if ( $XDG_CONFIG_HOME ) {
push @user_rc, "$XDG_CONFIG_HOME/latexmk/latexmkrc";
}
# N.B. $HOME equals "" if latexmk couldn't determine a home directory.
# In that case, we shouldn't look for an rc file there.
if ( $HOME ) {
push @user_rc, "$HOME/.latexmkrc";
}
read_first_rc_file_in_list( @user_rc );
}
if ( $auto_rc_use ) {
# Rc file in current directory:
read_first_rc_file_in_list( "latexmkrc", ".latexmkrc" );
}
## Process command line args.
@command_line_file_list = ();
$bad_options = 0;
while ($_ = $ARGV[0])
{
# Make -- and - equivalent at beginning of option,
# but save original for possible use in (pdf)latex command line
$original = $_;
s/^--/-/;
shift;
if ( /^-aux-directory=(.*)$/ || /^-auxdir=(.*)$/ ) {
$aux_dir = $1;
}
elsif (/^-bibtex$/) { $bibtex_use = 2; }
elsif (/^-bibtex-$/) { $bibtex_use = 0; }
elsif (/^-nobibtex$/) { $bibtex_use = 0; }
elsif (/^-bibtex-cond$/) { $bibtex_use = 1; }
elsif (/^-bibtex-cond1$/) { $bibtex_use = 1.5; }
elsif (/^-c$/) { $cleanup_mode = 2; $cleanup_fdb = 1; $cleanup_only = 1; }
elsif (/^-C$/ || /^-CA$/ ) { $cleanup_mode = 1; $cleanup_fdb = 1; $cleanup_only = 1; }
elsif (/^-CF$/) { $cleanup_fdb = 1; }
elsif (/^-cd$/) { $do_cd = 1; }
elsif (/^-cd-$/) { $do_cd = 0; }
elsif (/^-commands$/) { &print_commands; exit; }
elsif (/^-d$/) { $banner = 1; }
elsif (/^-dependents$/ || /^-deps$/ || /^-M$/ ) { $dependents_list = 1; }
elsif (/^-nodependents$/ || /^-dependents-$/ || /^-deps-$/) { $dependents_list = 0; }
elsif (/^-deps-out=(.*)$/) {
$deps_file = $1;
$dependents_list = 1;
}
elsif (/^-diagnostics/) { $diagnostics = 1; }
elsif (/^-dvi$/) { $dvi_mode = 1; }
elsif (/^-dvi-$/) { $dvi_mode = 0; }
elsif (/^-f$/) { $force_mode = 1; }
elsif (/^-f-$/) { $force_mode = 0; }
elsif (/^-g$/) { $go_mode = 1; }
elsif (/^-g-$/) { $go_mode = 0; }
elsif (/^-gg$/) {
$go_mode = 2; $cleanup_mode = 1; $cleanup_fdb = 1; $cleanup_only = 0;
}
elsif ( /^-h$/ || /^-help$/ ) { &print_help; exit;}
elsif (/^-jobname=(.*)$/) {
$jobname = $1;
}
elsif (/^-l$/) { $landscape_mode = 1; }
elsif (/^-l-$/) { $landscape_mode = 0; }
elsif (/^-latex=(.*)$/) {
$latex = $1;
}
elsif (/^-latexoption=(.*)$/) {
push @extra_latex_options, $1;
push @extra_pdflatex_options, $1;
push @extra_lualatex_options, $1;
push @extra_xelatex_options, $1;
}
elsif ( /^-logfilewarninglist$/ || /^-logfilewarnings$/ )
{ $silence_logfile_warnings = 0; }
elsif ( /^-logfilewarninglist-$/ || /^-logfilewarnings-$/ )
{ $silence_logfile_warnings = 1; }
# See above for -M
elsif (/^-MF$/) {
if ( $ARGV[0] eq '' ) {
&exit_help( "No file name specified after -MF switch");
}
$deps_file = $ARGV[0];
shift;
}
elsif ( /^-MP$/ ) { $dependents_phony = 1; }
elsif (/^-new-viewer$/) {
$new_viewer_always = 1;
}
elsif (/^-new-viewer-$/) {
$new_viewer_always = 0;
}
elsif (/^-norc$/ ) {
$auto_rc_use = 0;
# N.B. This has already been obeyed.
}
elsif ( /^-output-directory=(.*)$/ ||/^-outdir=(.*)$/ ) {
$out_dir = $1;
}
elsif (/^-p$/) { $printout_mode = 1;
$preview_continuous_mode = 0; # to avoid conflicts
$preview_mode = 0;
}
elsif (/^-p-$/) { $printout_mode = 0; }
elsif (/^-pdf$/) { $pdf_mode = 1; }
elsif (/^-pdf-$/) { $pdf_mode = 0; }
elsif (/^-pdfdvi$/){ $pdf_mode = 3; }
elsif (/^-pdflua$/){ $pdf_mode = 4; }
elsif (/^-pdfps$/) { $pdf_mode = 2; }
elsif (/^-pdfxe$/) { $pdf_mode = 5; }
# elsif (/^-pdflatex$/) {
# $pdflatex = "pdflatex %O %S";
# $pdf_mode = 1;
# $dvi_mode = $postscript_mode = 0;
# }
elsif (/^-pdflatex=(.*)$/) {
$pdflatex = $1;
}
elsif (/^-pdflualatex=(.*)$/) {
$lualatex = $1;
}
elsif (/^-pdfxelatex=(.*)$/) {
$xelatex = $1;
}
elsif (/^-pretex=(.*)$/) {
$pre_tex_code = $1;
}
elsif (/^-print=(.*)$/) {
$value = $1;
if ( $value =~ /^dvi$|^ps$|^pdf$|^auto$/ ) {
$print_type = $value;
$printout_mode = 1;
}
else {
&exit_help("$My_name: unknown print type '$value' in option '$_'");
}
}
elsif (/^-ps$/) { $postscript_mode = 1; }
elsif (/^-ps-$/) { $postscript_mode = 0; }
elsif (/^-pv$/) { $preview_mode = 1;
$preview_continuous_mode = 0; # to avoid conflicts
$printout_mode = 0;
}
elsif (/^-pv-$/) { $preview_mode = 0; }
elsif (/^-pvc$/) { $preview_continuous_mode = 1;
$force_mode = 0; # So that errors do not cause loops
$preview_mode = 0; # to avoid conflicts
$printout_mode = 0;
}
elsif (/^-pvc-$/) { $preview_continuous_mode = 0; }
elsif (/^-pvctimeout$/) { $pvc_timeout = 1; }
elsif (/^-pvctimeout-$/) { $pvc_timeout = 0; }
elsif (/^-pvctimeoutmins=(.*)$/) { $pvc_timeout_mins = $1; }
elsif (/^-recorder$/ ){ $recorder = 1; }
elsif (/^-recorder-$/ ){ $recorder = 0; }
elsif (/^-rules$/ ) { $rules_list = 1; }
elsif (/^-norules$/ || /^-rules-$/ ) { $rules_list = 0; }
elsif (/^-showextraoptions$/) {
print "List of extra latex and pdflatex options recognized by $my_name.\n",
"These are passed as is to (pdf)latex. They may not be recognized by\n",
"particular versions of (pdf)latex. This list is a combination of those\n",
"for TeXLive and MikTeX.\n",
"\n",
"Note that in addition to the options in this list, there are several\n",
"options known to the (pdf)latex programs that are also recognized by\n",
"latexmk and trigger special behavior by latexmk. Since these options\n",
"appear in the main list given by running 'latexmk --help', they do not\n",
"appear in the following list\n",
"NOTE ALSO: Not all of these options are supported by all versions of (pdf)latex.\n",
"\n";
foreach $option ( sort( keys %allowed_latex_options, keys %allowed_latex_options_with_arg ) ) {
if (exists $allowed_latex_options{$option} ) { print " $allowed_latex_options{$option}\n"; }
if (exists $allowed_latex_options_with_arg{$option} ) { print " $allowed_latex_options_with_arg{$option}\n"; }
}
exit;
}
elsif (/^-silent$/ || /^-quiet$/ ){ $silent = 1; }
elsif (/^-stdtexcmds$/) { &std_tex_cmds; }
elsif (/^-time$/) { $show_time = 1;}
elsif (/^-time-$/) { $show_time = 0;}
elsif (/^-use-make$/) { $use_make_for_missing_files = 1; }
elsif (/^-use-make-$/) { $use_make_for_missing_files = 0; }
elsif (/^-usepretex$/) { &alt_tex_cmds; }
elsif (/^-usepretex=(.*)$/) {
&alt_tex_cmds;
$pre_tex_code = $1;
}
elsif (/^-v$/ || /^-version$/) {
print "\n$version_details. Version $version_num\n";
exit;
}
elsif (/^-verbose$/) { $silent = 0; }
elsif (/^-view=default$/) { $view = "default";}
elsif (/^-view=dvi$/) { $view = "dvi";}
elsif (/^-view=none$/) { $view = "none";}
elsif (/^-view=ps$/) { $view = "ps";}
elsif (/^-view=pdf$/) { $view = "pdf"; }
elsif (/^-Werror$/){ $warnings_as_errors = 1; }
elsif (/^-lualatex$/) {
$pdf_mode = 4;
$dvi_mode = $postscript_mode = 0;
}
elsif (/^-xelatex$/) {
$pdf_mode = 5;
$dvi_mode = $postscript_mode = 0;
}
elsif (/^-e$/) {
if ( $#ARGV < 0 ) {
&exit_help( "No code to execute specified after -e switch");
}
execute_code_string( $ARGV[0] );
shift;
}
elsif (/^-r$/) {
if ( $ARGV[0] eq '' ) {
&exit_help( "No RC file specified after -r switch");
}
if ( -e $ARGV[0] ) {
process_rc_file( $ARGV[0] );
}
else {
die "$My_name: RC file [$ARGV[0]] does not exist\n";
}
shift;
}
elsif (/^-bm$/) {
if ( $ARGV[0] eq '' ) {
&exit_help( "No message specified after -bm switch");
}
$banner = 1; $banner_message = $ARGV[0];
shift;
}
elsif (/^-bi$/) {
if ( $ARGV[0] eq '' ) {
&exit_help( "No intensity specified after -bi switch");
}
$banner_intensity = $ARGV[0];
shift;
}
elsif (/^-bs$/) {
if ( $ARGV[0] eq '' ) {
&exit_help( "No scale specified after -bs switch");
}
$banner_scale = $ARGV[0];
shift;
}
elsif (/^-dF$/) {
if ( $ARGV[0] eq '' ) {
&exit_help( "No dvi filter specified after -dF switch");
}
$dvi_filter = $ARGV[0];
shift;
}
elsif (/^-pF$/) {
if ( $ARGV[0] eq '' ) {
&exit_help( "No ps filter specified after -pF switch");
}
$ps_filter = $ARGV[0];
shift;
}
elsif ( ( exists( $allowed_latex_options{$_} ) )
|| ( /^(-.+)=/ && exists( $allowed_latex_options_with_arg{$1} ) )
)
{
push @extra_latex_options, $original;
push @extra_pdflatex_options, $original;
push @extra_lualatex_options, $original;
push @extra_xelatex_options, $original;
}
elsif (/^-/) {
warn "$My_name: $_ bad option\n";
$bad_options++;
}
else {
push @command_line_file_list, $_ ;
}
}
if ( $bad_options > 0 ) {
&exit_help( "Bad options specified" );
}
warn "$My_name: This is $version_details, version: $version_num.\n",
unless $silent;
if ( ($out_dir ne '') && ($aux_dir eq '') ){
$aux_dir = $out_dir;
}
# Save original values for use in diagnositics.
# We may change $aux_dir and $out_dir after a detection
# of results of misconfiguration.
$aux_dir_requested = $aux_dir;
$out_dir_requested = $out_dir;
# The following reports results of diagnostics on location of .log file
# after the first run of a latex engine, when actually used aux_dir
# may not be the expected one, due to a configuration error.
# Values: -1 uninitialized (before first run)
# 0 log file not found;
# 1 log file in aux_dir;
# 2 log file **not** in aux_dir but in out_dir;
# 3 log file **not** in aux_dir or out_dir, but in cwd.
$where_log = -1;
&set_dirs_etc;
if ($bibtex_use > 1) {
push @generated_exts, 'bbl';
}
# For backward compatibility, convert $texfile_search to @default_files
# Since $texfile_search is initialized to "", a nonzero value indicates
# that an initialization file has set it.
if ( $texfile_search ne "" ) {
@default_files = split /\s+/, "*.tex $texfile_search";
}
#Glob the filenames command line if the script was not invoked under a
# UNIX-like environment.
# Cases: (1) MS/MSwin native Glob
# (OS detected as MSWin32)
# (2) MS/MSwin cygwin Glob [because we do not know whether
# the cmd interpreter is UNIXy (and does glob) or is
# native MS-Win (and does not glob).]
# (OS detected as cygwin)
# (3) UNIX Don't glob (cmd interpreter does it)
# (Currently, I assume this is everything else)
if ( ($^O eq "MSWin32") || ($^O eq "cygwin") ) {
# Preserve ordering of files
@file_list = glob_list1(@command_line_file_list);
#print "A1:File list:\n";
#for ($i = 0; $i <= $#file_list; $i++ ) { print "$i: '$file_list[$i]'\n"; }
}
else {
@file_list = @command_line_file_list;
}
@file_list = uniq1( @file_list );
# Check we haven't selected mutually exclusive modes.
# Note that -c overrides all other options, but doesn't cause
# an error if they are selected.
if (($printout_mode && ( $preview_mode || $preview_continuous_mode ))
|| ( $preview_mode && $preview_continuous_mode ))
{
# Each of the options -p, -pv, -pvc turns the other off.
# So the only reason to arrive here is an incorrect inititalization
# file, or a bug.
&exit_help( "Conflicting options (print, preview, preview_continuous) selected");
}
if ( @command_line_file_list ) {
# At least one file specified on command line (before possible globbing).
if ( !@file_list ) {
&exit_help( "Wildcards in file names didn't match any files");
}
}
else {
# No files specified on command line, try and find some
# Evaluate in order specified. The user may have some special
# for wanting processing in a particular order, especially
# if there are no wild cards.
# Preserve ordering of files
my @file_list1 = uniq1( glob_list1(@default_files) );
my @excluded_file_list = uniq1( glob_list1(@default_excluded_files) );
# Make hash of excluded files, for easy checking:
my %excl = ();
foreach my $file (@excluded_file_list) {
$excl{$file} = '';
}
foreach my $file (@file_list1) {
push( @file_list, $file) unless ( exists $excl{$file} );
}
if ( !@file_list ) {
&exit_help( "No file name specified, and I couldn't find any");
}
}
$num_files = $#file_list + 1;
$num_specified = $#command_line_file_list + 1;
#print "Command line file list:\n";
#for ($i = 0; $i <= $#command_line_file_list; $i++ ) { print "$i: '$command_line_file_list[$i]'\n"; }
#print "File list:\n";
#for ($i = 0; $i <= $#file_list; $i++ ) { print "$i: '$file_list[$i]'\n"; }
# If selected a preview-continuous mode, make sure exactly one filename was specified
if ($preview_continuous_mode && ($num_files != 1) ) {
if ($num_specified > 1) {
&exit_help(
"Need to specify exactly one filename for ".
"preview-continuous mode\n".
" but $num_specified were specified"
);
}
elsif ($num_specified == 1) {
&exit_help(
"Need to specify exactly one filename for ".
"preview-continuous mode\n".
" but wildcarding produced $num_files files"
);
}
else {
&exit_help(
"Need to specify exactly one filename for ".
"preview-continuous mode.\n".
" Since none were specified on the command line, I looked for \n".
" files in '@default_files'.\n".
" But I found $num_files files, not 1."
);
}
}
# If selected jobname, can only apply that to one file:
if ( ($jobname ne '') && ($jobname !~ /%A/) && ($num_files > 1) ) {
&exit_help(
"Need to specify at most one filename if ".
"jobname specified without a %A, \n".
" but $num_files were found (after defaults and wildcarding)."
);
}
if ( $jobname =~ /%[^A]/ ) {
&exit_help(
"Jobname '$jobname' contains placeholder other than %A."
);
}
# Normalize the commands, to have place-holders for source, dest etc:
&fix_cmds;
# Add common options
add_option( $latex_default_switches, \$latex );
add_option( $pdflatex_default_switches, \$pdflatex );
add_option( $lualatex_default_switches, \$lualatex );
add_option( $xelatex_default_switches, \$xelatex );
foreach (@extra_latex_options) { add_option( $_, \$latex ); }
foreach (@extra_pdflatex_options) { add_option( $_, \$pdflatex ); }
foreach (@extra_lualatex_options) { add_option( $_, \$lualatex ); }
foreach (@extra_xelatex_options) { add_option( $_, \$xelatex ); }
# If landscape mode, change dvips processor, and the previewers:
if ( $landscape_mode )
{
$dvips = $dvips_landscape;
$dvi_previewer = $dvi_previewer_landscape;
$ps_previewer = $ps_previewer_landscape;
}
if ( $silent ) {
add_option( "$latex_silent_switch", \$latex );
add_option( "$pdflatex_silent_switch", \$pdflatex );
add_option( "$lualatex_silent_switch", \$lualatex );
add_option( "$xelatex_silent_switch", \$xelatex );
add_option( "$biber_silent_switch", \$biber );
add_option( "$bibtex_silent_switch", \$bibtex );
add_option( "$makeindex_silent_switch", \$makeindex );
add_option( "$dvipdf_silent_switch", \$dvipdf );
add_option( "$dvips_silent_switch", \$dvips );
add_option( "$xdvipdfmx_silent_switch", \$xdvipdfmx );
}
if ( $recorder ) {
add_option( "-recorder", \$latex, \$pdflatex, \$lualatex, \$xelatex );
}
# If the output and/or aux directories are specified, fix the (pdf)latex
# commands to use them.
# N.B. We'll ensure that the directories actually exist only after a
# possible cd to the document directory, since the directories can be
# relative to the document.
if ( $out_dir ) {
add_option( "-output-directory=\"$out_dir\"",
\$latex, \$pdflatex, \$lualatex, \$xelatex );
}
if ( $aux_dir && ($aux_dir ne $out_dir) ) {
# N.B. If $aux_dir and $out_dir are the same, then the -output-directory
# option is sufficient, especially because the -aux-directory exists
# only in MiKTeX, not in TeXLive.
add_option( "-aux-directory=\"$aux_dir\"",
\$latex, \$pdflatex, \$lualatex, \$xelatex );
}
if ( $jobname ne '' ) {
# Since $jobname may include placeholder(s), put %R placeholder
# in option, and let %R be substituted by actual jobname at runtime.
add_option( "--jobname=%R", \$latex, \$lualatex, \$pdflatex, \$xelatex );
}
# Which kind of file do we preview?
if ( $view eq "default" ) {
# If default viewer requested, use "highest" of dvi, ps and pdf
# that was requested by user.
# No explicit request means view dvi.
$view = "dvi";
if ( $postscript_mode ) { $view = "ps"; }
if ( $pdf_mode ) { $view = "pdf"; }
}
# Make sure we make the kind of file we want to view:
if ($view eq 'dvi') { $dvi_mode = 1; }
if ($view eq 'ps') { $postscript_mode = 1; }
if ( ($view eq 'pdf') && ($pdf_mode == 0) ) {
$pdf_mode = 1;
}
# Make sure that we make something if all requests are turned off
if ( ! ( $dvi_mode || $pdf_mode || $postscript_mode || $printout_mode) ) {
print "No specific requests made, so default to dvi by latex\n";
$dvi_mode = 1;
}
# Determine requests.
if ( $banner ) { $postscript_mode = 1; }
if ( $dvi_mode ) {
$current_primary = 'latex';
$requested_filetypes{'dvi'} = 1;
if ( length($dvi_filter) != 0 ) { $requested_filetypes{'dviF'} = 1; }
}
if ( $postscript_mode ) {
$current_primary = 'latex';
$requested_filetypes{'ps'} = 1;
if ( length($ps_filter) != 0 ) { $requested_filetypes{'psF'} = 1; }
}
if ($pdf_mode > 5) {
warn "$My_name: Non-allowed value of \$pdf_mode = $pdf_mode,",
" replaced by 1.\n";
$pdf_mode = 1;
}
if ( ($dvi_mode || $postscript_mode) && $pdf_mode ) {
my %disallowed = ();
foreach (1,4,5) { $disallowed{$_} = 1; }
if ($disallowed{$pdf_mode}) {
warn "$My_name: \$pdf_mode = $pdf_mode is incompatible with dvi and postscript modes\n",
" which are required by other requests.\n";
if ($postscript_mode) {$pdf_mode = 2;}
else { $pdf_mode = 3; }
warn " I replaced it by $pdf_mode.\n";
}
}
if ( $pdf_mode == 0 ) {
$pdf_method = '';
}
elsif ( $pdf_mode == 1 ) {
$requested_filetypes{'pdf'} = 1;
$pdf_method = 'pdflatex';
}
elsif ( $pdf_mode == 2 ) {
$requested_filetypes{'pdf'} = 1;
$pdf_method = 'ps2pdf';
}
elsif ( $pdf_mode == 3 ) {
$requested_filetypes{'pdf'} = 1;
$pdf_method = 'dvipdf';
}
elsif ( $pdf_mode == 4 ) {
$requested_filetypes{'pdf'} = 1;
$pdf_method = 'lualatex';
}
elsif ( $pdf_mode == 5 ) {
$requested_filetypes{'pdf'} = 1;
$pdf_method = 'xelatex';
}
if ($print_type eq 'auto') {
if ( $postscript_mode ) { $print_type = 'ps'; }
elsif ( $pdf_mode ) { $print_type = 'pdf'; }
elsif ( $dvi_mode ) { $print_type = 'dvi'; }
else { $print_type = 'none'; }
}
if ( $printout_mode ) {
$one_time{'print'} = 1;
if ($print_type eq 'none'){
warn "$My_name: You have requested printout, but \$print_type is set to 'none'\n";
}
}
if ( $preview_continuous_mode || $preview_mode ) { $one_time{'view'} = 1; }
$can_switch = $allow_switch;
if ( $dvi_mode || $postscript_mode
|| ( $printout_mode && ($print_type eq 'ps') || ($print_type eq 'dvi') )
|| ( ($preview_mode || $preview_continuous_mode) && ( ($view eq 'ps') || ($view eq 'dvi') ) )
) {
# Automatic switching (e.g., pdf<->dvi o/p) requires pdf files to be
# the only destinations. So if ps or dvi files needed, we cannot
# allow switching. (There will then be an error condition if a TeX
# engine fails to produce the correct type of output file.)
warn "$My_name: Disallowing switch of output file as incompatible\n",
" with file requests.\n";
$can_switch = 0;
}
if ( $pdf_mode == 2 ) {
# We generate pdf from ps. Make sure we have the correct kind of ps.
add_option( "$dvips_pdf_switch", \$dvips );
}
# Restrict variables to allowed values:
if ($filetime_causality_threshold < 0) {
warn "$My_name: Correcting negative value of \$filetime_causality_threshold to zero.\n";
$filetime_causality_threshold = 0;
}
# Note sleep has granularity of 1 second.
# Sleep periods 0 < $sleep_time < 1 give zero delay,
# which is probably not what the user intended.
# Sleep periods less than zero give infinite delay
if ( $sleep_time < 0 ) {
warn "$My_name: Correcting negative sleep_time to 1 sec.\n";
$sleep_time = 1;
}
elsif ( ($sleep_time < 1) && ( $sleep_time != 0 ) ) {
warn "$My_name: Correcting nonzero sleep_time of less than 1 sec to 1 sec.\n";
$sleep_time = 1;
}
elsif ( $sleep_time == 0 ) {
warn "$My_name: sleep_time was configured to zero.\n",
" Do you really want to do this? It will give 100% CPU usage.\n";
}
# Make convenient forms for lookup.
# Extensions always have period.
# Convert @generated_exts to a hash for ease of look up and deletion
# Keep extension without period!
%generated_exts_all = ();
foreach (@generated_exts ) {
$generated_exts_all{$_} = 1;
}
$quell_uptodate_msgs = $silent;
# Whether to quell informational messages when files are uptodate
# Will turn off in -pvc mode
$failure_count = 0;
@failed_primaries = ();
if ($deps_file eq '' ) {
# Standardize name used for stdout
$deps_file = '-';
}
# Since deps_file is global (common to all processed files), we must
# delete it here when doing a clean up, and not in the FILE loop, where
# per-file processing (including clean-up) is done
if ( ($cleanup_mode > 0) && $dependents_list && ( $deps_file ne '-' ) ) {
unlink_or_move( $deps_file );
}
# In non-pvc mode, the dependency list is global to all processed TeX files,
# so we open a single file here, and add items to it after processing
# each file. But in -pvc mode, the dependency list should be written
# after round of processing the single TeX file (as if each round were
# a separate run of latexmk).
# If we are cleaning up ($cleanup_mode != 0) AND NOT continuing to
# make files (--gg option and $go_mode == 2), deps_file should not be
# created.
# I will use definedness of $deps_handle as flag for global deps file having
# been opened and therefore being available to be written to after
# compiling a file.
$deps_handle = undef;
if ( $dependents_list
&& ! $preview_continuous_mode
&& ( ($cleanup_mode == 0) || ($go_mode == 2) )
) {
$deps_handle = new FileHandle "> $deps_file";
if (! $deps_handle ) {
die "Cannot open '$deps_file' for output of dependency information\n";
}
}
# Remove leading and trailing space in the following space-separated lists,
# and collapse multiple spaces to one,
# to avoid getting incorrect blank items when they are split.
foreach ($clean_ext, $clean_full_ext) { s/^\s+//; s/\s+$//; s/\s+/ /g; }
# Deal with illegal and problematic characters in filename:
test_fix_texnames( @file_list );
FILE:
foreach $filename ( @file_list )
{
# Global variables for making of current file:
$updated = 0;
$failure = 0; # Set nonzero to indicate failure at some point of
# a make. Use value as exit code if I exit.
$failure_msg = ''; # Indicate reason for failure
if ( $do_cd ) {
($filename, $path) = fileparse( $filename );
warn "$My_name: Changing directory to '$path'\n"
if !$silent;
pushd( $path );
}
else {
$path = '';
}
# Ensure the output/auxiliary directories exist, if need be
if ( $out_dir ) {
if ( ! -e $out_dir ) {
warn "$My_name: making output directory '$out_dir'\n"
if ! $silent;
make_path $out_dir;
}
elsif ( ! -d $out_dir ) {
warn "$My_name: you requested output directory '$out_dir',\n",
" but an ordinary file of the same name exists, which will\n",
" probably give an error later\n";
}
}
if ( $aux_dir && ($aux_dir ne $out_dir) ) {
# N.B. If $aux_dir and $out_dir are the same, then the -output-directory
# option is sufficient, especially because the -aux-directory exists
# only in MiKTeX, not in TeXLive.
if ( ! -e $aux_dir ) {
warn "$My_name: making auxiliary directory '$aux_dir'\n"
if ! $silent;
make_path $aux_dir;
}
elsif ( ! -d $aux_dir ) {
warn "$My_name: you requested aux directory '$aux_dir',\n",
" but an ordinary file of the same name exists, which will\n",
" probably give an error later\n";
}
}
&set_names;
# For use under error conditions:
@default_includes = ($texfile_name, $aux_main);
local %rule_db = ();
&rdb_initialize_rules;
if ( $cleanup_mode > 0 ) {
# ?? MAY NEED TO FIX THE FOLLOWING IF $aux_dir or $out_dir IS SET.
my %other_generated = ();
my @index_bibtex_generated = ();
my @aux_files = ();
my @missing_bib_files = ();
my $bibs_all_exist = 0;
my %final_output_files = ();
foreach (keys %small_cleanup_preserved_exts) {
$final_output_files{"$out_dir1$root_filename.$_"} = 1;
}
$have_fdb = 0;
if ( -e $fdb_name ) {
print "$My_name: Examining fdb file '$fdb_name' for rules ...\n"
if $diagnostics;
$have_fdb = ( 0 == rdb_read( $fdb_name ) );
}
if ( $have_fdb ) {
rdb_for_actives(
sub { # Find generated files at rule level
my ($base, $path, $ext) = fileparseA( $$Psource );
$base = $path.$base;
if ( $rule =~ /^makeindex/ ) {
push @index_bibtex_generated, $$Psource, $$Pdest, "$base.ilg";
}
elsif ( $rule =~ /^(bibtex|biber)/ ) {
push @index_bibtex_generated, $$Pdest, "$base.blg";
push @aux_files, $$Psource;
if ( $bibtex_use == 1.5) {
foreach ( keys %$PHsource ) {
if ( ( /\.bib$/ ) && (! -e $_) ) {
push @missing_bib_files, $_;
}
}
}
}
elsif ( exists $other_generated{$$Psource} ) {
# print "=========== CHECKING: source file of rule '$rule', '$$Psource'\n",
# " is a generated file.\n";
## OLD with apparent bug:
#$other_generated{$$Pdest};
}
foreach my $key (keys %$PHdest) {
$other_generated{$key} = 1;
}
},
sub { # Find generated files at source file level
if ( $file =~ /\.aux$/ ) { push @aux_files, $file; }
}
);
if ($#missing_bib_files == -1) { $bibs_all_exist = 1; }
}
elsif ( -e $log_name ) {
# No fdb file, but log file exists, so do inferior job by parse_log
print "$My_name: Examining log file '$log_name' for generated files...\n"
if $diagnostics;
# Variables set by parse_log. Can I remove them?
local %generated_log = ();
local %dependents = (); # Maps files to status. Not used here.
local @bbl_files = (); # Not used here.
local %idx_files = (); # Maps idx_file to (ind_file, base). Not used here.
local %conversions = (); # (pdf)latex-performed conversions. Not used here.
# Maps output file created and read by (pdf)latex
# to source file of conversion.
local $primary_out = ''; # Actual output file (dvi or pdf). Not used here.
local $fls_file_analyzed = 0;
&parse_log;
%other_generated = %generated_log;
}
else {
print "$My_name: No fdb or log file, so clean up default set of files ...\n"
if $diagnostics;
}
if ( ($go_mode == 2) && !$silent ) {
warn "$My_name: Removing all generated files\n" unless $silent;
}
my $keep_bbl = 1;
if ( ($bibtex_use > 1.6)
||
( ($bibtex_use == 1.5) && ($bibs_all_exist) )
) {
$keep_bbl = 0;
}
if ($keep_bbl) {
delete $generated_exts_all{'bbl'};
}
# Convert two arrays to hashes:
my %index_bibtex_generated = ();
my %aux_files = ();
my %aux_files_to_save = ();
foreach (@index_bibtex_generated) {
$index_bibtex_generated{$_} = 1
unless ( /\.bbl$/ && ($keep_bbl) );
delete( $other_generated{$_} );
}
foreach (@aux_files) {
if (exists $other_generated{$_} ) {
$aux_files{$_} = 1;
}
else {
$aux_files_to_save{$_} = 1;
}
}
foreach (keys %final_output_files) { delete $other_generated{$_}; }
if ($diagnostics) {
show_array( "For deletion, the following were determined from fdb file or log file:\n"
." Generated (from makeindex and bibtex):",
keys %index_bibtex_generated );
show_array( " Aux files:", keys %aux_files );
show_array( " Other generated files:\n"
." (only deleted if \$cleanup_includes_generated is set): ",
keys %other_generated );
show_array( " Yet other generated files are specified by patterns:\n".
" Explicit pattern with %R or root-filename.extension:",
keys %generated_exts_all );
show_array( " Aux files to SAVE and not delete:", keys %aux_files_to_save );
}
my @clean_args = ( 'blg', 'ilg', 'log', 'aux.bak', 'idx.bak',
split('\s+',$clean_ext), keys %generated_exts_all );
cleanup1( $aux_dir1, @clean_args );
if ( $out_dir1 ne $aux_dir1 ) { cleanup1( $out_dir1, @clean_args ); }
if ( $cleanup_mode == 1 ) {
my @clean_args = ( keys %small_cleanup_preserved_exts, split('\s+', $clean_full_ext) );
cleanup1( $aux_dir1, @clean_args );
if ( $out_dir1 ne $aux_dir1 ) { cleanup1( $out_dir1, @clean_args ); }
}
unlink_or_move( 'texput.log', "texput.aux", "missfont.log",
keys %index_bibtex_generated,
keys %aux_files );
if ($cleanup_includes_generated) {
unlink_or_move( keys %other_generated );
}
if ( $cleanup_includes_cusdep_generated) {
&cleanup_cusdep_generated;
}
}
if ($cleanup_fdb) {
unlink_or_move( $fdb_name );
# If the fdb file exists, it will have been read, and therefore changed
# rule database. But deleting the fdb file implies we also want
# a virgin rule database, so we must reset it:
&rdb_initialize_rules;
}
if ($cleanup_only) { next FILE; }
if ( $diagnostics ) {
print "$My_name: Rules after start up for '$texfile_name'\n";
rdb_show();
}
$have_fdb = 0;
if (! -e $aux_main ) {
# No aux file => set up trivial aux file
# and corresponding fdb_file. Arrange them to provoke one run
# as minimum, but no more if actual aux file is trivial.
# (Useful on big files without cross references.)
# If aux file doesn't exist, then any fdb file is surely
# wrong.
# Previously, I had condition for this as being both aux and
# fdb files failing to exist. But it's not obvious what to
# do if aux exists and fdb doesn't. So I won't do anything.
&set_trivial_aux_fdb;
}
if ( -e $fdb_name ) {
$rdb_errors = rdb_read( $fdb_name );
$have_fdb = ($rdb_errors == 0);
}
if (!$have_fdb) {
# We didn't get a valid set of data on files used in
# previous run. So use filetime criterion for make
# instead of change from previous run, until we have
# done our own make.
rdb_recurse( [keys %possible_primaries],
sub{ if ( $$Ptest_kind == 1 ) { $$Ptest_kind = 3;} }
);
if ( -e $log_name ) {
rdb_for_some( [keys %possible_primaries], \&rdb_set_latex_deps );
}
}
foreach $rule ( &rdb_accessible ) {
# For all source files of all accessible rules,
# if the file data are not already set (e.g., from fdb_latexmk
# file, set them from disk.
rdb_one_rule ($rule, undef,
sub{ if ( $$Ptime == 0) { &rdb_update1; } }
);
}
if ($go_mode) {
# Force everything to be remade.
rdb_recurse( [ &rdb_target_array], sub{$$Pout_of_date=1;} );
}
if ( $diagnostics ) {
print "$My_name: Rules after initialization\n";
rdb_show();
}
#************************************************************
if ( $preview_continuous_mode ) {
&make_preview_continuous;
next FILE;
}
## Handling of failures:
## Variable $failure is set to indicate a failure, with information
## put in $failure_msg.
## These variables should be set to 0 and '' at any point at which it
## should be assumed that no failures have occurred.
## When after a routine is called it is found that $failure is set, then
## processing should normally be aborted, e.g., by return.
## Then there is a cascade of returns back to the outermost level whose
## responsibility is to handle the error.
## Exception: An outer level routine may reset $failure and $failure_msg
## after initial processing, when the error condition may get
## ameliorated later.
#Initialize failure flags now.
$failure = 0;
$failure_msg = '';
$failure = &rdb_make;
if ( ( $failure <= 0 ) || $force_mode ) {
rdb_for_some( [keys %one_time], \&rdb_run1 );
}
if ($#primary_warning_summary > -1) {
# N.B. $mult_defined, $bad_reference, $bad_character, $bad_citation also available here.
if ($warnings_as_errors) {
$failure = 1;
$failure_msg = "Warning(s) from latex (or c.) for '$filename'; treated as error";
}
}
if ($failure > 0) { next FILE; }
} # end FILE
continue {
if ($deps_handle) { deps_list($deps_handle); }
# If requested, print the list of rules. But don't do this in -pvc
# mode, since the rules list has already been printed.
if ($rules_list && ! $preview_continuous_mode) { rdb_list(); }
# Handle any errors
$error_message_count = rdb_show_rule_errors();
if ( ($error_message_count == 0) || ($failure > 0) ) {
if ( $failure_msg ) {
#Remove trailing space
$failure_msg =~ s/\s*$//;
warn "----------------------\n";
warn "This message may duplicate earlier message.\n";
warn "$My_name: Failure in processing file '$filename':\n",
" $failure_msg\n";
warn "----------------------\n";
$failure = 1;
}
}
if ( ($failure > 0) || ($error_message_count > 0) ) {
$failure_count ++;
push @failed_primaries, $filename;
}
&ifcd_popd;
}
close($deps_handle) if ( $deps_handle );
if ($show_time) { show_timing();}
sub show_timing {
my $processing_time = processing_time() - $processing_time1;
print @timings, "Accumulated processing time = $processing_time\n";
@timings = ();
$processing_time1 = processing_time();
}
# If we get here without going through the continue section:
if ( $do_cd && ($#dir_stack > -1) ) {
# Just in case we did an abnormal exit from the loop
warn "$My_name: Potential bug: dir_stack not yet unwound, undoing all directory changes now\n";
&finish_dir_stack;
}
if ($failure_count > 0) {
if ( $#file_list > 0 ) {
# Error occured, but multiple files were processed, so
# user may not have seen all the error messages
warn "\n------------\n";
show_array(
"$My_name: Some operations failed, for the following tex file(s)",
@failed_primaries);
}
if ( !$force_mode ) {
warn "$My_name: Use the -f option to force complete processing,\n",
" unless error was exceeding maximum runs, or warnings treated as errors.\n";
}
exit 12;
}
if ( $where_log == 2 ) {
warn "$My_name: You requested aux_dir '$aux_dir_requested',\n".
" but '$aux_dir' was used by the (pdf)latex engine.\n".
" That indicates a configuration error.\n";
if ( ($tex_distribution !~ /^MiKTeX/i) && ($aux_dir_requested ne $out_dir_requested) ) {
warn " Probably you set different aux and out directories,\n".
" but that is not supported by your TeX distribution.\n".
" The only current distribution supporting this is MiKTeX.\n";
}
}
# end MAIN PROGRAM
#############################################################
#############################################################
sub set_tex_cmds {
# Usage, e.g., set_tex_cmds( '%O %S' )
my $args = $_[0];
foreach my $cmd ('latex', 'lualatex', 'pdflatex', 'xelatex' ) {
${$cmd} = "$cmd $args";
}
# N.B. See setting of $latex_default_switches, ...,
# $xelatex_default_switches, etc, for any special options needed.
}
sub std_tex_cmds { set_tex_cmds( '%O %S' ); }
sub alt_tex_cmds { set_tex_cmds( '%O %P' ); }
#========================
sub test_fix_texnames {
my $illegal_char = 0;
my $unbalanced_quote = 0;
my $balanced_quote = 0;
foreach (@_) {
if ( $^O eq "MSWin32" ) {
# On MS-Win, change directory separator '\' to '/', as needed
# by the TeX engines, for which '\' introduces a macro name.
# Remember that '/' is a valid directory separator in MS-Win.
s[\\][/]g;
}
if ($do_cd) {
my ($filename, $path) = fileparse( $_ );
if ($filename =~ /[\Q$illegal_in_texname\E]/ ) {
$illegal_char++;
warn "$My_name: Filename '$filename' contains character not allowed for TeX file.\n";
}
if ($filename =~ /^&/) {
$illegal_char++;
warn "$My_name: Filename '$filename' contains initial '&', which is\n",
" not allowed for TeX file.\n";
}
}
else {
if ( /[\Q$illegal_in_texname\E]/ ) {
$illegal_char++;
warn "$My_name: Filename '$_' contains character not allowed for TeX file.\n";
}
if (/^&/ ) {
$illegal_char++;
warn "$My_name: Filename '$_' contains initial '&', which is not allowed\n",
" for TeX file.\n";
}
}
my $count_q = ($_ =~ tr/\"//);
if ( ($count_q % 2) != 0 ) {
warn "$My_name: Filename '$_' contains unbalanced quotes, not allowed.\n";
$unbalanced_quote++;
}
elsif ( $count_q > 0 ) {
warn "$My_name: Removed (balanced quotes) from filename '$_',\n";
s/\"//g;
warn " and obtained '$_'.\n";
$balanced_quote++;
}
}
if ($illegal_char || $unbalanced_quote) {
die "$My_name: Stopping because of bad filename(s).\n";
}
}
#############################################################
sub ensure_path {
# Usage: ensure_path( $var, values ...)
# $ENV{$var} is an environment variable (e.g. $ENV{TEXINPUTS}.
# Ensure the values are in it, prepending them if not, and
# creating the environment variable if it doesn't already exist.
my $var = shift;
my %cmpts = ();
if ( exists $ENV{$var} ) {
foreach ( split $search_path_separator, $ENV{$var} ) {
if ($_ ne '') { $cmpts{$_} = 1; }
}
}
foreach (@_) {
next if ( ($_ eq '') || (exists $cmpts{$_}) );
if (exists $ENV{$var}) {
$ENV{$var} = $_ . $search_path_separator . $ENV{$var};
}
else {
$ENV{$var} = $_ . $search_path_separator;
}
}
}
#############################################################
sub set_dirs_etc {
# Normalize versions terminating in directory/path separator
# and versions referring to current directory
# These actions in a subroutine so they can be used elsewhere.
$out_dir1 = $out_dir;
$aux_dir1 = $aux_dir;
foreach ( $aux_dir1, $out_dir1 ) {
if ( ($_ ne '') && ! m([\\/\:]$) ) {
$_ .= '/';
}
while ( s[^\.\/][] ) {}
}
if ($aux_dir) {
# Ensure $aux_dir is in BIBINPUTS and TEXINPUTS search paths.
# TEXINPUTS is used by dvips for files generated by mpost.
# For BIBINPUTS,
# at least one widely package (revtex4-1) generates a bib file
# (which is used in revtex4-1 for putting footnotes in the reference
# list), and bibtex must be run to use it. But latexmk needs to
# determine the existence of the bib file by use of kpsewhich, otherwise
# there is an error. So cope with this situation (and any analogous
# cases by adding the aux_dir to the relevant path search environment
# variables. BIBINPUTS seems to be the only one currently affected.
foreach ( 'BIBINPUTS', 'TEXINPUTS' ) {
ensure_path( $_, $aux_dir );
}
}
}
#############################################################
sub fix_cmds {
# If commands do not have placeholders for %S etc, put them in
foreach ($latex, $lualatex, $pdflatex, $xelatex, $lpr, $lpr_dvi, $lpr_pdf,
$pdf_previewer, $ps_previewer, $ps_previewer_landscape,
$dvi_previewer, $dvi_previewer_landscape,
$kpsewhich
) {
# Source only
if ( $_ && ! /%/ ) { $_ .= " %O %S"; }
}
foreach ($pdf_previewer, $ps_previewer, $ps_previewer_landscape,
$dvi_previewer, $dvi_previewer_landscape,
) {
# Run previewers detached
if ( $_ && ! /^(nostart|NONE|internal) / ) {
$_ = "start $_";
}
}
foreach ($biber, $bibtex) {
# Base only
if ( $_ && ! /%/ ) { $_ .= " %O %B"; }
}
foreach ($dvipdf, $ps2pdf) {
# Source and dest without flag for destination
if ( $_ && ! /%/ ) { $_ .= " %O %S %D"; }
}
foreach ($dvips, $makeindex) {
# Source and dest with -o dest before source
if ( $_ && ! /%/ ) { $_ .= " %O -o %D %S"; }
}
foreach ($dvi_filter, $ps_filter) {
# Source and dest, but as filters
if ( $_ && ! /%/ ) { $_ .= " %O <%S >%D"; }
}
} #END fix_cmds
#############################################################
sub add_option {
# Call add_option( $opt, \$cmd ... )
# Add option to one or more commands
my $option = shift;
while (@_) {
if ( ${$_[0]} !~ /%/ ) { &fix_cmds; }
${$_[0]} =~ s/%O/$option %O/;
shift;
}
} #END add_option
#############################################################
sub rdb_initialize_rules {
# Initialize rule database.
# (The rule database may get overridden/extended after the fdb_latexmk
# file is read, and after running commands to adjust to dependencies
# determined from document.
%rule_db = ();
%target_rules = ();
%target_files = ();
local %rule_list = ();
&rdb_set_rule_templates;
my %rule_template = %rule_list;
while ( my ($key, $value) = each %extra_rule_spec ) {
$rule_template{$key} = $value;
}
foreach my $rule ( keys %rule_template ) {
my ( $cmd_type, $ext_cmd, $int_cmd, $source, $dest, $base, $test_kind, $PA_extra_gen ) = @{$rule_template{$rule}};
if ( ! $PA_extra_gen ) { $PA_extra_gen = []; }
my $needs_making = 0;
# Substitute in the filename variables, since we will use
# those for determining filenames. But delay expanding $cmd
# until run time, in case of changes.
foreach ($base, $source, $dest, @$PA_extra_gen ) {
s/%R/$root_filename/g;
s/%Y/$aux_dir1/;
s/%Z/$out_dir1/;
}
foreach ($source, $dest ) {
s/%B/$base/;
s/%T/$texfile_name/;
}
rdb_create_rule( $rule, $cmd_type, $ext_cmd, $int_cmd, $test_kind,
$source, $dest, $base,
$needs_making, undef, undef, 1, $PA_extra_gen );
} # End rule iteration
# Ensure we only have one way to make pdf file, and that it is appropriate. Remove other incompatibilities
if ($pdf_mode == 1) { rdb_deactivate( 'dvipdf', 'ps2pdf', 'latex', 'lualatex', 'xdvipdfmx', 'xelatex' ); }
elsif ($pdf_mode == 2) { rdb_deactivate( 'dvipdf', 'pdflatex', 'lualatex', 'xdvipdfmx', 'xelatex' ); }
elsif ($pdf_mode == 3) { rdb_deactivate( 'pdflatex', 'ps2pdf', 'lualatex', 'xdvipdfmx', 'xelatex' ); }
elsif ($pdf_mode == 4) { rdb_deactivate( 'pdflatex', 'ps2pdf', 'dvipdf', 'xdvipdfmx', 'xelatex' ); }
elsif ($pdf_mode == 5) { rdb_deactivate( 'pdflatex', 'ps2pdf', 'dvipdf', 'lualatex' ); }
else { rdb_deactivate( 'dvipdf', 'pdflatex', 'ps2pdf', 'lualatex', 'xdvipdfmx', 'xelatex' ); }
if ($dvi_mode == 1) {
rdb_activate( 'latex' );
$target_files{$dvi_final} = 1;
}
if ($postscript_mode == 1) {
rdb_activate( 'latex' );
$target_files{$ps_final} = 1;
}
if ($pdf_mode) { $target_files{$pdf_final} = 1; }
&rdb_set_rule_net;
} # END rdb_initialize_rules
#************************************************************
sub rdb_set_rule_templates {
# Set up specifications for standard rules, adjusted to current conditions
# Substitutions: %S = source, %D = dest, %B = this rule's base
# %T = texfile, %R = root = base for latex.
# %Y for $aux_dir1, %Z for $out_dir1
my $print_file = '';
my $print_cmd = 'NONE';
if ( $print_type eq 'dvi' ) {
$print_file = $dvi_final;
$print_cmd = $lpr_dvi;
}
elsif ( $print_type eq 'pdf' ) {
$print_file = $pdf_final;
$print_cmd = $lpr_pdf;
}
elsif ( $print_type eq 'ps' ) {
$print_file = $ps_final;
$print_cmd = $lpr;
}
elsif ( $print_type eq 'none' ) {
$print_cmd = 'NONE echo NO PRINTING CONFIGURED';
}
my $view_file = '';
my $viewer = '';
my $viewer_update_method = 0;
my $viewer_update_signal = undef;
my $viewer_update_command = undef;
if ( ($view eq 'dvi') || ($view eq 'pdf') || ($view eq 'ps') ) {
$view_file = ${$view.'_final'};
$viewer = ${$view.'_previewer'};
$viewer_update_method = ${$view.'_update_method'};
$viewer_update_signal = ${$view.'_update_signal'};
if (defined ${$view.'_update_command'}) {
$viewer_update_command = ${$view.'_update_command'};
}
}
# Specification of internal command for viewer update:
my $PA_update = ['do_update_view', $viewer_update_method, $viewer_update_signal, 0, 1];
# For test_kind: Use file contents for latex and friends, but file time for the others.
# This is because, especially for dvi file, the contents of the file may contain
# a pointer to a file to be included, not the contents of the file!
%rule_list = (
'latex' => [ 'primary', "$latex", '', "%T", $dvi_name, "%R", 1, [$log_name] ],
'pdflatex' => [ 'primary', "$pdflatex", '', "%T", $pdf_name, "%R", 1, [$log_name] ],
'lualatex' => [ 'primary', "$lualatex", '', "%T", $pdf_name, "%R", 1, [$log_name] ],
'xelatex' => [ 'primary', "$xelatex", '', "%T", $xdv_name, "%R", 1, [$log_name] ],
'dvipdf' => [ 'external', "$dvipdf", 'do_viewfile', $dvi_final, $pdf_name, "%Z%R", 2 ],
'xdvipdfmx' => [ 'external', "$xdvipdfmx", 'do_viewfile', $xdv_final, $pdf_name, "%Z%R", 2 ],
'dvips' => [ 'external', "$dvips", 'do_viewfile', $dvi_final, $ps_name, "%Z%R", 2 ],
'dvifilter' => [ 'external', $dvi_filter, 'do_viewfile', $dvi_name, $dviF_name, "%Z%R", 2 ],
'ps2pdf' => [ 'external', "$ps2pdf", 'do_viewfile', $ps_final, $pdf_name, "%Z%R", 2 ],
'psfilter' => [ 'external', $ps_filter, 'do_viewfile', $ps_name, $psF_name, "%Z%R", 2 ],
'print' => [ 'external', "$print_cmd", 'if_source', $print_file, "", "", 2 ],
'update_view' => [ 'external', $viewer_update_command, $PA_update,
$view_file, "", "", 2 ],
'view' => [ 'external', "$viewer", 'if_source', $view_file, "", "", 2 ],
);
} # END rdb_set_rule_templates
#************************************************************
sub rdb_set_rule_net {
# Set network of rules, including links
&rdb_make_links;
&rdb_classify_rules;
}
#************************************************************
sub rdb_make_links {
# ?? Problem if there are multiple rules for getting a file. Notably pdf.
# Which one to choose?
# ?? Problem: what if a rule is inactive,
# e.g., bibtex because biber is in use,
# or xelatex when pdflatex is in use
# or bibtex when $bibtex_use is 0.
# What if both latex and pdflatex are being used?
# That has been allowed. But .aux file (also
# .log file) are made by both.
# Other case: package (like bibtopic) creates bbl or other file when
# it doesn't exist. Later a rule is created by latexmk to make that
# file. Then the rule's main destination file should have priority
# over non-main generated files from other rules.
&rdb_cache_generated;
rdb_for_actives(
0,
sub{
if ( exists $from_rules_main{$file} ) {
$$Pfrom_rule = $from_rules_main{$file};
}
elsif ( exists $from_rules{$file} ) {
$$Pfrom_rule = $from_rules{$file};
}
if ( $$Pfrom_rule && (! rdb_rule_exists( $$Pfrom_rule ) ) ) {
$$Pfrom_rule = '';
}
}
);
# &rdb_show;
} # END rdb_make_links
#************************************************************
sub rdb_cache_generated {
# Update %from_rules
%from_rules = ();
%from_rules_main = ();
rdb_for_actives( \&one_from_main_rule_cache );
rdb_for_actives( \&one_from_rule_cache );
} # END rdb_cache_generated
#------------
sub one_from_main_rule_cache {
# Rule context assumed.
# Set from_rules_main items for one rule
if (! $$Pdest) { return; }
# Error message trigger: if ( $$Pdest =~ /pdf$/) { $from_rules_main{$$Pdest} = 'pdflatexA'; }
if ( exists $from_rules_main{$$Pdest} ) {
my $old_rule = $from_rules_main{$$Pdest};
if ( $old_rule eq $rule ) {
# OK
}
else {
warn "$My_name: Possible bug:\n",
" In linking rules I already set from_rules_main{$$Pdest} to '$old_rule'\n",
" But now I want to set it to '$rule'\n";
#???? traceback();
}
}
$from_rules_main{$$Pdest} = $rule;
} # END one_from_main_rule_cache
#------------
sub one_from_rule_cache {
# Rule context assumed.
# Set from_rules items for one rule
foreach ( @$PA_extra_gen, keys %$PHdest ) {
# Error message trigger: if ( $_ =~ /aux$/) { $from_rules{$_} = 'pdflatexA'; }
if ( exists $from_rules{$_} ) {
my $old_rule = $from_rules{$_};
if ( $old_rule eq $rule ) {
# OK
}
elsif ( exists $from_rules_main{$_} && ( $from_rules_main{$_} ne $rule ) ) {
warn "$My_name: Possible problem:\n",
" In linking rules, I already set from_rules_main{$_}\n".
" to '$from_rules_main{$_}'\n",
" But now I also have a different rule '$rule' that also made the file.\n";
}
elsif ( exists($possible_primaries{$old_rule}) && exists($possible_primaries{$rule}) ) {
# This could be problematic. But we'll let it go,
# because it is a common case for .aux and .log files
# (etc), and these cases do not appear to mess up
# anything (by experience).
# Once we allow an active flag for rules and only
# examine active rules, the only case of this that
# will appear (in the absence of other problems) will
# be where two primary rules are active, notably a
# latex rule to make dvi and a pdflatex (or other
# rule) to make pdf.
}
else {
warn "$My_name: Possible bug:\n",
" In linking rules I already set from_rules{$_} to '$old_rule'\n",
" But now I want to set it to '$rule'\n";
#???? traceback();
}
}
$from_rules{$_} = $rule;
}
} #END from_rule_cache
#************************************************************
sub set_trivial_aux_fdb {
# 1. Write aux file EXACTLY as would be written if the tex file
# had no cross references, etc. I.e., a minimal .aux file.
# 2. Write a corresponding fdb file
# 3. Provoke a run of (pdf)latex (actually of all primaries).
local *aux_file;
open( aux_file, '>', $aux_main )
or die "Cannot write file '$aux_main'\n";
print aux_file "\\relax \n";
close(aux_file);
foreach my $rule (keys %possible_primaries ) {
rdb_ensure_file( $rule, $texfile_name );
rdb_ensure_file( $rule, $aux_main );
rdb_one_rule( $rule,
sub{ $$Pout_of_date = 1; }
);
}
&rdb_write( $fdb_name );
} #END set_trivial_aux_fdb
#************************************************************
#### Particular actions
#************************************************************
#************************************************************
sub do_cusdep {
# Unconditional application of custom-dependency
# except that rule is not applied if the source file source
# does not exist, and an error is returned if the dest is not made.
#
# Assumes rule context for the custom-dependency, and that my first
# argument is the name of the subroutine to apply
my $func_name = $_[0];
my $return = 0;
if ( !-e $$Psource ) {
# Source does not exist. Users of this rule will need to turn
# it off when custom dependencies are reset
if ( !$silent ) {
## ??? Was commented out. 1 Sep. 2008 restored, for cusdep no-file-exists issue
warn "$My_name: In trying to apply custom-dependency rule\n",
" to make '$$Pdest' from '$$Psource'\n",
" the source file has disappeared since the last run\n";
}
# Treat as successful
}
elsif ( !$func_name ) {
warn "$My_name: Possible misconfiguration or bug:\n",
" In trying to apply custom-dependency rule\n",
" to make '$$Pdest' from '$$Psource'\n",
" the function name is blank.\n";
}
elsif ( ! defined &$func_name ) {
warn "$My_name: Misconfiguration or bug,",
" in trying to apply custom-dependency rule\n",
" to make '$$Pdest' from '$$Psource'\n",
" function name '$func_name' does not exists.\n";
}
else {
my $cusdep_ret = &$func_name( $$Pbase );
if ( defined $cusdep_ret && ($cusdep_ret != 0) ) {
$return = $cusdep_ret;
if ($return) {
warn "Rule '$rule', function '$func_name'\n",
" failed with return code = $return\n";
}
}
elsif ( !-e $$Pdest ) {
# Destination non-existent, but routine failed to give an error
warn "$My_name: In running custom-dependency rule\n",
" to make '$$Pdest' from '$$Psource'\n",
" function '$func_name' did not make the destination.\n";
$return = -1;
}
}
return $return;
} # END do_cusdep
#************************************************************
sub do_viewfile {
# Unconditionally make file for viewing, going through temporary file if
# Assumes rule context
my $return = 0;
my ($base, $path, $ext) = fileparseA( $$Pdest );
if ( &view_file_via_temporary ) {
if ( $$Pext_cmd =~ /%D/ ) {
my $tmpfile = tempfile1( "${root_filename}_tmp", $ext );
warn "$My_name: Making '$$Pdest' via temporary '$tmpfile'...\n";
$return = &Run_subst( undef, undef, undef, undef, $tmpfile );
move( $tmpfile, $$Pdest );
}
else {
warn "$My_name is configured to make '$$Pdest' via a temporary file\n",
" but the command template '$$Pext_cmd' does not have a slot\n",
" to set the destination file, so I won't use a temporary file\n";
$return = &Run_subst();
}
}
else {
$return = &Run_subst();
}
return $return;
} #END do_viewfile
#************************************************************
sub do_update_view {
# Update viewer
# Assumes rule context
# Arguments: (method, signal, viewer_process)
my $return = 0;
# Although the process is passed as an argument, we'll need to update it.
# So (FUDGE??) bypass the standard interface for the process.
# We might as well do this for all the arguments.
my $viewer_update_method = ${$PAint_cmd}[1];
my $viewer_update_signal = ${$PAint_cmd}[2];
my $Pviewer_process = \${$PAint_cmd}[3];
my $Pneed_to_get_viewer_process = \${$PAint_cmd}[4];
if ($viewer_update_method == 2) {
if ($$Pneed_to_get_viewer_process) {
$$Pviewer_process = &find_process_id( $$Psource );
if ($$Pviewer_process != 0) {
$$Pneed_to_get_viewer_process = 0;
}
}
if ($$Pviewer_process == 0) {
print "$My_name: need to signal viewer for file '$$Psource', but didn't get \n",
" process ID for some reason, e.g., no viewer, bad configuration, bug\n"
if $diagnostics ;
}
elsif ( defined $viewer_update_signal) {
print "$My_name: signalling viewer, process ID $$Pviewer_process ",
"with signal $viewer_update_signal\n"
if $diagnostics ;
kill $viewer_update_signal, $$Pviewer_process;
}
else {
warn "$My_name: viewer is supposed to be sent a signal\n",
" but no signal is defined. Misconfiguration or bug?\n";
$return = 1;
}
}
elsif ($viewer_update_method == 4) {
if (defined $$Pext_cmd) {
$return = &Run_subst();
}
else {
warn "$My_name: viewer is supposed to be updated by running a command,\n",
" but no command is defined. Misconfiguration or bug?\n";
}
}
return $return;
} #END do_update_view
#************************************************************
sub if_source {
# Unconditionally apply rule if source file exists.
# Assumes rule context
if ( -e $$Psource ) {
return &Run_subst();
}
else {
warn "Needed source file '$$Psource' does not exist.\n";
return -1;
}
} #END if_source
#************************************************************
#### Subroutines
#************************************************************
#************************************************************
sub find_basename {
# Finds the basename of the root file
# Arguments:
# 1 - Filename to breakdown
# 2 - Where to place base file
# 3 - Where to place tex file
# Returns non-zero if tex file does not exist
#
# The rules for determining this depend on the implementation of TeX.
# The variable $extension_treatment determines which rules are used.
# !!!!!!!! I still need to implement use of kpsewhich to match behavior
# of (pdf)latex correctly.
local($given_name, $base_name, $ext, $path, $tex_name);
$given_name = $_[0];
if ( "$extension_treatment" eq "miktex_old" ) {
# Miktex v. 1.20d:
# 1. If the filename has an extension, then use it.
# 2. Else append ".tex".
# 3. The basename is obtained from the filename by
# removing the path component, and the extension, if it
# exists. If a filename has a multiple extension, then
# all parts of the extension are removed.
# 4. The names of generated files (log, aux) are obtained by
# appending .log, .aux, etc to the basename. Note that
# these are all in the CURRENT directory, and the drive/path
# part of the originally given filename is ignored.
#
# Thus when the given filename is "\tmp\a.b.c", the tex
# filename is the same, and the basename is "a".
($base_name, $path, $ext) = fileparse( $given_name, '\..*' );
if ( "$ext" eq "") { $tex_name = "$given_name.tex"; }
else { $tex_name = $given_name; }
$_[1] = $base_name;
$_[2] = $tex_name;
}
elsif ( "$extension_treatment" eq "unix" ) {
# unix (at least TeXLive 2016) =>
# A. Finding of tex file:
# 1. If filename.tex exists, use it,
# 2. else if kpsewhich finds filename.tex, use it
# 3. else if filename exists, use it,
# 4. else if kpsewhich finds filename, use it.
# (Probably can unify the above by
# 1'. If kpsewhich finds filename.tex, use result.
# 2'. else if kpsewhich finds filename, use result.
# 3'. else report file not found.
# B. The base filename is obtained by deleting the path
# component and, if an extension exists, the last
# component of the extension, even if the extension is
# null. (A name ending in "." has a null extension.)
# C. The names of generated files (log, aux) are obtained by
# appending .log, .aux, etc to the basename. Note that
# these are all in the CURRENT directory, and the drive/path
# part of the originally given filename is ignored.
#
# Thus when the given filename is "/tmp/a.b.c", there are two
# cases:
# a. /tmp/a.b.c.tex exists. Then this is the tex file,
# and the basename is "a.b.c".
# b. /tmp/a.b.c.tex does not exist. Then the tex file is
# "/tmp/a.b.c", and the basename is "a.b".
# But there are also modifications of this when a file can be
# found by kpsewhich.
if ( -f "$given_name.tex" ) {
$tex_name = "$given_name.tex";
}
else {
$tex_name = "$given_name";
}
($base_name, $path, $ext) = fileparse( $tex_name, '\.[^\.]*' );
$_[1] = $base_name;
$_[2] = $tex_name;
}
else {
die "$My_name: Incorrect configuration gives \$extension_treatment=",
"'$extension_treatment'\n";
}
if ($diagnostics) {
print "Given='$given_name', tex='$tex_name', base='$base_name'\n";
}
return ! -e $tex_name;
} #END find_basename
#************************************************************
sub make_preview_continuous {
local @changed = ();
local @changed_user = ();
local @disappeared = ();
local @no_dest = (); # Non-existent destination files
local @rules_never_run = ();
local @rules_to_apply = ();
local $failure = 0;
local %rules_applied = ();
local $updated = 0;
print "======= Need to update make_preview_continuous for target files\n";
$quell_uptodate_msgs = 1;
local $view_file = '';
rdb_one_rule( 'view', sub{ $view_file = $$Psource; } );
if ( ($view eq 'dvi') || ($view eq 'pdf') || ($view eq 'ps') ) {
warn "Viewing $view\n";
}
elsif ( $view eq 'none' ) {
warn "Not using a previewer\n";
$view_file = '';
}
else {
warn "$My_name: BUG: Invalid preview method '$view'\n";
exit 20;
}
my $viewer_running = 0; # No viewer known to be running yet
# Get information from update_view rule
local $viewer_update_method = 0;
# Pointers so we can update the following:
local $Pviewer_process = undef;
local $Pneed_to_get_viewer_process = undef;
rdb_one_rule( 'update_view',
sub{ $viewer_update_method = $$PAint_cmd[1];
$Pviewer_process = \$$PAint_cmd[3];
$Pneed_to_get_viewer_process = \$$PAint_cmd[4];
}
);
# Note that we don't get the previewer process number from the program
# that starts it; that might only be a script to get things set up and the
# actual previewer could be (and sometimes IS) another process.
if ( ($view_file ne '') && (-e $view_file) && !$new_viewer_always ) {
# Is a viewer already running?
# (We'll save starting up another viewer.)
$$Pviewer_process = &find_process_id( $view_file );
if ( $$Pviewer_process ) {
warn "$My_name: Previewer is already running\n"
if !$silent;
$viewer_running = 1;
$$Pneed_to_get_viewer_process = 0;
}
}
# Loop forever, rebuilding .dvi and .ps as necessary.
# Set $first_time to flag first run (to save unnecessary diagnostics)
my $last_action_time = time();
my $timed_out = 0;
CHANGE:
for (my $first_time = 1; 1; $first_time = 0 ) {
my %rules_to_watch = array_to_hash( &rdb_accessible );
$updated = 0;
$failure = 0;
$failure_msg = '';
if ( $MSWin_fudge_break && ($^O eq "MSWin32") ) {
# Fudge under MSWin32 ONLY, to stop perl/latexmk from
# catching ctrl/C and ctrl/break, and let it only reach
# downstream programs. See comments at first definition of
# $MSWin_fudge_break.
$SIG{BREAK} = $SIG{INT} = 'IGNORE';
}
if ($compiling_cmd) {
Run_subst( $compiling_cmd );
}
$failure = &rdb_make;
## warn "=========Viewer PID = $$Pviewer_process; updated=$updated\n";
if ( $MSWin_fudge_break && ($^O eq "MSWin32") ) {
$SIG{BREAK} = $SIG{INT} = 'DEFAULT';
}
# Start viewer if needed.
if ( ($failure > 0) && (! $force_mode) ) {
# No viewer yet
}
elsif ( ($view_file ne '') && (-e $view_file) && $updated && $viewer_running ) {
# A viewer is running. Explicitly get it to update screen if we have to do it:
rdb_one_rule( 'update_view', \&rdb_run1 );
}
elsif ( ($view_file ne '') && (-e $view_file) && !$viewer_running ) {
# Start the viewer
if ( !$silent ) {
if ($new_viewer_always) {
warn "$My_name: starting previewer for '$view_file'\n",
"------------\n";
}
else {
warn "$My_name: I have not found a previewer that ",
"is already running. \n",
" So I will start it for '$view_file'\n",
"------------\n";
}
}
local $retcode = 0;
rdb_one_rule( 'view', sub { $retcode = &rdb_run1;} );
if ( $retcode != 0 ) {
if ($force_mode) {
warn "$My_name: I could not run previewer\n";
}
else {
&exit_msg1( "I could not run previewer", $retcode);
}
}
else {
$viewer_running = 1;
$$Pneed_to_get_viewer_process = 1;
} # end analyze result of trying to run viewer
} # end start viewer
if ( $failure > 0 ) {
if ( !$failure_msg ) {
$failure_msg = 'Failure to make the files correctly';
}
&rdb_set_rule_net;
%rules_to_watch = array_to_hash( &rdb_accessible );
# There will be files changed during the run that are irrelevant.
# We need to wait for the user to change the files.
# So set the GENERATED files from (pdf)latex as up-to-date:
rdb_for_some( [keys %current_primaries], \&rdb_update_gen_files );
# And don't watch for changes for post_primary rules (ps and pdf
# from dvi, etc haven't been run after an error in (pdf)latex, so
# are out-of-date by filetime criterion, but they should not be run
# until after another (pdf)latex run:
foreach (@post_primary) { delete $rules_to_watch{$_}; }
$failure_msg =~ s/\s*$//; #Remove trailing space
warn "$My_name: $failure_msg\n",
" ==> You will need to change a source file before I do another run <==\n";
if ($failure_cmd) {
Run_subst( $failure_cmd );
}
}
else {
if ( ($#primary_warning_summary > -1) && $warning_cmd ) {
Run_subst( $warning_cmd );
}
elsif ( ($#primary_warning_summary > -1) && $warnings_as_errors && $failure_cmd ) {
Run_subst( $failure_cmd );
}
elsif ($success_cmd) {
Run_subst( $success_cmd );
}
}
rdb_show_rule_errors();
if ($rules_list) { rdb_list(); }
if ($show_time && ! $first_time) { show_timing(); }
if ( $dependents_list && ($updated || $failure) ) {
my $deps_handle = new FileHandle "> $deps_file";
if ( defined $deps_handle ) {
deps_list($deps_handle);
close($deps_handle);
}
else {
warn "Cannot open '$deps_file' for output of dependency information\n";
}
}
# Now wait for a file to change...
&rdb_cache_generated;
# During waiting for file changes, handle ctrl/C and ctrl/break here,
# rather than letting system handle them by terminating script (and
# code in the following command line to work: any script that calls
# it). This allows, for example, the command cleanup in the following
# command line to work:
# latexmk -pvc foo; cleanup;
&catch_break;
$have_break = 0;
$last_action_time = time();
$waiting = 1;
print "\n=== Watching for updated files. Use ctrl/C to stop ...\n";
WAIT: while (1) {
sleep( $sleep_time );
if ($have_break) { last WAIT; }
if ( rdb_user_changes(keys %rules_to_watch) ) {
if (!$silent) {
warn "$My_name: Need to remake files.\n";
&rdb_diagnose_changes( ' ' );
}
last WAIT;
}
# Don't count waiting time in processing:
$processing_time1 = processing_time();
# Does this do this job????
local $new_files = 0;
rdb_for_some( [keys %current_primaries], sub{ $new_files += &rdb_find_new_files } );
if ($new_files > 0) {
warn "$My_name: New file(s) found.\n";
last WAIT;
}
if ($have_break) { last WAIT; }
if ($pvc_timeout && ( time() > $last_action_time+60*$pvc_timeout_mins ) ) {
$timed_out = 1;
last WAIT;
}
} # end WAIT:
&default_break;
if ($have_break) {
print "$My_name: User typed ctrl/C or ctrl/break. I'll finish.\n";
return;
}
if ($timed_out) {
print "$My_name: More than $pvc_timeout_mins mins of inactivity. I'll finish.\n";
return;
}
$waiting = 0; if ($diagnostics) { warn "NOT WAITING\n"; }
} #end infinite_loop CHANGE:
} #END sub make_preview_continuous
#************************************************************
sub process_rc_file {
# Usage process_rc_file( filename )
# NEW VERSION
# Run rc_file whose name is given in first argument
# Exit with code 0 on success
# Exit with code 1 if file cannot be read or does not exist.
# Stop if there is a syntax error or other problem.
# PREVIOUSLY:
# Exit with code 2 if is a syntax error or other problem.
my $rc_file = $_[0];
my $ret_code = 0;
warn "$My_name: Executing Perl code in file '$rc_file'...\n"
if $diagnostics;
# I could use the do command of perl, but the preceeding -r test
# to get good diagnostics gets the wrong result under cygwin
# (e.g., on /cygdrive/c/latexmk/LatexMk)
my $RCH = new FileHandle;
if ( !-e $rc_file ) {
warn "$My_name: The rc-file '$rc_file' does not exist\n";
return 1;
}
elsif ( -d $rc_file ) {
warn "$My_name: The supposed rc-file '$rc_file' is a directory; but it\n",
" should be a normal text file\n";
return 1;
}
elsif ( open $RCH, "<$rc_file" ) {
{ local $/; eval <$RCH>; }
close $RCH;
}
else {
warn "$My_name: I cannot read the rc-file '$rc_file'\n";
return 1;
}
# PREVIOUS VERSION
# if ( ! -r $rc_file ) {
# warn "$My_name: I cannot read the rc-file '$rc_file'\n",
# " or at least that's what Perl (for $^O) reports\n";
# return 1;
# }
# do( $rc_file );
if ( $@ ) {
# Indent each line of possibly multiline message:
my $message = prefix( $@, " " );
warn "$My_name: Initialization file '$rc_file' gave an error:\n",
"$message\n";
die "$My_name: Stopping because of problem with rc file\n";
# Use the following if want non-fatal error.
return 2;
}
return 0;
} #END process_rc_file
#************************************************************
sub execute_code_string {
# Usage execute_code_string( string_of_code )
# Run the perl code contained in first argument
# Halt if there is a syntax error or other problem.
# ???Should I leave the exiting to the caller (perhaps as an option)?
# But I can always catch it with an eval if necessary.
# That confuses ctrl/C and ctrl/break handling.
my $code = $_[0];
warn "$My_name: Executing initialization code specified by -e:\n",
" '$code'...\n"
if $diagnostics;
eval $code;
# The return value from the eval is not useful, since it is the value of
# the last expression evaluated, which could be anything.
# The correct test of errors is on the value of $@.
if ( $@ ) {
# Indent each line of possibly multiline message:
my $message = prefix( $@, " " );
die "$My_name: ",
"Stopping because executing following code from command line\n",
" $code\n",
"gave an error:\n",
"$message\n";
}
} #END execute_code_string
#************************************************************
sub cleanup1 {
# Usage: cleanup1( directory, exts_without_period, ... )
#
# The directory and the root file name are fixed names, so I must escape
# any glob metacharacters in them:
my $dir = fix_pattern( shift );
my $root_fixed = fix_pattern( $root_filename );
foreach (@_) {
my $name = /%R/ ? $_ : "%R.$_";
$name =~ s/%R/${root_fixed}/;
$name = $dir.$name;
unlink_or_move( my_glob( "$name" ) );
}
} #END cleanup1
#************************************************************
sub cleanup_cusdep_generated {
# Remove files generated by custom dependencies
rdb_for_actives( \&cleanup_one_cusdep_generated );
} #END cleanup_cusdep_generated
#************************************************************
sub cleanup_one_cusdep_generated {
# Remove destination file generated by one custom dependency
# Assume rule context, but not that the rule is a custom dependency.
# Only delete destination file if source file exists (so destination
# file can be recreated)
if ( $$Pcmd_type ne 'cusdep' ) {
# NOT cusdep
return;
}
if ( ! -e $$Psource ) {
warn "$My_name: For custom dependency '$rule',\n",
" I won't delete destination file '$$Pdest'\n",
" and any other generated files,\n",
" because the source file '$$Psource' doesn't exist,\n",
" so the destination file may not be able to be recreated\n";
return;
}
unlink_or_move( $$Pdest, keys %$PHdest );
} #END cleanup_one_cusdep_generated
#************************************************************
#************************************************************
#************************************************************
# Error handling routines, warning routines, help
#************************************************************
sub die_trace {
# Call: die_trace( message );
&traceback; # argument(s) passed unchanged
die "\n";
} #END die_trace
#************************************************************
sub traceback {
# Call: &traceback
# or traceback( message, )
my $msg = shift;
if ($msg) { warn "$msg\n"; }
warn "Traceback:\n";
my $i=0; # Start with immediate caller
while ( my ($pack, $file, $line, $func) = caller($i++) ) {
if ($func eq 'die_trace') { next; }
warn " $func called from line $line\n";
}
} #END traceback
#************************************************************
sub exit_msg1
{
# exit_msg1( error_message, retcode [, action])
# 1. display error message
# 2. if action set, then restore aux file
# 3. exit with retcode
warn "\n------------\n";
warn "$My_name: $_[0].\n";
warn "-- Use the -f option to force complete processing.\n";
my $retcode = $_[1];
if ($retcode >= 256) {
# Retcode is the kind returned by system from an external command
# which is 256 * command's_retcode
$retcode /= 256;
}
exit $retcode;
} #END exit_msg1
#************************************************************
sub warn_running {
# Message about running program:
if ( $silent ) {
warn "$My_name: @_\n";
}
else {
warn "------------\n@_\n------------\n";
}
} #END warn_running
#************************************************************
sub exit_help
# Exit giving diagnostic from arguments and how to get help.
{
warn "\n$My_name: @_\n",
"Use\n",
" $my_name -help\nto get usage information\n";
exit 10;
} #END exit_help
#************************************************************
sub print_help
{
print
"$My_name $version_num: Automatic LaTeX document generation routine\n\n",
"Usage: $my_name [latexmk_options] [filename ...]\n\n",
" Latexmk_options:\n",
" -aux-directory=dir or -auxdir=dir \n",
" - set name of directory for auxiliary files (aux, log)\n",
" - Currently this only works with MiKTeX\n",
" -bibtex - use bibtex when needed (default)\n",
" -bibtex- - never use bibtex\n",
" -bibtex-cond - use bibtex when needed, but only if the bib file exists\n",
" -bibtex-cond1 - use bibtex when needed, but only if the bib file exists;\n",
" on cleanup delete bbl file only if bib file exists\n",
" -bm <message> - Print message across the page when converting to postscript\n",
" -bi <intensity> - Set contrast or intensity of banner\n",
" -bs <scale> - Set scale for banner\n",
" -commands - list commands used by $my_name for processing files\n",
" -c - clean up (remove) all nonessential files, except\n",
" dvi, ps and pdf files.\n",
" This and the other clean-ups are instead of a regular make.\n",
" -C - clean up (remove) all nonessential files\n",
" including aux, dep, dvi, postscript and pdf files\n",
" and file of database of file information\n",
" -CA - clean up (remove) all nonessential files.\n",
" Equivalent to -C option.\n",
" -CF - Remove file of database of file information before doing \n",
" other actions\n",
" -cd - Change to directory of source file when processing it\n",
" -cd- - Do NOT change to directory of source file when processing it\n",
" -dependents or -deps - Show list of dependent files after processing\n",
" -dependents- or -deps- - Do not show list of dependent files\n",
" -deps-out=file - Set name of output file for dependency list,\n",
" and turn on showing of dependency list\n",
" -dF <filter> - Filter to apply to dvi file\n",
" -dvi - generate dvi\n",
" -dvi- - turn off required dvi\n",
" -e <code> - Execute specified Perl code (as part of latexmk start-up\n",
" code)\n",
" -f - force continued processing past errors\n",
" -f- - turn off forced continuing processing past errors\n",
" -gg - Super go mode: clean out generated files (-CA), and then\n",
" process files regardless of file timestamps\n",
" -g - process regardless of file timestamps\n",
" -g- - Turn off -g\n",
" -h - print help\n",
" -help - print help\n",
" -jobname=STRING - set basename of output file(s) to STRING.\n",
" (Like --jobname=STRING on command line for many current\n",
" implementations of latex/pdflatex.)\n",
" -l - force landscape mode\n",
" -l- - turn off -l\n",
" -latex=<program> - set program used for latex.\n",
" (replace '<program>' by the program name)\n",
" -latexoption=<option> - add the given option to the (pdf)latex command\n",
" -logfilewarninglist or -logfilewarnings \n",
" give list of warnings after run of (pdf)latex\n",
" -logfilewarninglist- or -logfilewarnings- \n",
" do not give list of warnings after run of (pdf)latex\n",
" -lualatex - use lualatex for processing files to pdf\n",
" and turn dvi/ps modes off\n",
" -M - Show list of dependent files after processing\n",
" -MF file - Specifies name of file to receives list dependent files\n",
" -MP - List of dependent files includes phony target for each source file.\n",
" -new-viewer - in -pvc mode, always start a new viewer\n",
" -new-viewer- - in -pvc mode, start a new viewer only if needed\n",
" -nobibtex - never use bibtex\n",
" -nodependents - Do not show list of dependent files after processing\n",
" -norc - omit automatic reading of system, user and project rc files\n",
" -output-directory=dir or -outdir=dir\n",
" - set name of directory for output files\n",
" -pdf - generate pdf by pdflatex\n",
" -pdfdvi - generate pdf by dvipdf\n",
" -pdflatex=<program> - set program used for pdflatex.\n",
" (replace '<program>' by the program name)\n",
" -pdflualatex=<program> - set program used for lualatex.\n",
" (replace '<program>' by the program name)\n",
" -pdfps - generate pdf by ps2pdf\n",
" -pdflua - generate pdf by lualatex\n",
" -pdfxe - generate pdf by xelatex\n",
" -pdfxelatex=<program> - set program used for xelatex.\n",
" (replace '<program>' by the program name)\n",
" -pdf- - turn off pdf\n",
" -ps - generate postscript\n",
" -ps- - turn off postscript\n",
" -pF <filter> - Filter to apply to postscript file\n",
" -p - print document after generating postscript.\n",
" (Can also .dvi or .pdf files -- see documentation)\n",
" -pretex=<TeX code> - Sets TeX code to be executed before inputting source\n",
" file, if commands suitable configured\n",
" -print=dvi - when file is to be printed, print the dvi file\n",
" -print=ps - when file is to be printed, print the ps file (default)\n",
" -print=pdf - when file is to be printed, print the pdf file\n",
" -pv - preview document. (Side effect turn off continuous preview)\n",
" -pv- - turn off preview mode\n",
" -pvc - preview document and continuously update. (This also turns\n",
" on force mode, so errors do not cause $my_name to stop.)\n",
" (Side effect: turn off ordinary preview mode.)\n",
" -pvc- - turn off -pvc\n",
" -pvctimeout - timeout in pvc mode after period of inactivity\n",
" -pvctimeout- - don't timeout in pvc mode after inactivity\n",
" -pvctimeoutmins=<time> - set period of inactivity (minutes) for pvc timeout\n",
" -quiet - silence progress messages from called programs\n",
" -r <file> - Read custom RC file\n",
" (N.B. This file could override options specified earlier\n",
" on the command line.)\n",
" -recorder - Use -recorder option for (pdf)latex\n",
" (to give list of input and output files)\n",
" -recorder- - Do not use -recorder option for (pdf)latex\n",
" -rules - Show list of rules after processing\n",
" -rules- - Do not show list of rules after processing\n",
" -showextraoptions - Show other allowed options that are simply passed\n",
" as is to latex and pdflatex\n",
" -silent - silence progress messages from called programs\n",
" -stdtexcmds - Sets standard commands for *latex\n",
" -time - show CPU time used\n",
" -time- - don't show CPU time used\n",
" -use-make - use the make program to try to make missing files\n",
" -use-make- - don't use the make program to try to make missing files\n",
" -usepretex - Sets commands for *latex to use extra code before inputting\n",
" source file\n",
" -usepretex=<TeX code> - Equivalent to -pretex=<TeX code> -usepretex\n",
" -v - display program version\n",
" -verbose - display usual progress messages from called programs\n",
" -version - display program version\n",
" -view=default - viewer is default (dvi, ps, pdf)\n",
" -view=dvi - viewer is for dvi\n",
" -view=none - no viewer is used\n",
" -view=ps - viewer is for ps\n",
" -view=pdf - viewer is for pdf\n",
" -Werror - treat warnings from called programs as errors\n",
" -xelatex - use xelatex for processing files to pdf\n",
" and turn dvi/ps modes off\n",
"\n",
" filename = the root filename of LaTeX document\n",
"\n",
"-p, -pv and -pvc are mutually exclusive\n",
"-h, -c and -C override all other options.\n",
"-pv and -pvc require one and only one filename specified\n",
"All options can be introduced by '-' or '--'. (E.g., --help or -help.)\n",
" \n",
"In addition, latexmk recognizes many other options that are passed to\n",
"latex and/or pdflatex without interpretation by latexmk. Run latexmk\n",
"with the option -showextraoptions to see a list of these\n",
"\n",
"Report bugs etc to John Collins <jcc8 at psu.edu>.\n";
} #END print_help
#************************************************************
sub print_commands {
warn "Commands used by $my_name:\n",
" To run latex, I use \"$latex\"\n",
" To run pdflatex, I use \"$pdflatex\"\n",
" To run lualatex, I use \"$lualatex\"\n",
" To run xelatex, I use \"$xelatex\"\n",
" To run biber, I use \"$biber\"\n",
" To run bibtex, I use \"$bibtex\"\n",
" To run makeindex, I use \"$makeindex\"\n",
" To make a ps file from a dvi file, I use \"$dvips\"\n",
" To make a ps file from a dvi file with landscape format, ",
"I use \"$dvips_landscape\"\n",
" To make a pdf file from a dvi file, I use \"$dvipdf\"\n",
" To make a pdf file from a ps file, I use \"$ps2pdf\"\n",
" To make a pdf file from an xdv file, I use \"$xdvipdfmx\"\n",
" To view a pdf file, I use \"$pdf_previewer\"\n",
" To view a ps file, I use \"$ps_previewer\"\n",
" To view a ps file in landscape format, ",
"I use \"$ps_previewer_landscape\"\n",
" To view a dvi file, I use \"$dvi_previewer\"\n",
" To view a dvi file in landscape format, ",
"I use \"$dvi_previewer_landscape\"\n",
" To print a ps file, I use \"$lpr\"\n",
" To print a dvi file, I use \"$lpr_dvi\"\n",
" To print a pdf file, I use \"$lpr_pdf\"\n",
" To find running processes, I use \"$pscmd\", \n",
" and the process number is at position $pid_position\n";
warn "Notes:\n",
" Command starting with \"start\" is run detached\n",
" Command that is just \"start\" without any other command, is\n",
" used under MS-Windows to run the command the operating system\n",
" has associated with the relevant file.\n",
" Command starting with \"NONE\" is not used at all\n";
} #END print_commands
#************************************************************
sub view_file_via_temporary {
return $always_view_file_via_temporary
|| ($pvc_view_file_via_temporary && $preview_continuous_mode);
} #END view_file_via_temporary
#************************************************************
#### Tex-related utilities
#**************************************************
sub check_biber_log {
# Check for biber warnings:
# Usage: check_biber_log( base_of_biber_run, \@biber_source )
# return 0: OK;
# 1: biber warnings;
# 2: biber errors;
# 3: could not open .blg file;
# 4: failed to find one or more source files, except for bibfile;
# 5: failed to find bib file;
# 6: missing file, one of which is control file
# 10: only error is missing \citation commands.
# 11: Malformed bcf file (normally due to error in pdflatex run)
# Side effect: add source files @biber_source
my $base = $_[0];
my $Pbiber_source = $_[1];
my $blg_name = "$base.blg";
my $blg_file = new FileHandle;
open( $blg_file, "<$blg_name" )
or return 3;
my $have_warning = 0;
my $have_error = 0;
my $missing_citations = 0;
my $no_citations = 0;
my $error_count = 0; # From my counting of error messages
my $warning_count = 0; # From my counting of warning messages
# The next two occur only from biber
my $bibers_error_count = 0; # From biber's counting of errors
my $bibers_warning_count = 0; # From biber's counting of warnings
my $not_found_count = 0;
my $control_file_missing = 0;
my $control_file_malformed = 0;
my %remote = (); # List of extensions of remote files
while (<$blg_file>) {
if (/> WARN /) {
print "Biber warning: $_";
$have_warning = 1;
$warning_count ++;
}
elsif (/> (FATAL|ERROR) /) {
print "Biber error: $_";
if ( /> (FATAL|ERROR) - Cannot find file '([^']+)'/ #'
|| /> (FATAL|ERROR) - Cannot find '([^']+)'/ ) { #'
$not_found_count++;
push @$Pbiber_source, $2;
}
elsif ( /> (FATAL|ERROR) - Cannot find control file '([^']+)'/ ) { #'
$not_found_count++;
$control_file_missing = 1;
push @$Pbiber_source, $2;
}
elsif ( /> ERROR - .*\.bcf is malformed/ ) {
# Special treatment: Malformed .bcf file commonly results from error
# in (pdf)latex run. This error must be ignored.
$control_file_malformed = 1;
}
else {
$have_error = 1;
$error_count ++;
if ( /> (FATAL|ERROR) - The file '[^']+' does not contain any citations!/ ) { #'
$no_citations++;
}
}
}
elsif ( /> INFO - Data source '([^']*)' is a remote BibTeX data source - fetching/
){
my $spec = $1;
my ( $base, $path, $ext ) = fileparseA( $spec );
$remote{$ext} = 1;
}
elsif ( /> INFO - Found .* '([^']+)'\s*$/
|| /> INFO - Found '([^']+)'\s*$/
|| /> INFO - Reading '([^']+)'\s*$/
|| /> INFO - Processing .* file '([^']+)' .*$/
) {
my $file = $1;
my ( $base, $path, $ext ) = fileparseA( $file );
if ($remote{$ext} && ( $base =~ /^biber_remote_data_source/ ) && 1) {
# Ignore the file, which appears to be a temporary local copy
# of a remote file. Treating the file as a source file will
# be misleading, since it will normally have been deleted by
# biber itself.
}
elsif ( (defined $Pbiber_source) && (-e $file) ) {
# Note that biber log file gives full path to file. (No search is
# needed to find it.) The file must have existed when biber was
# run. If it doesn't exist now, a few moments later, it must
# have gotten deleted, probably by biber (e.g., because it is a
# copy of a remote file).
# So I have included a condition above that the file must
# exist to be included in the source-file list.
push @$Pbiber_source, $file;
}
}
elsif ( /> INFO - WARNINGS: ([\d]+)\s*$/ ) {
$bibers_warning_count = $1;
}
elsif ( /> INFO - ERRORS: ([\d]+)\s*$/ ) {
$bibers_error_count = $1;
}
}
close $blg_file;
if ($control_file_malformed){return 11;}
my @not_found = &find_file_list1( $Pbiber_source, $Pbiber_source,
'', \@BIBINPUTS );
@$Pbiber_source = uniqs( @$Pbiber_source );
if ( ($#not_found < 0) && ($#$Pbiber_source >= 0) ) {
warn "$My_name: Found biber source file(s) [@$Pbiber_source]\n"
unless $silent;
}
elsif ( ($#not_found == 0) && ($not_found[0] =~ /\.bib$/) ) {
# Special treatment if sole missing file is bib file
# I don't want to treat that as an error
warn "$My_name: Biber did't find bib file [$not_found[0]]\n";
return 5;
}
else {
warn "$My_name: Failed to find one or more biber source files:\n";
foreach (@not_found) { warn " '$_'\n"; }
if ($force_mode) {
warn "==== Force_mode is on, so I will continue. ",
"But there may be problems ===\n";
}
if ($control_file_missing) {
return 6;
}
return 4;
}
# print "$My_name: #Biber errors = $error_count, warning messages = $warning_count,\n ",
# "missing citation messages = $missing_citations, no_citations = $no_citations\n";
if ( ! $have_error && $no_citations ) {
# If the only errors are missing citations, or lack of citations, that should
# count as a warning.
# HOWEVER: biber doesn't generate a new bbl. So it is an error condition.
return 10;
}
if ($have_error) {return 2;}
if ($have_warning) {return 1;}
return 0;
} #END check_biber_log
#**************************************************
sub run_bibtex {
my $return = 999;
# Prevent changes we make to environment becoming global:
local %ENV = %ENV;
my ( $base, $path, $ext ) = fileparseA( $$Psource );
if ( $path && $bibtex_fudge ) {
# Since (e.g.,) 'bibtex output/main.aux' doesn't find subsidiary .aux
# files, as from \@include{chap.aux}, we change directory to the
# directory of the top-level .aux file to run bibtex. But we have to
# fix search paths for .bib and .bst, since they may be specified
# relative to the document directory.
my $cwd = good_cwd();
foreach ( 'BIBINPUTS', 'BSTINPUTS' ) {
if ( exists $ENV{$_} ) {
$ENV{$_} = $cwd.$search_path_separator.$ENV{$_};
}
else {
$ENV{$_} = $cwd.$search_path_separator;
}
}
pushd( $path );
if (!$silent) {
print "$My_name: changed directory to '$path'\n",
"Set BIBINPUTS='$ENV{BIBINPUTS}'\n",
"Set BSTINPUTS='$ENV{BSTINPUTS}'\n";
}
$return = &Run_subst( undef, undef, '', $base.$ext, '', $base );
popd();
if (!$silent) {
print "$My_name: changed directory back to '", cwd(), "'\n";
}
}
else {
$return = Run_subst();
}
return $return;
}
#**************************************************
sub check_bibtex_log {
# Check for bibtex warnings:
# Usage: check_bibtex_log( base_of_bibtex_run )
# return 0: OK, 1: bibtex warnings, 2: bibtex errors,
# 3: could not open .blg file.
# 10: only error is missing \citation commands or a missing aux file
# (which would normally be corrected after a later run of
# (pdf)latex).
my $base = $_[0];
my $blg_name = "$base.blg";
my $blg_file = new FileHandle;
open( $blg_file, "<$blg_name" )
or return 3;
my $have_warning = 0;
my $have_error = 0;
my $missing_citations = 0;
my @missing_aux = ();
my $error_count = 0;
while (<$blg_file>) {
if (/^Warning--/) {
#print "Bibtex warning: $_";
$have_warning = 1;
}
elsif ( /^I couldn\'t open auxiliary file (.*\.aux)/ ) {
push @missing_aux, $1;
}
elsif ( /^I found no \\citation commands---while reading file/ ) {
$missing_citations++;
}
elsif (/There (were|was) (\d+) error message/) {
$error_count = $2;
#print "Bibtex error: count=$error_count $_";
$have_error = 1;
}
}
close $blg_file;
my $missing = $missing_citations + $#missing_aux + 1;
if ( $#missing_aux > -1 ) {
# Need to make the missing files.
warn "$My_name: One or more aux files is missing for bibtex. I'll try\n",
" to get (pdf)latex to remake them.\n";
rdb_for_some( [keys %current_primaries], sub{ $$Pout_of_date = 1; } );
}
#print "Bibtex errors = $error_count, missing aux files and citations = $missing\n";
if ($have_error && ($error_count <= $missing )
&& ($missing > 0) ) {
# If the only error is a missing citation line, that should only
# count as a warning.
# Also a missing aux file should be innocuous; it will be created on
# next run of (pdf)latex. ?? HAVE I HANDLED THAT CORRECTLY?
# But have to deal with the problem that bibtex gives a non-zero
# exit code. So leave things as they are so that the user gets
# a better diagnostic ??????????????????????????
# $have_error = 0;
# $have_warning = 1;
return 10;
}
if ($have_error) {return 2;}
if ($have_warning) {return 1;}
return 0;
} #END check_bibtex_log
#**************************************************
sub normalize_force_directory {
# Usage, normalize_force_directory( dir, filename )
# Perform the following operations:
# Clean filename
# If filename contains no path component, insert dir in front
# Normalize filename
# Return result
my $default_dir = $_[0];
my $filename = clean_filename( $_[1] );
my ($base_name, $path ) = fileparse( $filename );
if ( $base_name eq $filename ) {
$filename = "$default_dir$filename";
}
return normalize_filename( $filename );
} #END normalize force_directory
#**************************************************
sub set_names {
# Set names of standard files. These are global variables.
## Remove extension from filename if was given.
if ( find_basename($filename, $root_filename, $texfile_name) ) {
if ( $force_mode ) {
warn "$My_name: Could not find file '$texfile_name'\n";
}
else {
&ifcd_popd;
&exit_msg1( "Could not find file '$texfile_name'",
11);
}
}
$tex_basename = $root_filename; # Base name of TeX file itself
if ($jobname ne '' ) {
$root_filename = $jobname;
$root_filename =~ s/%A/$tex_basename/g;
}
$aux_main = "%Y%R.aux";
$log_name = "%Y%R.log";
$fdb_name = "%Y%R.$fdb_ext";
# Note: Only MiKTeX allows out_dir ne aux_dir. It puts
# .fls file in out_dir, not aux_dir, which seems
# not natural.
$fls_name = "%Z%R.fls";
$dvi_name = "%Z%R.dvi";
$dviF_name = "%Z%R.dviF";
$ps_name = "%Z%R.ps";
$psF_name = "%Z%R.psF";
$pdf_name = "%Z%R.pdf";
## It would be logical for a .xdv file to be put in the out_dir,
## just like a .dvi file. But the only program, MiKTeX, that
## currently implements aux_dir, and hence allows aux_dir ne out_dir,
## puts .xdv file in aux_dir. So we must use %Y not %Z:
$xdv_name = "%Y%R.xdv";
foreach ( $aux_main, $log_name, $fdb_name, $fls_name,
$dvi_name, $ps_name, $pdf_name, $xdv_name, $dviF_name, $psF_name ) {
s/%R/$root_filename/g;
s/%Y/$aux_dir1/;
s/%Z/$out_dir1/;
}
$dvi_final = $dvi_name;
$ps_final = $ps_name;
$pdf_final = $pdf_name;
$xdv_final = $xdv_name;
if ( length($dvi_filter) > 0) {
$dvi_final = $dviF_name;
}
if ( length($ps_filter) > 0) {
$ps_final = $psF_name;
}
}
#**************************************************
sub parse_log {
# Scan log file for: dependent files
# reference_changed, bad_reference, bad_citation
# Return value: 1 if success, 0 if no log file.
# Put results in UPDATES of global variables (which are normally declared
# local in calling routine, to be suitably scoped):
# %dependents: maps definite dependents to code:
# 0 = from missing-file line
# May have no extension
# May be missing path
# 1 = from 'File: ... Graphic file (type ...)' line
# no path. Should exist, but may need a search, by kpsewhich.
# 2 = from regular '(...' coding for input file,
# Has NO path, which it would do if LaTeX file
# Highly likely to be mis-parsed line
# 3 = ditto, but has a path character ('/').
# Should be LaTeX file that exists.
# If it doesn't exist, we have probably a mis-parsed line.
# There's no need to do a search.
# 4 = definitive, which in this subroutine is only done:
# for default dependents,
# and for files that exist and are source of conversion
# reported by epstopdf et al.
# 5 = Had a missing file line. Now the file exists.
# 6 = File was written during run. (Overrides 5)
# 7 = File was created during run to be read in. (Overrides 5 and 6)
# (e.g., by epstopdf)
# Treat the following specially, since they have special rules
# @bbl_files to list of .bbl files.
# %idx_files to map from .idx files to .ind files.
# %generated_log: keys give set of files written by (pdf)latex (e.g., aux, idx)
# as determined by \openout = ... lines in log file.
# @missing_subdirs = list of needed subdirectories of aux_dir
# These are needed for writing aux_files when an included file is in
# a subdirectory relative to the directory of the main TeX file.
# This variable is only set when the needed subdirectories don't exist,
# and the aux_dir is non-trivial, which results in an error message in
# the log file
# %conversions Internally made conversions from one file to another
#
# These may have earlier found information in them, so they should NOT
# be initialized.
#
# Also SET
# $reference_changed, $bad_reference, $bad_citation
# $pwd_latex
#
# Put in trivial or default values if log file does not exist/cannot be opened
#
# Input globals: $primary_out, $fls_file_analyzed
#
# Give a quick way of looking up custom-dependency extensions
my %cusdep_from = ();
my %cusdep_to = ();
foreach ( @cus_dep_list ) {
my ($fromext, $toext) = split;
$cusdep_from{$fromext} = $cusdep_from{".$fromext"} = $_;
$cusdep_to{$toext} = $cusdep_to{".$toext"} = $_;
}
# print "==== Cusdep from-exts:"; foreach (keys %cusdep_from) {print " '$_'";} print "\n";
# print "==== Cusdep to-exts:"; foreach (keys %cusdep_to) {print " '$_'";} print "\n";
# Filenames given in log file may be preceded by a pathname
# denoting current directory. In MiKTeX, this is an absolute
# pathname; in TeXLive, it is './'. Either way, we'll want to
# remove this pathname string --- see the comments in sub
# rdb_set_latex_deps. In order of reliability for use in
# normalizing filenames from the log file, the following forms
# of the cwd are used:
# (a) internally deduced pwd from log file from sequence of lines
# **file
# (dir/file
# if possible. NO THAT'S WRONG if kpsearch is done.
# (b) from PWD line in fls file (if available), passed as $pwd_latex
# (c) system-given cwd as interpreted by sub good_cwd.
# We'll put the first two in @pwd_log
my @pwd_log = ();
if ($pwd_latex) { push @pwd_log, $pwd_latex; }
# $primary_out is actual output file (dvi or pdf)
# It is initialized before the call to this routine, to ensure
# a sensible default in case of misparsing
$reference_changed = 0;
$mult_defined = 0;
$bad_reference = 0;
$bad_character = 0;
$bad_citation = 0;
my $log_file = new FileHandle;
if ( ! open( $log_file, "<$log_name" ) ) {
return 0;
}
if ($log_file_binary) { binmode $log_file; }
# Collect lines of log file
my @lines = ();
my $line = 0;
my $engine = 'pdfTeX'; # Simple default in case of problems
while(<$log_file>) {
$line++;
# Could use chomp here, but that fails if there is a mismatch
# between the end-of-line sequence used by latex and that
# used by perl. (Notably a problem with MSWin latex and
# cygwin perl!)
s/[\n\r]*$//;
# Handle wrapped lines:
# They are lines brutally broken at exactly $log_wrap chars
# excluding line-end. Sometimes a line $log_wrap chars
# long is an ordinary line, sometimes it is part of a line
# that was wrapped. To handle all cases, I keep both
# options open by putting the line into @lines before
# and after appending the next line:
my $len = length($_);
if ($line == 1) {
if ( /^This is ([^,]+), / ) {
$engine = $1;
print "=== TeX engine is '$engine'\n"
if (!$silent);
if ( /^This is ([^,]+), [^\(]*\(([^\)]+)\)/ ) {
$tex_distribution = $2;
print "=== TeX distribution is '$tex_distribution'\n"
if ($diagnostics);
}
}
else {
warn "$My_name: First line of .log file '$log_name' is not in standard format.\n";
}
}
else {
# LuaTeX sometimes wraps at 80 instead of 79, so work around this
while ( ( ($len == $log_wrap) || ( ($engine eq 'LuaTeX') && ($len == $log_wrap+1) ) )
&& !eof($log_file) ) {
push @lines, $_;
my $extra = <$log_file>;
$extra =~ s/[\n\r]*$//;
$len = length($extra);
$_ .= $extra;
}
}
push @lines, $_;
}
close $log_file;
push @lines, ""; # Blank line to terminate. So multiline blocks
# are always terminated by non-block line, rather than eof.
$line = 0;
my $state = 0; # 0 => before ** line,
# 1 => after **filename line, before next line (first file-reading line)
# 2 => pwd_log determined.
# For parsing multiple line blocks of info
my $current_pkg = ""; # non-empty string for package name, if in
# middle of parsing multi-line block of form:
# Package name ....
# (name) ...
# ...
my $block_type = ""; # Specify information in such a block
my $delegated_source = ""; # If it is a file conversion, specify source
my $delegated_output = ""; # and output file. (Don't put in
# data structure until block is ended.)
my %new_conversions = ();
my @retries = ();
my $log_silent = ($silent || $silence_logfile_warnings);
my @warning_list = ();
LINE:
while( ($line <= $#lines) || ($#retries > -1) ) {
if ($#retries > -1) {
$_ = pop @retries;
}
else {
$_ = $lines[$line];
$line ++;
}
if ( /^! pdfTeX warning/ || /^pdfTeX warning/ ) {
# This kind of warning is produced by some versions of pdftex
# or produced by my reparse of warnings from other
# versions.
next;
}
elsif ( /^(.+)(pdfTeX warning.*)$/ ) {
# Line contains a pdfTeX warnings that may have been
# inserted directly after other material without an
# intervening new line. I think pdfTeX always inserts a
# newline after the warning. (From examination of source
# code.)
push @retries, $1;
# But continue parsing the original line, in case it was a
# misparse, e.g., of a filename ending in 'pdfTeX';
}
if ( $line == 1 ){
if ( /^This is / ) {
# First line OK
next LINE;
} else {
warn "$My_name: Error on first line of '$log_name'.\n".
"This is apparently not a TeX log file. ",
"The first line is:\n$_\n";
$failure = 1;
$failure_msg = "Log file '$log_name' appears to have wrong format.";
return 0;
}
}
if ( ($state == 0) && /^\*\*(.*)$/ ) {
# Line containing first line specified to tex
# It's either a filename or a command starting with \
my $first = $1;
$state = 1;
if ( ! /^\\/ ) {
$source_log = $first;
if ( -e "$source_log.tex" ) { $source_log .= '.tex'; }
}
else {
$state = 2;
}
next LINE;
}
elsif ( $state == 1 ) {
$state = 2;
if (-e $source_log) {
# then the string preceeding $source_log on the line after the
# ** line is probably the PWD as it appears in filenames in the
# log file, except if the file appears in two locations.
if ( m{^\("([^"]*)[/\\]\Q$source_log\E"} ) {
unshift @pwd_log, $1;
}
elsif ( m{^\((.*)[/\\]\Q$source_log\E} ) {
unshift @pwd_log, $1;
}
}
}
if ( $block_type ) {
# In middle of parsing block
if ( /^\($current_pkg\)/ ) {
# Block continues
if ( ($block_type eq 'conversion')
&& /^\($current_pkg\)\s+Output file: <([^>]+)>/ )
{
$delegated_output = normalize_clean_filename($1, @pwd_log);
}
next LINE;
}
# Block has ended.
if ($block_type eq 'conversion') {
#print "=== $delegated_source -> $delegated_output\n";
$new_conversions{$delegated_source} = $delegated_output;
}
$current_pkg = $block_type
= $delegated_source = $delegated_output = "";
# Then process current line
}
# Check for changed references, bad references and bad citations:
if (/Rerun to get/) {
warn "$My_name: References changed.\n" if ! $log_silent;
$reference_changed = 1;
}
if (/^LaTeX Warning: (Reference[^\001]*undefined on input line .*)\./) {
push @warning_list, $1;
$bad_reference++;
}
elsif (/^LaTeX Warning: (Label [^\001]* multiply defined.*)\./) {
push @warning_list, $1;
$mult_defined++;
}
elsif (/^LaTeX Warning: (Citation[^\001]*undefined on input line .*)\./) {
push @warning_list, $1;
$bad_citation++;
}
elsif (/^Package natbib Warning: (Citation[^\001]*undefined on input line .*)\./) {
push @warning_list, $1;
$bad_citation++;
}
elsif ( /^Missing character: There is no /
|| /^! Package inputenc Error: Unicode character /
|| /^! Bad character code /
) {
$bad_character++;
}
elsif ( /^Document Class: / ) {
# Class sign-on line
next LINE;
}
elsif ( /^\(Font\)/ ) {
# Font info line
next LINE;
}
elsif (/^No pages of output\./) {
$primary_out = '';
warn "$My_name: Log file says no output from latex\n";
next LINE;
}
elsif ( /^Output written on\s+(.*)\s+\(\d+\s+page/ ) {
$primary_out = normalize_clean_filename($1, @pwd_log);
warn "$My_name: Log file says output to '$primary_out'\n"
unless $silent;
next LINE;
}
elsif ( /^Overfull /
|| /^Underfull /
|| /^or enter new name\. \(Default extension: .*\)/
|| /^\*\*\* \(cannot \\read from terminal in nonstop modes\)/
) {
# Latex error/warning, etc.
next LINE;
}
elsif ( /^\\openout\d+\s*=\s*\`([^\']+)\'\.$/ ) {
# When (pdf)latex is run with an -output-directory
# or an -aux_directory, the file name does not contain
# the output path; fix this, after removing quotes:
$generated_log{normalize_force_directory( $aux_dir1, $1 )} = 1;
next LINE;
}
# Test for conversion produced by package:
elsif ( /^Package (\S+) Info: Source file: <([^>]+)>/ ) {
# Info. produced by epstopdf (and possibly others)
# about file conversion
$current_pkg = normalize_clean_filename($1, @pwd_log);
$delegated_source = normalize_clean_filename($2, @pwd_log);
$block_type = 'conversion';
next LINE;
}
# Test for writing of index file. The precise format of the message
# depends on which package (makeidx.sty , multind.sty or index.sty) and
# which version writes the message.
elsif ( /Writing index file (.*)$/ ) {
my $idx_file = '';
if ( /^Writing index file (.*)$/ ) {
# From makeidx.sty or multind.sty
$idx_file = $1;
}
elsif ( /^index\.sty> Writing index file (.*)$/ ) {
# From old versions of index.sty
$idx_file = $1;
}
elsif ( /^Package \S* Info: Writing index file (.*) on input line/ ) {
# From new versions of index.sty
$idx_file = $1;
}
else {
warn "$My_name: Message indicates index file was written\n",
" ==> but I do not know how to understand it: <==\n",
" '$_'\n";
next LINE;
}
# Typically, there is trailing space, not part of filename:
$idx_file =~ s/\s*$//;
# When (pdf)latex is run with an -output-directory
# or an -aux_directory, the file name does not contain
# the output path; fix this, after removing quotes:
$idx_file = normalize_force_directory( $aux_dir1, $idx_file );
my ($idx_base, $idx_path, $idx_ext) = fileparseA( $idx_file );
$idx_base = $idx_path.$idx_base;
$idx_file = $idx_base.$idx_ext;
if ( $idx_ext eq '.idx' ) {
warn "$My_name: Index file '$idx_file' was written\n"
unless $silent;
$idx_files{$idx_file} = [ "$idx_base.ind", $idx_base ];
}
elsif ( exists $cusdep_from{$idx_ext} ) {
if ( !$silent ) {
warn "$My_name: Index file '$idx_file' was written\n";
warn " Cusdep '$cusdep_from{$idx_ext}' should be used\n";
}
# No action needed here
}
else {
warn "$My_name: Index file '$idx_file' written\n",
" ==> but it has an extension I do not know how to handle <==\n";
}
next LINE;
}
elsif ( /^No file (.*?\.bbl)./ ) {
# When (pdf)latex is run with an -output-directory
# or an -aux_directory, the file name does not contain
# the output path; fix this, after removing quotes:
my $bbl_file = normalize_force_directory( $aux_dir1, $1 );
warn "$My_name: Non-existent bbl file '$bbl_file'\n $_\n";
$dependents{$bbl_file} = 0;
push @bbl_files, $bbl_file;
next LINE;
}
foreach my $pattern (@file_not_found) {
if ( /$pattern/ ) {
my $file = clean_filename($1);
warn "$My_name: Missing input file: '$file' from line\n '$_'\n"
unless $silent;
$dependents{normalize_filename($file, @pwd_log)} = 0;
my $file1 = $file;
if ( $aux_dir ) {
# Allow for the possibility that latex generated
# a file in $aux_dir, from which the missing file can
# be created by a cusdep (or other) rule that puts
# the result in $out_dir. If the announced missing file
# has no path, then it would be effectively a missing
# file in $aux_dir, with a path. So give this alternate
# location.
# It is also possible to have a file that is in a directory
# relative to the aux_dir, so allow for that as well
my $file1 = normalize_force_directory( $aux_dir1, $file );
$dependents{$file1} = 0;
$dependents{$aux_dir1.$file} = 0;
}
next LINE;
}
}
if ( (! $fls_file_analyzed)
&& /^File: (.+) Graphic file \(type / ) {
# First line of message from includegraphics/x
# But this does NOT include full path information
# (if exact match is not found and a non-trivial
# kpsearch was done by (pdf)latex).
# But the source-file information is in the fls file,
# if we are using it.
$dependents{normalize_clean_filename($1, @pwd_log)} = 1;
next LINE;
}
# Now test for generic lines to ignore, only after special cases!
if ( /^File: / ) {
# Package sign-on line. Includegraphics/x also produces a line
# with this signature, but I've already handled it.
next LINE;
}
if ( /^Package: / ) {
# Package sign-on line
next LINE;
}
if (/^\! LaTeX Error: / ) {
next LINE;
}
if ( m[^! I can't write on file `(.*)/([^/']*)'.\s*$] ) {
my $dir = $1;
my $file = $2;
my $full_dir = $aux_dir1.$dir;
if ( ($aux_dir ne '') && (! -e $full_dir) && ( $file =~ /\.aux$/) ) {
warn "$My_name: === There were problems writing to '$file' in '$full_dir'\n",
" I'll try to make the subdirectory later.\n"
if $diagnostics;
push @missing_subdirs, $full_dir;
}
else {
warn "$My_name: ====== There were problems writing to",
"----- '$file' in '$full_dir'.\n",
"----- But this is not the standard situation of\n",
"----- aux file to subdir of output directory, with\n",
"----- non-existent subdir\n",
}
}
if ( ($fls_file_analyzed) && (! $analyze_input_log_always) ) {
# Skip the last part, which is all about finding input
# file names which should all appear more reliably in the
# fls file.
next LINE;
}
my @new_includes = ();
GRAPHICS_INCLUDE_CANDIDATE:
while ( /<([^>]+)(>|$)/g ) {
if ( -f $1 ) { push @new_includes, $1; }
} # GRAPHICS_INCLUDE_CANDIDATE:
INCLUDE_CANDIDATE:
while ( /\((.*$)/ ) {
# Filename found by
# '(', then filename, then terminator.
# Terminators: obvious candidates: ')': end of reading file
# '(': beginning of next file
# ' ': space is an obvious separator
# ' [': start of page: latex
# and pdflatex put a
# space before the '['
# '[': start of config file
# in pdflatex, after
# basefilename.
# '{': some kind of grouping
# Problem:
# All or almost all special characters are allowed in
# filenames under some OS, notably UNIX. Luckily most cases
# are rare, if only because the special characters need
# escaping. BUT 2 important cases are characters that are
# natural punctuation
# Under MSWin, spaces are common (e.g., "C:\Program Files")
# Under VAX/VMS, '[' delimits directory names. This is
# tricky to handle. But I think few users use this OS
# anymore.
#
# Solution: use ' [', but not '[' as first try at delimiter.
# Then if candidate filename is of form 'name1[name2]', then
# try splitting it. If 'name1' and/or 'name2' exists, put
# it/them in list, else just put 'name1[name2]' in list.
# So form of filename is now:
# '(',
# then any number of characters that are NOT ')', '(', or '{'
# (these form the filename);
# then ' [', or ' (', or ')', or end-of-string.
# That fails for pdflatex
# In log file:
# '(' => start of reading of file, followed by filename
# ')' => end of reading of file
# '[' => start of page (normally preceeded by space)
# Remember:
# filename (on VAX/VMS) may include '[' and ']' (directory
# separators)
# filenames (on MS-Win) commonly include space.
# filenames on UNIX can included space.
# Miktex quotes filenames
# But web2c doesn't. Then
# (string message
# is ambiguous: is the filename "string" or "string message".
# Allow both as candidates, since user filenames with spaces
# are rare. System filenames with spaces are common, but
# they are normally followed by a newline rather than messages.
# First step: replace $_ by whole of line after the '('
# Thus $_ is putative filename followed by other stuff.
$_ = $1;
# Array of new candidate include files; sometimes more than one.
my $quoted = 0;
if ( /^\"([^\"]+)\"/ ) {
# Quoted file name, as from MikTeX
$quoted = 1;
}
elsif ( /^([^\(^\)]*?)\s+[\[\{\<]/ ) {
# Terminator: space then '[' or '{' or '<'
# Use *? in condition: to pick up first ' [' (etc)
# as terminator
}
elsif ( /^([^\(^\)]*)\s+(?=\()/ ) {
# Terminator is ' (', but '(' isn't in matched string,
# so we keep the '(' ready for the next match
}
elsif ( /^([^\(^\)]*)(\))/ ) {
# Terminator is ')'
}
else {
#Terminator is end-of-string
}
$_ = $'; # Put $_ equal to the unmatched tail of string '
my $include_candidate = $1;
$include_candidate =~ s/\s*$//; # Remove trailing space.
if ( !$quoted && ($include_candidate =~ /(\S+)\s/ ) ){
# Non-space-containing filename-candidate
# followed by space followed by message
# (Common)
push @new_includes, $1;
}
if ( $include_candidate eq "[]" ) {
# Part of overfull hbox message
next INCLUDE_CANDIDATE;
}
if ( $include_candidate =~ /^\\/ ) {
# Part of font message
next INCLUDE_CANDIDATE;
}
# Remove quotes around filename, as for MikTeX. I've already
# treated this as a special case. For safety check here:
$include_candidate =~ s/^\"(.*)\"$/$1/;
push @new_includes, $include_candidate;
if ( $include_candidate =~ /^(.+)\[([^\]]+)\]$/ ) {
# Construct of form 'file1[file2]', as produced by pdflatex
if ( -e $1 ) {
# If the first component exists, we probably have the
# pdflatex form
push @new_includes, $1, $2;
}
else {
# We have something else.
# So leave the original candidate in the list
}
}
} # INCLUDE_CANDIDATE
INCLUDE_NAME:
foreach my $include_name (@new_includes) {
$include_name = normalize_filename( $include_name, @pwd_log );
my ($base, $path, $ext) = fileparseB( $include_name );
if ( ($path eq './') || ($path eq '.\\') ) {
$include_name = $base.$ext;
}
if ( $include_name !~ m'[/|\\]' ) {
# Filename does not include a path character
# High potential for misparsed line
$dependents{$include_name} = 2;
} else {
$dependents{$include_name} = 3;
}
if ( $ext eq '.bbl' ) {
warn "$My_name: Found input bbl file '$include_name'\n"
unless $silent;
push @bbl_files, $include_name;
}
} # INCLUDE_NAME
} # LINE
# Default includes are always definitive:
foreach (@default_includes) { $dependents{$_} = 4; }
###print "New parse: \n";
###foreach (sort keys %dependents) { print " '$_': $dependents{$_}\n"; }
my @misparsed = ();
my @missing = ();
my @not_found = ();
my %kpsearch_candidates = ();
CANDIDATE:
foreach my $candidate (keys %dependents) {
my $code = $dependents{$candidate};
if ( -d $candidate ) {
# If $candidate is directory, it was presumably found from a
# mis-parse, so remove it from the list. (Misparse can
# arise, for example from a mismatch of latexmk's $log_wrap
# value and texmf.cnf value of max_print_line.)
delete $dependents{$candidate};
}
elsif ( -e $candidate ) {
if ( exists $generated_log{$candidate} ){
$dependents{$candidate} = 6;
}
elsif ($code == 0) {
$dependents{$candidate} = 5;
}
else {
$dependents{$candidate} = 4;
}
}
elsif ($code == 1) {
# Graphics file that is supposed to have been read.
# Candidate name is as given in source file, not as path
# to actual file.
# We have already tested that file doesn't exist, as given.
# so use kpsewhich.
# If the file still is not found, assume non-existent;
$kpsearch_candidates{$candidate} = 1;
delete $dependents{$candidate};
}
elsif ($code == 2) {
# Candidate is from '(...' construct in log file, for input file
# which should include pathname if valid input file.
# Name does not have pathname-characteristic character (hence
# $code==2.
# We get here if candidate file does not exist with given name
# Almost surely result of a misparsed line in log file.
delete $dependents{$candidate};
push @misparse, $candidate;
}
elsif ($code == 3) {
# Candidate is from '(...' construct in log file, for input file
# which should include pathname if valid input file.
# Name does have pathname-characteristic character (hence
# $code==3.
# But we get here only if candidate file does not exist with
# given name.
# Almost surely result of a misparsed line in log file.
# But with lower probability than $code == 2
delete $dependents{$candidate};
push @misparse, $candidate;
}
elsif ($code == 0) {
my ($base, $path, $ext) = fileparseA($candidate);
$ext =~ s/^\.//;
if ( ($ext eq '') && (-e "$path$base.tex") ) {
# I don't think the old version was correct.
# If the missing-file report was of a bare
# extensionless file, and a corresponding .tex file
# exists, then the missing file does not correspond
# to the missing file, unless the .tex file was
# created during the run.
# OLD $dependents{"$path$base.tex"} = 4;
# OLD delete $dependents{$candidate};
# NEW:
$dependents{"$path$base.tex"} = 4;
}
push @missing, $candidate;
}
}
my @kpsearch_candidates = keys %kpsearch_candidates;
if (@kpsearch_candidates) {
foreach my $result ( kpsewhich( @kpsearch_candidates ) ) {
$dependents{$result} = 4;
}
}
CANDIDATE_PAIR:
foreach my $delegated_source (keys %new_conversions) {
my $delegated_output = $new_conversions{$delegated_source};
my $rule = "Delegated $delegated_source, $delegated_output";
# N.B. $delegated_source eq '' means the output file
# was created without a named input file.
foreach my $candidate ($delegated_source, $delegated_output) {
if (! -e $candidate ) {
# The file might be somewhere that can be found
# in the search path of kpathsea:
my @kpse_result = kpsewhich( $candidate,);
if ($#kpse_result > -1) {
$candidate = $kpse_result[0];
}
}
}
if ( ( (-e $delegated_source) || ($delegated_source eq '') )
&& (-e $delegated_output) )
{
$conversions{$delegated_output} = $delegated_source;
$dependents{$delegated_output} = 7;
if ($delegated_source) {
$dependents{$delegated_source} = 4;
}
}
elsif (!$silent) {
print "Logfile claimed conversion from '$delegated_source' ",
"to '$delegated_output'. But:\n";
if (! -e $delegated_output) {
print " Output file does not exist\n";
}
if ( ($delegated_source ne '') && (! -e $delegated_source) ) {
print " Input file does not exist\n";
}
}
}
if ( ($#warning_list >= 0) && !$log_silent ) {
@warning_list = uniqs( @warning_list );
show_array( "$My_name: List of undefined refs and citations:",
@warning_list );
}
if ( $diagnostics ) {
@misparse = uniqs( @misparse );
@missing = uniqs( @missing );
@not_found = uniqs( @not_found );
my @dependents = sort( keys %dependents );
my $dependents = $#dependents + 1;
my $misparse = $#misparse + 1;
my $missing = $#missing + 1;
my $not_found = $#not_found + 1;
my $exist = $dependents - $not_found - $missing;
my $bbl = $#bbl_files + 1;
print "$dependents dependent files detected, of which ",
"$exist exist, $not_found were not found,\n",
" and $missing appear not to exist.\n";
print "Dependents:\n";
foreach (@dependents) {
print " '$_' ";
if ( $dependents{$_} == 6 ) { print " written by (pdf)latex";}
if ( $dependents{$_} == 7 ) { print " converted by (pdf)latex";}
print "\n";
}
if ($not_found > 0) {
print "Not found:\n";
foreach (@not_found) { print " $_\n"; }
}
if ($missing > 0) {
print "Not existent:\n";
foreach (@missing) { print " $_\n"; }
}
if ( $bbl > 0 ) {
print "Input bbl files:\n";
foreach (@bbl_files) { print " $_\n"; }
}
if ( $misparse > 0 ) {
print "Possible input files, perhaps from misunderstood lines in .log file:\n";
foreach ( @misparse ) { print " $_\n"; }
}
}
return 1;
} #END parse_log
#************************************************************
sub find_set_log {
# Locate the log file, if possible. This allows for possible configuration
# errors, e.g., because the command for (*)latex was such that it did not
# do the setting of -output-directory or -aux-directory that the user intended,
# or because the version used did not support one or other of these options.
# Put result in $where_log (see its initial declaration/definition for details).
# Change $aux_dir and/or $out_dir as appropriate, and make consequent changes.
#
# Probably further attention to location of output file (.dvi, .pdf, or .xdv)
# could be done, to get $out_dir and $$Pdest more accurately set.
#
# Typical configuration errors that lead to the need for this subroutine:
# %O not used in command definition, so directory options don't getpassed
# to (*)latex.
# Use of $aux_dir different to $out_dir, when (*)latex doesn't support
# the -aux-directory option (notably with TeXLive distribution).
if ($where_log >= 0) {
# .log file was found on previous run. No need to repeat search, since
# if the location were to change from run to run, we'd have other
# serious difficulties that are to hard to deal with.
return;
}
if ( test_gen_file( "$aux_dir1$root_filename.log" ) ) {
# .log file is in expected place.
$where_log = 1;
}
elsif ( test_gen_file( "$out_dir1$root_filename.log" ) ) {
# .log file is in out_dir not in aux_dir.
# Presumably there is a configuration error
# that prevents aux_dir from being used by latex.
# So change $aux_dir to the actually used value.
$where_log = 2;
$aux_dir = $out_dir;
}
elsif ( test_gen_file( "$root_filename.log" ) ) {
# .log file is not in out_dir nor in aux_dir, but is in cwd.
# Presumably there is a configuration error
# that prevents the directories from being used by latex.
# So change $aux_dir to the actually used value.
$where_log = 3;
$aux_dir = "";
}
else {
# No .log file found
$failure = 1;
$$Plast_result = 2;
$where_log = 0;
$failure_msg
= "(Pdf)LaTeX didn't generate the expected log file '$log_name'\n";
}
if ($where_log > 1) {
warn "$My_name: Changed aux_dir from '$aux_dir_requested' to '$aux_dir'\n".
" to allow for probable configuration error\n";
# Allow for the changes associated with change of $aux_dir:
&set_dirs_etc;
&set_names;
warn "$My_name: Actual .log file is\n",
" '$log_name'\n",
" instead of the value\n",
" '$aux_dir_requested/$root_filename.log'\n",
" that seemed to be intended.\n";
}
}
#************************************************************
sub parse_fls {
my ($fls_name, $Pinputs, $Poutputs, $Pfirst_read_after_write, $Ppwd_latex ) = @_;
%$Pinputs = %$Poutputs = %$Pfirst_read_after_write = ();
my $fls_file = new FileHandle;
# Make a note of current working directory
# I'll update it from the fls file later
# Currently I don't use this, but it would be useful to use
# this when testing prefix for cwd in a filename, by
# giving (pdf)latex's best view of the cwd. Note that the
# value given by the cwd() function may be mangled, e.g., by cygwin
# compared with native MSWin32.
#
# Two relevant forms of cwd exist: The system one, which we can find, and
# the one reported by (pdf)latex in the fls file. It will be
# useful to remove leading part of cwd in filenames --- see the
# comments in sub rdb_set_latex_deps. Given the possible multiplicity
# of representations of cwd, the one reported in the fls file should
# be definitive in the fls file.
my $cwd = good_cwd();
if ( ! open ($fls_file, "<$fls_name") ) {
return 1;
}
foreach $_ ( <$fls_file> ) {
# Remove trailing CR and LF. Thus we get correct behavior when an fls file
# is produced by MS-Windows program (e.g., in MiKTeX) with CRLF line ends,
# but is read by Unix Perl (which treats LF as line end, and preserves CRLF
# in read-in lines):
$_ =~ s/[\n\r]*$//;
if (/^\s*PWD\s+(.*)$/) {
$cwd = $1;
$$Ppwd_latex = $cwd;
if ( $cwd =~ /\"/ ) {
warn "$My_name: The working directory has a '\"' character in its name:\n",
" '$cwd'\n This can cause me trouble. Beware!\n";
}
}
elsif (/^\s*INPUT\s+(.*)$/) {
# Take precautions against aliasing of foo, ./foo and other possibilities for cwd.
my $file = $1;
# Remove exactly pwd reported in this file, and following separator.
# MiKTeX reports absolute pathnames, and this way of removing PWD insulates
# us from coding issues if the PWD contains non-ASCII characters. What
# coding scheme (UTF-8, code page, etc) is used depends on OS, TeX
# implementation, ...
if ( defined $$Ppwd_latex ) {
$file =~ s(^\Q$$Ppwd_latex\E[\\/])();
}
$file = normalize_filename( $file );
if ( (exists $$Poutputs{$file}) && (! exists $$Pinputs{$file}) ) {
$$Pfirst_read_after_write{$file} = 1;
}
$$Pinputs{$file} = 1;
}
elsif (/^\s*OUTPUT\s+(.*)$/) {
# Take precautions against aliasing of foo, ./foo and other possibilities for cwd.
my $file = $1;
$file =~ s(^\Q$$Ppwd_latex\E[\\/])();
$file = normalize_filename( $file );
$$Poutputs{$file} = 1;
}
}
close( $fls_file );
return 0;
} #END parse_fls
#************************************************************
sub clean_filename {
# Convert quoted filename as found in log file to filename without quotes
# Allows arbitrarily embedded double-quoted substrings, includes the
# cases
# 1. `"string".ext', which arises e.g., from \jobname.bbl:
# when the base filename contains spaces, \jobname has quotes.
# and from \includegraphics with basename specified.
# Also deals with filenames written by asymptote.sty
# 2. Or "string.ext" from \includegraphcs with basename and ext specified.
# and from MiKTeX logfile for input files with spaces.
# Doubled quotes (e.g., A""B) don't get converted.
# Neither do unmatched quotes.
my $filename = $_[0];
while ( $filename =~ s/^([^\"]*)\"([^\"]+)\"(.*)$/$1$2$3/ ) {}
return $filename;
}
# ------------------------------
sub normalize_filename {
# Usage: normalize_filename( filename [, extra forms of name of cwd] )
# Returns filename with removal of various forms for cwd, and
# with conversion of directory separator to '/' only
#
my ( $file, @dirs ) = @_;
my $file1 = $file; # Saved original value
my $cwd = good_cwd();
# Normalize files to use / to separate directory components:
# (Note both / and \ are allowed under MSWin.)
foreach ($cwd, $file, @dirs) {
s(\\)(/)g;
}
# Remove initial component equal to current working directory.
# Use \Q and \E round directory name in regex to avoid interpretation
# of metacharacters in directory name:
foreach my $dir ( @dirs, '.', $cwd ) {
if ( $file =~ s(^\Q$dir\E/)() ) {
last;
}
}
return $file;
}
# ------------------------------
sub normalize_clean_filename {
# Usage: normalize_clean_filename( filename [, extra forms of name of cwd] )
# Same as normalize_filename, but first remove any double quotes, as
# done by clean_filename, which is appropriate for filenames from log file.
my ($file, @dirs) = @_;
return normalize_filename( clean_filename( $file ) , @dirs );
}
#************************************************************
sub fix_pattern {
# Escape the characters [ and {, to give a pattern for use in glob
# with these characters taken literally.
my $pattern = shift;
$pattern =~ s/\[/\\\[/g;
$pattern =~ s/\{/\\\{/g;
return $pattern;
}
#************************************************************
sub parse_aux {
#Usage: parse_aux( $aux_file, \@new_bib_files, \@new_aux_files, \@new_bst_files )
# Parse aux_file (recursively) for bib files, and bst files.
# If can't open aux file, then
# Return 0 and leave @new_bib_files empty
# Else set @new_bib_files from information in the aux files
# And:
# Return 1 if no problems
# Return 2 with @new_bib_files empty if there are no \bibdata
# lines.
# Return 3 if I couldn't locate all the bib_files
# Set @new_aux_files to aux files parsed
my $aux_file = $_[0];
local $Pbib_files = $_[1];
local $Paux_files = $_[2];
local $Pbst_files = $_[3];
@$Pbib_files = ();
@$Pbst_files = ();
@$Paux_files = ();
parse_aux1( $aux_file );
if ($#{$Paux_files} < 0) {
return 0;
}
@$Pbib_files = uniqs( @$Pbib_files );
@$Pbst_files = uniqs( @$Pbst_files );
if ( $#{$Pbib_files} == -1 ) {
warn "$My_name: No .bib files listed in .aux file '$aux_file' \n",
return 2;
}
my @not_found = &find_file_list1( $Pbib_files, $Pbib_files,
'.bib', \@BIBINPUTS );
@$Pbib_files = uniqs( @$Pbib_files );
&find_file_list1( $Pbst_files, $Pbst_files, '.bst' );
@$Pbst_files = uniqs( @$Pbst_files );
my @bad_bib = ();
foreach ( @$Pbib_files ) {
if ( /\s/ ) { push @bad_bib, $_; }
}
if ($#bad_bib >= 0) {
warn "$My_name: White space in an argument list for \\bibliography.\n",
" which is not allowed by bibtex. Bad arguments:\n";
foreach (@bad_bib ) { warn " '$_'\n"; }
return 3;
}
if ( $#not_found < 0) {
warn "$My_name: Found bibliography file(s) [@$Pbib_files]\n"
unless $silent;
}
else {
warn "$My_name: Failed to find one or more bibliography files:\n";
foreach (@not_found) { warn " '$_'\n"; }
if ($force_mode) {
warn "==== Force_mode is on, so I will continue. ",
"But there may be problems ===\n";
}
return 3;
}
return 1;
} #END parse_aux
#************************************************************
sub parse_aux1
# Parse single aux file for bib files.
# Usage: &parse_aux1( aux_file_name )
# Append newly found bib_filenames in @$Pbib_files, already
# initialized/in use.
# Append aux_file_name to @$Paux_files if aux file opened
# Recursively check \@input aux files
# Return 1 if success in opening $aux_file_name and parsing it
# Return 0 if fail to open it
{
my $aux_file = $_[0];
my $aux_fh = new FileHandle;
if (! open($aux_fh, $aux_file) ) {
warn "$My_name: Couldn't find aux file '$aux_file'\n";
return 0;
}
push @$Paux_files, $aux_file;
AUX_LINE:
while (<$aux_fh>) {
if ( /^\\bibdata\{(.*)\}/ ) {
# \\bibdata{comma_separated_list_of_bib_file_names}
# These are normally without the '.bib' extension.
push @$Pbib_files, split /,/, $1;
}
elsif ( /^\\bibstyle\{(.*)\}/ ) {
# \\bibstyle{bst_file_name}
# Normally without the '.bst' extension.
push @$Pbst_files, split /,/, $1;
}
elsif ( /^\\\@input\{(.*)\}/ ) {
# \\@input{next_aux_file_name}
&parse_aux1( $aux_dir1.$1 );
}
else {
foreach my $Psub (@aux_hooks) {
&$Psub;
}
}
}
close($aux_fh);
return 1;
} #END parse_aux1
#************************************************************
#************************************************************
#************************************************************
#************************************************************
# Manipulations of main file database:
#************************************************************
sub fdb_get {
# Call: fdb_get(filename [, check_time])
# Returns an array (time, size, md5) for the current state of the
# named file.
# The optional argument check_time is either the run_time of some command
# that may have changed the file or the last time the file was checked
# for changes --- see below.
# For non-existent file, deletes its entry in fdb_current,
# and returns (0,-1,0) (whatever is in @nofile).
# As an optimization, the md5 value is taken from the cache in
# fdb_current, if the time and size stamp indicate that the
# file has not changed.
# The md5 value is recalculated if
# the current filetime differs from the cached value:
# file has been written
# the current filesize differs from the cached value:
# file has definitely changed
# But the file can also be rewritten without change in filetime when
# file processing happens within the 1-second granularity of the
# timestamp (notably for aux files from latex on a short source file).
# The only case that concerns us is when the file is an input to a program
# at some runtime t, the file is rewritten later by the same or another
# program, with timestamp t, and when the initial file also has
# timestamp t.
# A test is applied for this situation if the check_time argument is
# supplied and is nonzero.
my ($file, $check_time) = @_;
if ( ! defined $check_time ) { $check_time = 0;}
my ($new_time, $new_size) = get_time_size($file);
if ( $new_size < 0 ) {
delete $fdb_current{$file};
return @nofile;
}
my $recalculate_md5 = 0;
if ( ! exists $fdb_current{$file} ) {
# Ensure we have a record.
$fdb_current{$file} = [@nofile];
$recalculate_md5 = 1;
}
my $file_data = $fdb_current{$file};
my ( $time, $size, $md5 ) = @$file_data;
if ( ($new_time != $time) || ($new_size != $size)
|| ( $check_time && ($check_time == $time ) )
) {
# Only force recalculation of md5 if time or size changed.
# However, the physical file time may have changed without
# affecting the value of the time coded in $time, because
# times are computed with a 1-second granularity.
# The only case to treat specially is where the file was created,
# then used by the current rule, and then rewritten, all within
# the granularity size, otherwise the value of the reported file
# time changed, and we've handled it. But we may have already
# checked this at an earlier time than the current check. So the
# only dangerous case is where the file time equals a check_time,
# which is either the run_time of the command or the time of a
# previous check.
# Else we assume file is really unchanged.
$recalculate_md5 = 1;
}
if ($recalculate_md5) {
@$file_data = ( $new_time, $new_size, get_checksum_md5( $file ) );
}
return @$file_data;;
} #END fdb_get
#************************************************************
sub fdb_set {
# Call: fdb_set(filename, $time, $size, $md5 )
# Set data in file data cache, i.e., %fdb_current
my ($file, $time, $size, $md5 ) = @_;
if ( ! exists $fdb_current{$file} ) {
$fdb_current{$file} = [@nofile];
}
@{$fdb_current{$file}} = ( $time, $size, $md5 );
} #END fdb_set
#************************************************************
sub fdb_show {
# Displays contents of fdb
foreach my $file ( sort keys %fdb_current ) {
print "'$file': @{$fdb_current{$file}}\n";
}
} #END fdb_show
#************************************************************
#************************************************************
#************************************************************
# Routines for manipulating rule database
#************************************************************
sub rdb_read {
# Call: rdb_read( $in_name )
# Sets rule database from saved file, in format written by rdb_write.
# Returns -1 if file could not be read else number of errors.
# Thus return value on success is 0
# Requires: Rule database initialized with standard rules, with
# conditions corresponding to requests determined by
# initialization and command line options.
# Asssumption: Normally the fdb_latexmk file contains state of
# rules and files corresponding to end of last
# compilation, and the rules in the file were
# active on that run.
# Complications arise when that state does not correspond to current
# rule set:
# (a) Configuration etc may have changed: e.g., different out_dir,
# different target rules and files, including different tex engine.
# (b) Output extension of primary rule may be different from current
# initialized one, because of document properties (use of
# \pdfoutput etc).
# (c) The same may arise because of misconfigured rules, a situation
# that may or may not have changed in current run.
# (d) The primary engine requested may not be the one used in
# the previous run, possibly because (i) request has
# changed, or (ii) document metacommand was obeyed to change
# engine. (The last is not currently implemented, but
# may/should be in the future.)
# (e) Something else, e.g., copying/editing of fdb_latexmk file.
#
local $in_name = $_[0];
my $in_handle = new FileHandle;
$in_handle->open( $in_name, '<' )
or return ();
my $errors = 0;
my $state = -1; # Values: -1: before start; 0: outside rule;
# 1: in source section;
# 2: in generated file section;
# 10: ignored rule.
my $rule = '';
local $run_time = 0;
local $source = '';
local $dest = '';
my $base = '';
my %old_actives = (); # Hash: keys are rules in fdb_latexmk file
local %new_sources = (); # Hash: rule => { file=>[ time, size, md5, fromrule ] }
my $new_source = undef; # Reference to hash of sources for current rule
LINE:
while ( <$in_handle> ) {
# Remove leading and trailing white space.
s/^\s*//;
s/\s*$//;
if ($state == -1) {
if ( ! /^# Fdb version ([\d]+)$/ ) {
warn "$My_name: File-database '$in_name' is not of correct format\n";
return 1;
}
if ( $1 > $fdb_ver) {
warn "$My_name: File-database '$in_name' is of too new version, $1 > $fdb_ver\n";
return 1;
}
$state = 0;
}
# Ignore blank lines and comments
if ( /^$/ || /^#/ || /^%/ ) { next LINE;}
if ( /^\[\"([^\"]+)\"\]/ ) {
# Start of section
$rule = $1;
my $tail = $'; #' Single quote in comment tricks the parser in
# emacs from misparsing an isolated single quote
$run_time = $check_time = 0;
$source = $dest = $base = '';
$old_actives{$rule} = 1;
if ( $tail =~ /^\s*(\S+)\s*$/ ) {
$run_time = $1;
}
elsif ( $tail =~ /^\s*(\S+)\s+\"([^\"]*)\"\s+\"([^\"]*)\"\s+\"([^\"]*)\"\s*$/ ) {
$run_time = $1;
$source = $2;
$dest = $3;
$base = $4;
}
elsif ( $tail =~ /^\s*(\S+)\s+\"([^\"]*)\"\s+\"([^\"]*)\"\s+\"([^\"]*)\"\s+(\S+)\s*$/ ) {
$run_time = $1;
$source = $2;
$dest = $3;
$base = $4;
$check_time = $5;
}
if ( rdb_rule_exists( $rule ) ) {
rdb_one_rule( $rule, \&rdb_read_set_rule );
}
elsif ($rule =~ /^cusdep\s+(\S+)\s+(\S+)\s+(.+)$/ ) {
# Create custom dependency
my $fromext = $1;
my $toext = $2;
my $base = $3;
$source = "$base.$fromext";
# $dest = "$base.$toext";
my $func_name = '';
foreach my $dep ( @cus_dep_list ) {
my ($tryfromext,$trytoext,$must,$try_func_name) = split('\s+',$dep);
if ( ($tryfromext eq $fromext) && ($trytoext eq $toext) ) {
$func_name = $try_func_name;
}
}
if ($func_name) {
my $PAnew_cmd = ['do_cusdep', $func_name];
# Set source file as non-existent.
# If it existed on last run, it will be in later
# lines of the fdb file
rdb_create_rule( $rule, 'cusdep', '', $PAnew_cmd, 1,
$source, $dest, $base, 0, $run_time, $check_time, 1 );
}
else {
warn "$My_name: In file-database '$in_name', the custom-dependency rule\n",
" '$rule' is not available in this session.\n",
" Presumably it's no longer in your configuration for latexmk.\n";
$state = 10;
next LINE;
}
}
elsif ( $rule =~ /^(makeindex|bibtex|biber)\s*(.*)$/ ) {
my $PA_extra_gen = [];
my $rule_generic = $1;
my $int_cmd = '';
if ( ! $source ) {
# If fdb_file was old-style (v. 1)
$source = $2;
my $path = '';
my $ext = '';
($base, $path, $ext) = fileparseA( $source );
$base = $path.$base;
if ($rule_generic eq 'makeindex') {
$dest = "$base.ind";
}
elsif ($rule_generic eq 'bibtex') {
$dest = "$base.bbl";
$source = "$base.aux";
}
elsif ($rule_generic eq 'biber') {
$dest = "$base.bbl";
$source = "$base.bcf";
}
}
if ($rule =~ /^makeindex/) { $PA_extra_gen = [ "$base.ilg" ]; }
if ($rule =~ /^(bibtex|biber)/) { $PA_extra_gen = [ "$base.blg" ]; }
if ($rule =~ /^bibtex/) { $int_cmd = "run_bibtex"; }
warn "$My_name: File-database '$in_name': setting rule '$rule'\n"
if $diagnostics;
my $cmd_type = 'external';
my $ext_cmd = ${$rule_generic};
warn " Rule kind = '$rule_generic'; ext_cmd = '$ext_cmd';\n",
" int_cmd = '$int_cmd';\n",
" source = '$source'; dest = '$dest'; base = '$base';\n"
if $diagnostics;
# Set source file as non-existent.
# If it existed on last run, it will be in later
# lines of the fdb file
rdb_create_rule( $rule, $cmd_type, $ext_cmd, $int_cmd, 1,
$source, $dest, $base, 0, $run_time, $check_time, 1, $PA_extra_gen );
}
else {
if ($diagnostics) {
warn "$My_name: In file-database '$in_name' rule '$rule'\n",
" is not in use in this session\n";
}
$new_source = undef;
$state = 10;
next LINE;
}
$new_source = $new_sources{$rule} = {};
$state = 1; #Reading a section, source part
}
elsif ( ($state <=0) || ($state >= 3) ) {
next LINE;
}
elsif ( /^\(source\)/ ) { $state = 1; next LINE; }
elsif ( /^\(generated\)/ ) { $state = 2; next LINE; }
elsif ( ($state == 1) && /^\"([^\"]*)\"\s+(\S+)\s+(\S+)\s+(\S+)\s+\"([^\"]*)\"/ ) {
# Source file line
my $file = $1;
my $time = $2;
my $size = $3;
my $md5 = $4;
my $from_rule = $5;
#?? print " --- File '$file'\n";
if ($state != 1) {
warn "$My_name: In file-database '$in_name' ",
"line $. is outside a section:\n '$_'\n";
$errors++;
next LINE;
}
# Set file in database. But ensure we don't do an unnecessary
# fdb_get, which can trigger a new MD5 calculation, which is
# lengthy for a big file. Ininitially flagging the file
# as non-existent solves the problem:
rdb_ensure_file( $rule, $file, undef, 1 );
rdb_set_file1( $rule, $file, $time, $size, $md5 );
fdb_set( $file, $time, $size, $md5 );
# Save the rest of the data, especially the from_rule until we know all
# the rules, otherwise the from_rule may not exist.
# Also we'll have a better chance of looping through files.
${$new_source}{$file} = [ $time, $size, $md5, $from_rule ];
}
elsif ( ($state == 2) && /^\"([^\"]*)\"/ ) {
my $file = $1;
rdb_one_rule( $rule, sub{ rdb_add_generated($file); } );
}
else {
warn "$My_name: In file-database '$in_name' ",
"line $. is of wrong format:\n '$_'\n";
$errors++;
next LINE;
}
}
undef $in_handle;
# Set cus dependencies.
&rdb_set_dependents( keys %rule_db );
&rdb_set_rule_net;
return $errors;
} # END rdb_read
#************************************************************
sub rdb_read_set_rule {
# Rule context assumed. Implicit passing of $dest, $run_time, $check_time,
# $in_name used as local variables in calling routine rdb_read;
if ($$Ptest_kind == 3) { $$Ptest_kind = 1; }
$$Prun_time = $run_time;
$$Pcheck_time = $check_time;
# Deal with possibility that destination in fdb_latexmk has different name
# than the default one. The only case that concerns us is where
# the extension is changed (by \pdfoutput, e.g., in tex file). But
# it is possible out and aux directories have been chosen differently,
# and the user choice there MUST OVERRIDE the value in the fdb_latexmk file.
if ($dest ne $$Pdest) {
if (! $possible_primaries{$rule} ) {
warn "$My_name: In reading rule '$rule' in '$in_name',\n",
" name of destination file is not current one; I'll flag rule as out of date.\n";
$$Pout_of_date = 10;
}
elsif ( ! rdb_is_active($rule) ) {
warn "$My_name: In reading rule '$rule' in '$in_name',\n",
" rule is not currently active.\n";
# No fixup now. Causes to be analyzed:
# Change of requested files: no action needed.
# Obeying of metacommand: not implemented yet.
}
else {
# Get here if rule is active and primary and destination is different
warn "$My_name: In reading rule '$rule' in '$in_name',\n",
" destination has different name than configured...\n";
my ($oldbase, $oldpath, $oldext) = fileparseA( $dest );
my ($newbase, $newpath, $newext) = fileparseA( $$Pdest );
if ($oldext ne $newext) {
if ( ! exists $allowed_output_ext{$oldext} ) {
warn " Old extension '$oldext' not allowed.\n";
$$Pout_of_date = 10;
}
else {
warn " ===== CHANGING output type from '$newext' to '$oldext' in '$rule'\n";
my $switch_error = switch_output( $oldext, $newext );
if ($switch_error) {
warn " I could not accommodate the changed output extension\n",
" (either because the configuration does not allow it\n",
" or because there is a conflict with requested filetypes).\n",
"===> There may be subsequent warnings, which may or may not be ignorable.\n",
"===> If necessary, clean out generated files and try again\n";
}
}
}
if ( ($oldbase ne $newbase) || ($oldpath ne $newpath) ) {
# There are further issues (e.g., change of out_dir).
# Need rerun to correct:
$$Pout_of_date = 10;
}
}
}
} #END rdb_read_set_rule
#************************************************************
sub rdb_write {
# Call: rdb_write( $out_name )
# Writes to the given file name the database of file and rule data
# for all rules needed to make final output
# Returns 1 on success, 0 if file couldn't be opened.
local $out_name = $_[0];
local $out_handle = new FileHandle;
if ( ($out_name eq "") || ($out_name eq "-") ) {
# Open STDOUT
$out_handle->open( '>-' );
}
else {
$out_handle->open( $out_name, '>' );
}
if (!$out_handle) { return 0; }
&rdb_set_rule_net;
print $out_handle "# Fdb version $fdb_ver\n";
my @rules = sort &rdb_accessible;
rdb_for_some(
\@rules,
sub {
# Omit data on a unused and never-run primary rule:
if ( ($$Prun_time == 0)
&& exists( $possible_primaries{$rule} )
&& ! exists( $current_primaries{$rule} )
)
{
return;
}
print $out_handle "[\"$rule\"] $$Prun_time \"$$Psource\" \"$$Pdest\" \"$$Pbase\" $$Pcheck_time\n";
rdb_do_files(
sub { print $out_handle " \"$file\" $$Ptime $$Psize $$Pmd5 \"$$Pfrom_rule\"\n"; }
);
print $out_handle " (generated)\n";
foreach (keys %$PHdest) {
print $out_handle " \"$_\"\n";
}
}
);
undef $out_handle;
return 1;
} #END rdb_write
#************************************************************
sub rdb_set_latex_deps {
# Assume rule context.
# This is intended to be applied only for a primary (LaTeX-like) rule.
# Set its dependents etc, using information from log, aux, and fls files.
# Use fls file only if $recorder is set, and the fls file was generated
# on this run.
# N.B. A complication which we try and handle in determining
# dependent files is that there may be aliasing of file names,
# especially when characters are used in file and directory
# names that are not pure 7-bit-ASCII. Here is a list of some
# of the difficulties that do arise, between, on the one hand,
# the filenames specified on latexmk's and the cwd found by
# latexmk from the system, and, on the other hand, the filenames
# and their components reported by (pdf)latex in the fls and log
# files:
# 1. Whether the separator of path components is / or \ in
# MSWin.
# 2. Whether the LFN or the SFN is provided.
# 3. Whether the filenames include the cwd or whether they
# are relative to the current directory.
# 4. Under cygwin, whether the absolute filenames are
# specified by UNIX or native MSWin conventions.
# (With cygin, the programs used, including the Perl that
# executes latexmk, can be any combination of native MSWin
# programs and cygwin programs with their UNIX-like
# behavior.)
# 5. Whether UTF-8 or some other coding is used, and under
# which circumstances: e.g., in calls to the OS to access
# files, in files output by programs, on latexmk's command
# line, on other programs' command lines, by the command
# interpreterS.
# 6. If UTF-8 is used, what kind of canonicalization is used,
# if any. (This is a particular bugbear when files are
# transferred between different OSes.)
# 7. Whether the name of a file in the current directory is
# reported as the simple filename or whether it is
# preceeded by ".\" or "./".
# 8. How is it determined whether a pathname is absolute or
# relative? An absolute pathname in MSWin may start with
# a drive letter and a colon, but under UNIX-type systems,
# the colon is an ordinary character.
# 9. Whether a filename reported in an fls or log file can be
# used as is by perl to access a file, or on the command
# line to invoke another program, and whether the use on a
# command line depends on whether the command line is
# executed by a CLI, and by which CLI. (E.g., cmd.exe,
# v. sh v. tcsh, etc.)
# 10. Whether such a filename for the filename on (pdf)latex's
# file agrees with the one on the command line.
# The above questions have arisen from actual experiences and
# tests.
#
# In any case, when determining dependent files, we will try to
# remove an initial directory string from filenames found in the
# fls and log files, whenever it denotes the current
# directory. The directory string may be an absolute pathname,
# such as MiKTeX writes in both fls and log files, or it may be
# simply "./" as given by TeXLive in its log file. There are
# several reasons for removing a directory string when possible:
#
# 1. To avoid having multiple names referring to the same
# file in the list of dependents.
# 2. Because the name may be in a different coding. Thus
# under MSWin 7, cmd.exe and perl (by default) work in an
# "ANSI" coding with some code page, but the filenames
# written by MiKTeX are UTF-8 coded (and if they are non-ASCII
# can't be used for file-processing by Perl without some
# trouble). This is a particular problem if the pathname
# contains non-ASCII characters; the directory names may not
# even be under the user's control, unlike typical filenames.
# 3. When it comes to filenames that are then used in calls to
# bibtex and makeindex, it is bad to use absolute pathnames
# instead of clearly relative pathnames, because the default
# security settings are to prohibit writing files to the
# corresponding directories, which makes the calls to these
# programs unnecessarily fail.
#
# In removing unnecessary directory-specifying strings, to
# convert a filename to a simple specification relative to the
# current directory, it will be important to preferentially use
# a determination of the current directory from the file being
# processed. In the fls file, there is normally a PWD line. In
# the log file, if (pdf)latex is started with a filename instead
# of a command-executing first line, then this can be determined
# from the first few lines of the log file -- see parse_log.
# This gives a more reliable determination of the relevant path
# string; this is especially important in cases where there is a
# mismatch of coding of the current directory, particularly
# notable in the above-mentioned case of non-ASCII characters
# under MSWin. Other inconsistencies happen when there is a
# mixure of cygwin and native MSWin software. There can also be
# inconsistencies between whether the separator of pathname
# components is "/" or "\". So we will allow for this. The
# necessary normalizations of filenames are handled by the
# subroutines normalize_filename and normalize_clean_filename.
#
# I have not tried to handle the (currently rare) cases that the
# OS is neither UNIX-like nor MSWin-like.
#
# Assumption: the list of generated files in %PHdest was already initialized earlier.
# In principle, I should do it here, but useful possibilities (e.g.,
# see pythontex-latexmk) for subroutine called to process a .tex to add items to
# %PHdest. So initializing here is too late.
# Rules should only be primary
if ( $$Pcmd_type ne 'primary' ) {
warn "\n$My_name: ==========$My_name: Probable BUG======= \n ",
" rdb_set_latex_deps called to set files ",
"for non-primary rule '$rule'\n\n";
return;
}
#?? # We'll prune this by all files determined to be needed for source files.
#?? my %unneeded_source = %$PHsource;
# Parse fls and log files to find relevant filenames
# Result in the following variables:
local %dependents = (); # Maps files to status
local @bbl_files = ();
local %idx_files = (); # Maps idx_file to (ind_file, base)
local %generated_log = (); # Lists generated files found in log file
local %generated_fls = (); # Lists generated files found in fls file
local %source_fls = (); # Lists source files found in fls file
local %first_read_after_write = (); # Lists source files that are only read
# after being written (so are not true
# source files.
local $primary_out = $$Pdest; # output file (dvi or pdf)
local %conversions = (); # (pdf)latex-performed conversions.
# Maps output file created and read by (pdf)latex
# to source file of conversion.
local @missing_subdirs = (); # Missing subdirectories in aux_dir
local $pwd_latex = undef; # Cwd as reported in fls file by (pdf)latex
local %created_rules = (); # Maps files to rules existing or created to
# make them. Use to avoid misunderstood
# dependencies when a package creates a
# missing file during *latex compliation
# instead of just allowing to be made later
# by another rule.
# The following are also returned by parsing routines, but are global,
# to be used by caller:
# $reference_changed, $bad_reference, $bad_character, $bad_citation, $mult_defined
# Do I have my own eps-to-pdf conversion?
my $epspdf_cusdep = 0;
foreach (@cus_dep_list) {
if ( /^eps pdf / ) { $epspdf_cusdep = 1; last; }
}
# Analyze fls file first. It tells us the working directory as seen by (pdf)latex
# But we'll use the results later, so that they take priority over the findings
# from the log file.
local $fls_file_analyzed = 0;
if ($recorder && test_gen_file($fls_name) ) {
$fls_file_analyzed =
(0== parse_fls( $fls_name, \%source_fls, \%generated_fls, \%first_read_after_write, \$pwd_latex ));
if (! $fls_file_analyzed ) {
warn "$My_name: fls file '$fls_name' appears to have been made but it couldn't be opened.\n";
}
}
&parse_log;
$missing_dirs = 'none'; # Status of missing directories
if (@missing_subdirs) {
$missing_dirs = 'success';
if ($allow_subdir_creation) {
foreach my $dir ( uniqs( @missing_subdirs ) ) {
if ( -d $dir ) {
$missing_dirs = 'failure';
warn "$My_name: ==== Directory '$dir' is said to be missing\n",
" But it exists!\n";
}
elsif ( (-e $dir) && (!-d $dir) ) {
$missing_dirs = 'failure';
warn "$My_name: ==== Directory '$dir' is said to be missing\n",
" But a non-directory file of this name exists!\n";
}
else {
if (mkdir $dir) {
warn "$My_name: Directory '$dir' created\n";
}
else {
$missing_dirs = 'failure';
warn "$My_name: Couldn't create directory '$dir'.\n",
" System error: '$!'\n";
}
}
}
}
else {
$missing_dirs = 'not allowed';
warn "$My_name: There are missing subdirectories, but their creation\n",
" is not allowed. The subdirectories are:\n";
foreach my $dir ( uniqs( @missing_subdirs ) ) {
warn " '$dir'\n";
}
}
}
# Use results from fls file. (N.B. The hashes will be empty if the fls file
# wasn't used/analyzed, so we don't need a test as to whether the fls file was
# used.
foreach (keys %source_fls) {
if (! -e ) {
# File is listed in .fls file as read, but doesn't exist now.
# Therefore it is not a true source file, surely.
# Sometimes this is caused by a bug (e.g., lualatex in TeXLive 2016,
# 2017) when there is an incorrect line in .fls file. (This
# would deserve a warning.)
# But sometimes (e.g., with minted package), the file could be
# created during a run, read, and then deleted.
next;
}
$dependents{$_} = 4;
if ( /\.bbl$/ ) { push @bbl_files, $_; }
}
foreach (keys %generated_fls) {
if (! -e ) {
# File is listed in .fls file as written, but doesn't exist now.
# Therefore it is not a true externally visible generated file.
# (Typically, e.g., with the minted package, it is a temporary
# file created during a run and then deleted during the run.)
next;
}
rdb_add_generated( $_ );
if ( exists($dependents{$_}) ) {
$dependents{$_} = 6;
}
}
for my $conv (sort keys %conversions) {
my $conv_source = $conversions{$conv};
if ( $conv =~ /^(.*)-eps-converted-to\.pdf$/ ) {
# Check all the conditions for pdflatex's conversion eps to pdf
# are valid; if they are, treat the converted file as not a
# source file.
my $base = $1;
if ( (-e $conv_source) && (-e $conv) && ( $conv_source eq "$base.eps" ) ) {
# $conv isn't a real source of (pdf)latex
rdb_remove_files( $rule, $conv );
delete $dependents{$conv};
if ($epspdf_cusdep) {
$dependents{"$base.pdf"} = ((-e "$base.pdf") ? 4 : 0 );
}
}
}
}
# ?? !! Should also deal with .run.xml file
# Handle result on output file:
# 1. Non-existent output file, which is because of no content.
# This could either be because the source file has genuinely
# no content, or because of a missing input file. Since a
# missing input file might be correctable by a run of some
# other program whose running is provoked AFTER a run of
# (pdf)latex, we'll set a diagnostic and leave it to the
# rdb_make to handle after all circular dependencies are
# resolved.
# 2. The output file might be of a different kind than expected
# (i.e., dvi instead of pdf, or vv). This could
# legitimately occur when the source file (or an invoked
# package or class) sets \pdfoutput.
$missing_dvi_pdf = '';
if ($primary_out eq '') {
warn "$My_name: For rule '$rule', no output was made\n";
$missing_dvi_pdf = $$Pdest;
}
elsif ($primary_out ne normalize_filename($$Pdest) ) {
my ($actual_base, $actual_path, $actual_ext) = fileparseA( $primary_out );
my ($intended_base, $intended_path, $intended_ext) = fileparseA( $$Pdest );
if ( $actual_ext ne $intended_ext ) {
warn "$My_name: ===For rule '$rule', the extensions differ between the\n",
" actual output file '$primary_out',\n",
" and the expected output '$$Pdest'.\n";
if ( ! exists $allowed_output_ext{$actual_ext} ) {
warn " Actual output file has an extension '$actual_ext' that\n",
" is not one I know about. I cannot handle this\n";
}
else {
my $switch_error = switch_output( $actual_ext, $intended_ext );
if ( $switch_error ) {
warn " I could not accommodate the changed output extension\n",
" (either because the configuration does not allow it\n",
" or because there is a conflict with requested filetypes).\n";
$failure = 1;
$failure_msg = 'Could not handle change of output extension';
}
else {
warn " Rule structure will be changed suitably.\n";
}
}
}
}
IDX_FILE:
foreach my $idx_file ( keys %idx_files ) {
my ($ind_file, $ind_base) = @{$idx_files{$idx_file}};
my $from_rule = "makeindex $idx_file";
if ( ! rdb_rule_exists( $from_rule ) ){
print "!!!===Creating rule '$from_rule': '$ind_file' from '$idx_file'\n"
if ($diagnostics);
rdb_create_rule( $from_rule, 'external', $makeindex, '', 1,
$idx_file, $ind_file, $ind_base, 1, 0, 0, 1, [ "$ind_base.ilg" ] );
print " ===Source file '$ind_file' for '$rule'\n"
if ($diagnostics);
rdb_ensure_file( $rule, $ind_file, $from_rule );
}
# Make sure the .ind file is treated as a detected source file;
# otherwise if the log file has it under a different name (as
# with MiKTeX which gives full directory information), there
# will be problems with the clean-up of the rule concerning
# no-longer-in-use source files:
$dependents{$ind_file} = 4;
if ( ! -e $ind_file ) {
# Failure was non-existence of makable file
# Leave failure issue to other rules.
$failure = 0;
}
$created_rules{$ind_file} = $from_rule;
}
local %processed_aux_files = ();
BBL_FILE:
foreach my $bbl_file ( uniqs( @bbl_files ) ) {
my ($bbl_base, $bbl_path, $bbl_ext) = fileparseA( $bbl_file );
$bbl_base = $bbl_path.$bbl_base;
my @new_bib_files = ();
my @new_aux_files = ();
my @new_bst_files = ();
my @biber_source = ( "$bbl_base.bcf" );
my $bib_program = 'bibtex';
if ( test_gen_file( "$bbl_base.bcf" ) ) {
$bib_program = 'biber';
}
my $from_rule = "$bib_program $bbl_base";
print "======= Dealing with '$from_rule'\n" if ($diagnostics);
# Don't change to use activation and deactivation here, rather than
# creation and removal of rules. This is because rules are to be
# created on the fly here with details corresponding to current. So
# activating a previously inactive rule, which is out-of-date, may
# cause trouble.
if ($bib_program eq 'biber') {
check_biber_log( $bbl_base, \@biber_source );
# Remove OPPOSITE kind of bbl generation:
rdb_remove_rule( "bibtex $bbl_base" );
}
else {
parse_aux( "$bbl_base.aux", \@new_bib_files, \@new_aux_files, \@new_bst_files );
# Remove OPPOSITE kind of bbl generation:
rdb_remove_rule( "biber $bbl_base" );
}
if ( ! rdb_rule_exists( $from_rule ) ){
print " ===Creating rule '$from_rule'\n" if ($diagnostics);
if ( $bib_program eq 'biber' ) {
rdb_create_rule( $from_rule, 'external', $biber, '', 1,
"$bbl_base.bcf", $bbl_file, $bbl_base, 1, 0, 0, 1, [ "$bbl_base.blg" ] );
}
else {
rdb_create_rule( $from_rule, 'external', $bibtex, 'run_bibtex', 1,
"$bbl_base.aux", $bbl_file, $bbl_base, 1, 0, 0, 1, [ "$bbl_base.blg" ] );
}
}
$created_rules{$bbl_file} = $from_rule;
local %old_sources = ();
rdb_one_rule( $from_rule, sub { %old_sources = %$PHsource; } );
my @new_sources = ( @new_bib_files, @new_aux_files, @new_bst_files );
if ( $bib_program eq 'biber' ) {
push @new_sources, @biber_source;
}
foreach my $source ( @new_sources ) {
print " ===Source file '$source' for '$from_rule'\n"
if ($diagnostics);
rdb_ensure_file( $from_rule, $source );
delete $old_sources{$source};
}
foreach my $source ( @new_aux_files ) {
$processed_aux_files{$source} = 1;
}
if ($diagnostics) {
foreach ( keys %old_sources ) {
print "Removing no-longer-needed dependent '$_' from rule '$from_rule'\n";
}
}
rdb_remove_files( $from_rule, keys %old_sources );
print " ===Source file '$bbl_file' for '$rule'\n"
if ($diagnostics);
rdb_ensure_file( $rule, $bbl_file, $from_rule );
if ( ! -e $bbl_file ) {
# Failure was non-existence of makable file
# Leave failure issue to other rules.
$failure = 0;
}
}
if ( ($#aux_hooks > -1) && ! exists $processed_aux_files{$aux_main} ) {
my @new_bib_files = ();
my @new_aux_files = ();
my @new_bst_files = ();
parse_aux( $aux_main, \@new_bib_files, \@new_aux_files, \@new_bst_files );
foreach my $source ( @new_aux_files ) {
$processed_aux_files{$source} = 1;
}
}
NEW_SOURCE:
foreach my $new_source (keys %dependents) {
print " ===Source file for rule '$rule': '$new_source'\n"
if ($diagnostics);
if ( exists $first_read_after_write{$new_source} ) {
if ( dep_at_start($new_source) ) {
#warn "--- READ ONLY AFTER WRITE OF '$new_source'\n";
$dependents{$new_source} = 7;
}
else {
#warn "--- READ ONLY AFTER CREATE OF '$new_source'\n";
$dependents{$new_source} = 6;
}
}
if ( ($dependents{$new_source} == 5)
|| ($dependents{$new_source} == 6)
) {
# (a) File was detected in "No file..." line in log file.
# Typically file was searched for early in run of
# latex/pdflatex, was not found, and then was written
# later in run.
# or (b) File was written during run.
# In both cases, if file doesn't already exist in database, we
# don't know its previous status. Therefore we tell
# rdb_ensure_file that if it needs to add the file to its
# database, then the previous version of the file should be
# treated as non-existent, to ensure another run is forced.
rdb_ensure_file( $rule, $new_source, undef, 1 );
}
elsif ( $dependents{$new_source} == 7 ) {
# File was result of conversion by (pdf)latex.
my $cnv_source = $conversions{$new_source};
rdb_ensure_file( $rule, $new_source );
# if ($cnv_source && ($cnv_source !~ /\"/ ) ) {
if ($cnv_source ) {
# Conversion from $cnv_source to $new_source
# implies that effectively $cnv_source is a source
# of the (pdf)latex run.
rdb_ensure_file( $rule, $cnv_source );
}
# Flag that changes of the generated file during a run
# do not require a rerun:
rdb_one_file( $new_source, sub{ $$Pcorrect_after_primary = 1; } );
}
else {
# But we don't need special precautions for ordinary user files
# (or for files that are generated outside of latex/pdflatex).
rdb_ensure_file( $rule, $new_source );
}
if ( ($dependents{$new_source} == 6)
|| ($dependents{$new_source} == 7)
) {
rdb_add_generated($new_source);
}
}
# Some packages (e.g., bibtopic) generate a dummy error-message-providing
# bbl file when a bbl file does not exist. Then the fls and log files
# show the bbl file as created by the primary run and hence as a
# generated file. Since we now have a rule to create a real bbl file,
# the information in the fls and log files no longer represents a
# correct dependency, so the bbl file is to be removed from the
# generated files.
foreach (keys %created_rules) { rdb_remove_generated( $_ ); }
my @more_sources = &rdb_set_dependents( $rule );
my $num_new = $#more_sources + 1;
foreach (@more_sources) {
$dependents{$_} = 4;
if ( ! -e $_ ) {
# Failure was non-existence of makable file
# Leave failure issue to other rules.
$failure = 0;
$$Pchanged = 1; # New files can be made. Ignore error.
}
}
if ($diagnostics) {
if ($num_new > 0 ) {
print "$num_new new source files for rule '$rule':\n";
foreach (@more_sources) { print " '$_'\n"; }
}
else {
print "No new source files for rule '$rule':\n";
}
my @first_read_after_write = sort keys %first_read_after_write;
if ($#first_read_after_write >= 0) {
print "The following files were only read after being written:\n";
foreach (@first_read_after_write) {
print " '$_'\n";
}
}
}
my @files_not_needed = ();
foreach (keys %$PHsource) {
if ( ! exists $dependents{$_} ) {
print "Removing no-longer-needed dependent '$_' from rule '$rule'\n"
if $diagnostics;
push @files_not_needed, $_;
}
}
rdb_remove_files( $rule, @files_not_needed );
} # END rdb_set_latex_deps
#************************************************************
sub switch_output {
# Assume rule context for primary rule
# Return 0 on success, non-zero error code on failure
my ( $actual_ext, $intended_ext ) = @_;
if ( $actual_ext eq $intended_ext) { return 0; }
if ( ! $can_switch ) { return 1; }
if ( $intended_ext eq '.dvi' ) {
rdb_deactivate_derequest( 'dvipdf', 'pspdf' );
}
elsif ( $intended_ext eq '.xdv' ) {
rdb_deactivate_derequest( 'xdvipdfmx' );
}
else { }
if ( $actual_ext eq '.dvi' ) {
rdb_activate_request( 'dvipdf' );
$input_extensions{$rule} = $standard_input_extensions{latex};
}
elsif ( $actual_ext eq '.xdv' ) {
rdb_activate_request( 'xdvipdfmx' );
$input_extensions{$rule} = $standard_input_extensions{xelatex};
}
else {
$input_extensions{$rule} = $standard_input_extensions{pdflatex};
}
my $old_dest = $$Pdest;
my $new_dest = $$Pdest;
$new_dest =~ s/$intended_ext$/$actual_ext/;
# Compensate for MiKTeX's behavior: dvi and pdf are put in out_dir, but xdv is put in aux_dir:
if ( ($actual_ext eq '.xdv') && ($out_dir ne $aux_dir) ){ $new_dest =~ s/^$out_dir1/$aux_dir1/; }
if ( ($intended_ext eq '.xdv') && ($out_dir ne $aux_dir) ){ $new_dest =~ s/^$aux_dir1/$out_dir1/; }
rdb_change_dest( $new_dest );
# Some fixes to avoid spurious error conditions:
$switched_primary_output = 1;
if (-e $$Pdest) {
$missing_dvi_pdf = '';
if ($$Plast_result == 1 ) { $$Plast_result = 0; }
}
else { $missing_dvi_pdf = $$Pdest; }
return 0;
} #END switch_output
#************************************************************
sub test_gen_file {
# Usage: test_gen_file( filename )
# Tests whether the file was generated during a run of (pdf)latex.
# Assumes context for primary rule.
# Two kinds of test are used:
# a. From %generated_log, which works after the log file has been parsed,
# but only for certain files and for those TeX engines (not MiKTeX)
# that put \openout lines in log file.
# b. By the file existing and being at least as new as the system
# time at the start of the run. But we allow for a measured
# offset between filetime and system time, which could be
# nonzero if the file is on a different, remote system than the
# one running latexmk. We must also allow a threshold in the
# comparisons of filetimes to allow for the inaccuracy of the
# offset measurement.
my $file = shift;
return exists $generated_log{$file}
|| ( -e $file && ( get_mtime( $file ) >= $$Prun_time + $filetime_offset - $filetime_causality_threshold));
}
#************************************************************
sub dep_at_start {
# Usage: dep_at_start( filename )
# Tests whether the file was source file and existed at start of run.
# Assumes context for primary rule.
my $time = undef;
rdb_one_file( shift, sub{ $time = $$Ptime; } );
return (defined $time) && ($time != 0);
}
#************************************************************
sub rdb_find_new_files {
# Call: rdb_find_new_files
# Assumes rule context for primary rule.
# Deal with files which were missing and for which a method
# of finding them has become available:
# (a) A newly available source file for a custom dependency.
# (b) When there was no extension, a file with appropriate
# extension
# (c) When there was no extension, and a newly available source
# file for a custom dependency can make it.
my %new_includes = ();
MISSING_FILE:
foreach my $missing ( keys %$PHsource ) {
next if ( $$PHsource{$missing} != 0 );
my ($base, $path, $ext) = fileparseA( $missing );
$ext =~ s/^\.//;
if ( -e "$missing.tex" ) {
$new_includes{"$missing.tex"} = 1;
}
elsif ( -e $missing ) {
$new_includes{$missing} = 1;
}
elsif ( $ext ne "" ) {
foreach my $dep (@cus_dep_list){
my ($fromext,$toext) = split('\s+',$dep);
if ( ( "$ext" eq "$toext" )
&& ( -e "$path$base.$fromext" )
) {
# Source file for the missing file exists
# So we have a real include file, and it will be made
# next time by rdb_set_dependents
$new_includes{$missing} = 1;
}
else {
# no point testing the $toext if the file doesn't exist.
}
next MISSING_FILE;
}
}
else {
# $_ doesn't exist, $_.tex doesn't exist,
# and $_ doesn't have an extension
foreach my $dep (@cus_dep_list){
my ($fromext,$toext) = split('\s+',$dep);
if ( -e "$path$base.$fromext" ) {
# Source file for the missing file exists
# So we have a real include file, and it will be made
# next time by &rdb__dependents
$new_includes{"$path$base.$toext"} = 1;
# next MISSING_FILE;
}
if ( -e "$path$base.$toext" ) {
# We've found the extension for the missing file,
# and the file exists
$new_includes{"$path$base.$toext"} = 1;
# next MISSING_FILE;
}
}
}
} # end MISSING_FILES
# Sometimes bad line-breaks in log file (etc) create the
# impression of a missing file e.g., ./file, but with an incorrect
# extension. The above tests find the file with an extension,
# e.g., ./file.tex, but it is already in the list. So now I will
# remove files in the new_include list that are already in the
# include list. Also handle aliasing of file.tex and ./file.tex.
# For example, I once found:
# (./qcdbook.aux (./to-do.aux) (./ideas.aux) (./intro.aux) (./why.aux) (./basics
#.aux) (./classics.aux)
my $found = 0;
foreach my $file (keys %new_includes) {
# if ( $file =~ /\"/ ) {next; }
my $stripped = $file;
$stripped =~ s{^\./}{};
if ( exists $PHsource{$file} ) {
delete $new_includes{$file};
}
else {
$found ++;
rdb_ensure_file( $rule, $file );
}
}
if ( $diagnostics && ( $found > 0 ) ) {
warn "$My_name: Detected previously missing files:\n";
foreach ( sort keys %new_includes ) {
warn " '$_'\n";
}
}
return $found;
} # END rdb_find_new_files
#************************************************************
sub rdb_set_dependents {
# Call rdb_set_dependents( rules ...)
# Returns array (sorted), of new source files.
local @new_sources = ();
local @deletions = ();
# Shouldn't recurse. The definite rules to be examined are given.
rdb_for_some( [@_], 0, \&rdb_one_dep );
# OLD rdb_recurse( [@_], 0, \&rdb_one_dep );
foreach (@deletions) {
my ($rule, $file) = @$_;
rdb_remove_files( $rule, $file );
}
&rdb_make_links;
return uniqs( @new_sources );
} #END rdb_set_dependents
#************************************************************
sub rdb_find_source_file {
# Helper for searching dependencies in all paths inside the TEXINPUTS
# environment variable.
my $test = "$_[0].$_[1]";
if ( -e $test ) {
return $_[0];
}
if ( exists $ENV{TEXINPUTS} ) {
foreach my $searchpath (split $search_path_separator, $ENV{TEXINPUTS}) {
my $file = File::Spec->catfile($searchpath,$_[0]);
my $test = "$file.$_[1]";
if ( -e $test ) {
return $file;
}
}
}
return "$_[0]";
}
#************************************************************
sub rdb_one_dep {
# Helper for finding dependencies. One case, $rule and $file given
# Assume file (and rule) context for DESTINATION file.
# Only look for dependency if $rule is primary rule (i.e., latex
# or pdflatex) or is a custom dependency:
if ( (! exists $possible_primaries{$rule}) && ($rule !~ /^cusdep/) ) {
return;
}
#print "=============ONE_DEP: '$rule' '$file'\n";
local $new_dest = $file;
my ($base_name, $path, $toext) = fileparseA( $new_dest );
$base_name = $path.$base_name;
$toext =~ s/^\.//;
my $Pinput_extensions = $input_extensions{$rule};
DEP:
foreach my $dep ( @cus_dep_list ) {
my ($fromext,$proptoext,$must,$func_name) = split('\s+',$dep);
if ( $toext eq $proptoext ) {
$base_name = rdb_find_source_file($base_name, $fromext);
my $source = "$base_name.$fromext";
# Found match of rule
if ($diagnostics) {
print "Found cusdep: $source to make $rule:$new_dest ====\n";
}
if ( -e $source ) {
$$Pfrom_rule = "cusdep $fromext $toext $base_name";
my $new_new_dest = "$base_name.$toext";
if ($new_new_dest ne $new_dest) {
rdb_ensure_file( $rule, $new_new_dest );
$new_dest = $new_new_dest;
}
local @PAnew_cmd = ( 'do_cusdep', $func_name );
if ( !-e $new_dest ) {
push @new_sources, $new_dest;
}
if (! rdb_rule_exists( $$Pfrom_rule ) ) {
print "$My_name: === Creating rule '$$Pfrom_rule'\n" if $diagnostics;
rdb_create_rule( $$Pfrom_rule, 'cusdep', '', \@PAnew_cmd, 3,
$source, $new_dest, $base_name, 0 );
}
return;
}
else {
# Source file does not exist
if ( !$force_mode && ( $must != 0 ) ) {
# But it is required that the source exist ($must !=0)
$failure = 1;
$failure_msg = "File '$base_name.$fromext' does not exist ".
"to build '$base_name.$toext'";
return;
}
elsif ( $$Pfrom_rule =~ /^cusdep $fromext $toext / ) {
# Source file does not exist, destination has the rule set.
# So turn the from_rule off
$$Pfrom_rule = '';
}
else {
}
}
}
elsif ( ($toext eq '')
&& (! -e $file )
&& (! -e "$base_name.$proptoext" )
&& exists $$Pinput_extensions{$proptoext}
) {
# Empty extension and non-existent destination
# This normally results from \includegraphics{A}
# without graphics extension for file, when file does
# not exist. So we will try to find something to make it.
$base_name = rdb_find_source_file($base_name, $fromext);
my $source = "$base_name.$fromext";
if ( -e $source ) {
$new_dest = "$base_name.$proptoext";
my $from_rule = "cusdep $fromext $proptoext $base_name";
push @new_sources, $new_dest;
print "Ensuring rule for '$from_rule', to make '$new_dest'\n"
if $diagnostics > -1;
local @PAnew_cmd = ( 'do_cusdep', $func_name );
if (! rdb_rule_exists( $from_rule ) ) {
print "$My_name: === Creating rule '$$Pfrom_rule'\n" if $diagnostics;
rdb_create_rule( $from_rule, 'cusdep', '', \@PAnew_cmd, 3,
$source, $new_dest, $base_name, 0 );
}
rdb_ensure_file( $rule, $new_dest, $from_rule );
# We've now got a spurious file in our rule. But don't mess
# with deleting an item we are in the middle of!
push @deletions, [$rule, $file];
return;
}
} # End of Rule found
} # End DEP
if ( (! -e $file) && $use_make_for_missing_files ) {
# Try to make the missing file
#Set character to surround filenames in commands:
my $q = $quote_filenames ? '"' : '';
if ( $toext ne '' ) {
print "$My_name: '$rule': source file '$file' doesn't exist. I'll try making it...\n";
&Run_subst( "$make $q$file$q" );
if ( -e $file ) {
return;
}
}
else {
print "$My_name: '$rule': source '$file' doesn't exist.\n",
" I'll try making it with allowed extensions \n";
foreach my $try_ext ( keys %$Pinput_extensions ) {
my $new_dest = "$file.$try_ext";
&Run_subst( "$make $q$new_dest$q" );
if ( -e $new_dest ) {
print "SUCCESS in making '$new_dest'\n";
# Put file in rule, without a from_rule, but
# set its state as non-existent, to correspond
# to file's state before the file was made
# This ensures a rerun of (pdf)latex is provoked.
rdb_ensure_file( $rule, $new_dest, undef, 1 );
push @new_sources, $new_dest;
push @deletions, [$rule, $file];
# Flag need for a new run of (pdf)latex despite
# the error due to a missing file.
$$Pout_of_date_user = 1;
return;
}
}
}
}
} #END rdb_one_dep
#************************************************************
sub rdb_list {
# Call: rdb_list()
# List rules and their source files
print "===Rules:\n";
local $count_rules = 0;
my @accessible_all = &rdb_accessible;
rdb_for_some(
\@accessible_all,
sub{ $count_rules++;
print "Rule '$rule' depends on:\n";
},
sub{ print " '$file'\n"; },
sub{ print " and generates:\n";
foreach (keys %$PHdest) { print " '$_'\n"; }
# print " default_extra_generated:\n";
# foreach (@$PA_extra_gen) { print " '$_'\n"; }
},
);
if ($count_rules <= 0) {
print " ---No rules defined\n";
}
} #END rdb_list
#************************************************************
sub deps_list {
# Call: deps_list(fh)
# List dependent files to file open on fh
my $fh = $_[0];
print $fh "#===Dependents, and related info, for $filename:\n";
my @dest_exts = ();
if ($pdf_mode) {push @dest_exts, '.pdf';}
if ($dvi_mode) {push @dest_exts, '.dvi';}
if ($postscript_mode) {push @dest_exts, '.ps';}
my %source = ( $texfile_name => 1 );
my @generated = ();
my @accessible_all = &rdb_accessible;
rdb_for_some(
\@accessible_all,
sub{ push @generated, keys %$PHdest; },
sub{ $source{$file} = 1; }
);
foreach (keys %generated_exts_all) {
(my $name = /%R/ ? $_ : "%R.$_") =~ s/%R/${aux_dir1}${root_filename}/;
push @generated, $name;
}
show_array( "Generated:", @generated ) if $diagnostics;
foreach (@generated) {
delete $source{$_};
}
show_array( "Sources:", keys %source ) if $diagnostics;
foreach my $ext (@dest_exts) {
# Don't insert name of deps file in targets.
# The previous behavior of inserting the name of the deps file
# matched the method recommended by GNU make for automatically
# generated prerequisites -- see Sec. "Generating Prerequisites
# Automatically" of GNU make manual (v. 4.2). But this can
# cause problems in complicated cases, and as far as I can see,
# it doesn't actually help, despite the reasoning given.
# The only purpose of the deps file is to to determine source
# files for a particular rule. The files whose changes make the
# deps file out-of-date are the same as those that make the real
# target file (e.g., .pdf) out-of-date. So the GNU method seems
# completely unnecessary.
print $fh "${out_dir1}${root_filename}${ext} :";
foreach (sort keys %source) {
print $fh "\\\n $_";
}
print $fh "\n";
}
print $fh "#===End dependents for $filename:\n";
if ($dependents_phony) {
print $fh "\n#===Phony rules for $filename:\n\n";
foreach (sort keys %source) {
print $fh "$_ :\n\n";
}
print $fh "#===End phony rules for $filename:\n";
}
} #END deps_list
#************************************************************
sub rdb_show {
# Call: rdb_show()
# Displays contents of rule data base.
# Side effect: Exercises access routines!
print "===Rules:\n";
local $count_rules = 0;
rdb_for_actives(
sub{ $count_rules++;
my @int_cmd = @$PAint_cmd;
foreach (@int_cmd) {
if ( !defined($_) ) { $_='undef';}
}
print " [$rule]: '$$Pcmd_type' '$$Pext_cmd' '@int_cmd' $$Ptest_kind ",
"'$$Psource' '$$Pdest' '$$Pbase' $$Pout_of_date $$Pout_of_date_user\n"; },
sub{ print " '$file': $$Ptime $$Psize $$Pmd5 '$$Pfrom_rule'\n"; }
);
if ($count_rules <= 0) {
print " ---No rules defined\n";
}
} #END rdb_show
#************************************************************
sub rdb_target_array {
# Returns array of all rules implicated by %target_rules and %target_files
my %rules = &rdb_target_hash;
return keys %rules;
} # End rdb_target_array
#************************************************************
sub rdb_target_hash {
# Returns hash mapping to 1 all rules implicated by %target_rules and %target_files
my %rules = %target_rules;
foreach (keys %target_files) {
if (exists $from_rules{$_}) { $rules{$from_rules{$_}} = 1; }
}
return %rules;
} # End rdb_target_hash
#************************************************************
sub rdb_accessible {
# Call: &rdb_accessible
# Returns array of rules accessible from target rules and rules to make target files
local %accessible_rules = &rdb_target_hash;
rdb_recurse( [keys %accessible_rules], sub{ $accessible_rules{$rule} = 1; } );
return keys %accessible_rules;
} #END rdb_accessible
#************************************************************
#************************************************************
#************************************************************
sub rdb_make {
# Call: &rdb_make
# Makes the targets and prerequisites.
# Leaves one-time rules to last.
# Does appropriate repeated makes to resolve dependency loops
# Returns 0 on success, nonzero on failure.
# General method: Find all accessible rules, then repeatedly make
# them until all accessible rules are up-to-date and the source
# files are unchanged between runs. On termination, all
# accessible rules have stable source files.
#
# One-time rules are view and print rules that should not be
# repeated in an algorithm that repeats rules until the source
# files are stable. It is the calling routine's responsibility to
# arrange to call them, or to use them here with caution.
#
# Note that an update-viewer rule need not be considered
# one-time. It can be legitimately applied everytime the viewed
# file changes.
#
# Note also that the criterion of stability is to be applied to
# source files, not to output files. Repeated application of a
# rule to IDENTICALLY CONSTANT source files may produce different
# output files. This may be for a trivial reason (e.g., the
# output file contains a time stamp, as in the header comments for
# a typical postscript file), or for a non-trivial reason (e.g., a
# stochastic algorithm, as in abcm2ps).
#
# This caused me some actual trouble. In general, circular
# dependencies produce non-termination, and the the following
# situation is an example of a generic situation where certain
# rules must be obeyed in order to obtain proper results:
# 1. A/the latex source file contains specifications for
# certain postprocessing operations. Standard (pdf)latex
# already has this, for indexing and bibliography.
# 2. In the case in point that caused me trouble, the
# specification was for musical tunes that were contained
# in external source files not directly input to
# (pdf)latex. But in the original version, there was a
# style file (abc.sty) that caused latex itself to call
# abcm2ps to make .eps files for each tune that were to be
# read in on the next run of latex.
# 3. Thus the specification can cause a non-terminating loop
# for latexmk, because the output files of abcm2ps changed
# even with identical input.
# 4. The solution was to
# a. Use a style file abc_get.sty that simply wrote the
# specification on the tunes to the .aux file in a
# completely deterministic fashion.
# b. Instead of latex, use a script abclatex.pl that runs
# latex and then extracts the abc contents for each tune
# from the source abc file. This is also
# deterministic.
# c. Use a cusdep rule in latexmk to convert the tune abc
# files to eps. This is non-deterministic, but only
# gets called when the (deterministic) source file
# changes.
# This solves the problem. Latexmk works. Also, it is no
# longer necessary to enable write18 in latex, and multiple
# unnecessary runs of abcm2ps are no longer used.
#
# The order of testing and applying rules is chosen by the
# following heuristics:
# 1. Both latex and pdflatex may be used, but the resulting
# aux files etc may not be completely identical. Define
# latex and pdflatex as primary rules. Apply the general
# method of repeated circulating through all rules until
# the source files are stable for each primary rule
# separately. Naturally the rules are all accessible
# rules, but excluding primary rules except for the current
# primary.
# 2. Assume that the primary rules are relatively
# time-consuming, so that unnecessary passes through them
# to check stability of the source files should be avoided.
# 3. Assume that although circular dependencies exist, the
# rules can nevertheless be thought of as basically
# non-circular, and that many rules are strictly or
# normally non-circular. In particular cusdep rules are
# typically non-circular (e.g., fig2eps), as are normal
# output processing rules like dvi2ps.
# 4. The order for the non-circular approximation is
# determined by applying the assumption that an output file
# from one rule that is read in for an earlier stage is
# unchanged.
# HOWEVER, at a first attempt, the ordering is not needed. It
# only gives an optimization
# 5. (Note that these assumptions could be violated, e.g., if
# $dvips is arranged not only to do the basic dvips
# command, but also to extract information from the ps file
# and feed it back to an input file for (pdf)latex.)
# 6. Nevertheless, the overall algorithm should allow
# circularities. Then the general criterion of stability
# of source files covers the general case, and also
# robustly handles the case that the USER changes source
# files during a run. This is particularly important in
# -pvc mode, given that a full make on a large document can
# be quite lengthy in time, and moreover that a user
# naturally wishes to make corrections in response to
# errors, particularly latex errors, and have them apply
# right away.
# This leads to the following approach:
# 1. Classify accessible rules as: primary, pre-primary
# (typically cusdep, bibtex, makeindex, etc), post-primary
# (typically dvips, etc), and one-time
# 2. Then stratify the rules into an order of application that
# corresponds to the basic feedforward structure, with the
# exclusion of one-time rules.
# 3. Always require that one-time rules are among the
# explicitly requested rules, i.e., the last to be applied,
# were we to apply them. Anything else would not match the
# idea of a one-time rule.
# 4. Then work as follows:
# a. Loop over primaries
# b. For each primary, examine each pre-primary rule and
# apply if needed, then the primary rule and then each
# post-primary rule. The ordering of the pre-primary
# and post-primary rules was found in step 2.
# BUT applying the ordering is not essential
# c. Any time that a pre-primary or primary rule is
# applied, loop back to the beginning of step b. This
# ensures that bibtex etc are applied before rerunning
# (pdf)latex, and also covers changing source files, and
# gives priority to quick pre-primary rules for changing
# source files against slow reruns of latex.
# d. Then apply post-primary rules in order, but not
# looping back after each rule. This non-looping back
# is because the rules are normally feed-forward only.
# BUT applying the ordering is not essential
# e. But after completing post-primary rules do loop back
# to b if any rules were applied. This covers exotic
# circular dependence (and as a byproduct, changing
# source files).
# f. On each case of looping back to b, re-evaluate the
# dependence setup to allow for the effect of changing
# source files.
#
&rdb_set_rule_net;
local %pass = ();
local $failure = 0; # General accumulated error flag
local $missing_dvi_pdf = ''; # Did primary run fail to make its output file?
local $runs = 0;
local $too_many_passes = 0;
local %rules_applied = ();
local $switched_primary_output = 0;
my $retry_msg = 0; # Did I earlier say I was going to attempt
# another pass after a failure?
foreach my $rule (keys %rule_db) {
$pass{$rule} = 0;
}
PASS:
while (1==1) {
# Exit condition at end of body of loop.
$runs = 0;
$switched_primary_output = 0;
my $previous_failure = $failure;
$failure = 0;
local $newrule_nofile = 0; # Flags whether rule created for
# making currently non-existent file, which
# could become a needed source file for a run
# and therefore undo an error condition
foreach my $rule (keys %rule_db) {
# Update %pass in case new rules have been created
if (! exists $pass{$rule} ) { $pass{$rule} = 0; }
}
if ($diagnostics) {
print "Make: doing pre_primary and primary...\n";
}
# Do the primary run if it is needed. On return $runs == 0
# signals that nothing was run (and hence no output
# files changed), either because no input files
# changed and no run was needed, or because the
# number of passes through the rule exceeded the
# limit. In the second case $too_many_runs is set.
rdb_for_some( [@pre_primary, $current_primary], \&rdb_make1 );
if ($switched_primary_output) {
print "=========SWITCH OF OUTPUT WAS DONE.\n";
next PASS;
}
if ( ($runs > 0) && ! $too_many_passes ) {
$retry_msg = 0;
if ( $force_mode || (! $failure) || $switched_primary_output ) {
next PASS;
}
# Get here on failure, without being in force_mode
if ( $newrule_nofile ) {
$retry_msg = 1;
print "$My_name: Error on run, but found possibility to ",
"make new source files\n";
next PASS;
}
else { last PASS; }
}
if ($runs == 0) {
# $failure not set on this pass, so use value from previous pass:
$failure = $previous_failure;
if ($retry_msg) {
print "But in fact no new files made\n";
}
if ($failure && !$force_mode ) { last PASS; }
}
if ( $missing_dvi_pdf ) {
# No output from primary, after completing circular dependence
warn "Failure to make '$missing_dvi_pdf'\n";
$failure = 1;
last PASS;
}
if ($diagnostics) {
print "Make: doing post_primary...\n";
}
rdb_for_some( [@post_primary], \&rdb_make1 );
if ( ($runs == 0) || $too_many_passes ) {
# If $too_many_passes is set, it should also be that
# $runs == 0; but for safety, I also checked
# $too_many_passes.
last PASS;
}
}
continue {
# Re-evaluate rule classification and accessibility,
# but do not change primaries.
# Problem is that %current_primaries gets altered
&rdb_set_rule_net;
} #End PASS
rdb_for_some( [@unusual_one_time], \&rdb_make1 );
rdb_write( $fdb_name );
if ($#primary_warning_summary > -1) {
# N.B. $mult_defined, $bad_reference, $bad_character, $bad_citation also available here.
show_array( "$My_name: Summary of warnings from last run of (pdf)latex:",
@primary_warning_summary );
}
if (! $silent) {
if ($failure && $force_mode) {
print "$My_name: Errors, in force_mode: so I tried finishing targets\n";
}
elsif ($failure) {
print "$My_name: Errors, so I did not complete making targets\n";
}
else {
local @dests = ();
rdb_for_some( [@_], sub{ push @dests, $$Pdest if ($$Pdest); } );
print "$My_name: All targets (@dests) are up-to-date\n";
}
}
return $failure;
} #END rdb_make
#-------------------
sub rdb_show_rule_errors {
local @errors = ();
local @warnings = ();
rdb_for_actives(
sub{
if ($$Plast_message ne '') {
if ($$Plast_result == 200) {
push @warnings, "$rule: $$Plast_message";
}
else {
push @errors, "$rule: $$Plast_message";
}
}
elsif ($$Plast_result == 1) {
push @errors, "$rule: failed to create output file";
}
elsif ($$Plast_result == 2) {
push @errors, "$rule: gave an error";
}
elsif ($$Prun_time == 0) {
# This can have innocuous causes. So don't report
}
}
);
if ($#warnings > -1) {
warn "Collected warning summary (may duplicate other messages):\n";
foreach (@warnings){
warn " $_\n";
}
}
if ($#errors > -1) {
warn "Collected error summary (may duplicate other messages):\n";
foreach (@errors){
warn " $_\n";
}
}
return $#errors+1;
}
#-------------------
sub rdb_make1 {
# Call: rdb_make1
# Helper routine for rdb_make.
# Carries out make at level of given rule (all data available).
# Assumes contexts for recursion, make, and rule, and
# assumes that source files for the rule are to be considered
# up-to-date.
if ($diagnostics) { print " Make1 $rule\n"; }
if ($failure & ! $force_mode) {return;}
if ( ! defined $pass{$rule} ) {$pass{$rule} = 0; }
# Special fix up for bibtex:
my $bibtex_not_run = -1; # Flags status as to whether this is a
# bibtex rule and if it is, whether out-of-date condition is to
# be ignored.
# -1 => not a bibtex rule
# 0 => no special treatment
# 1 => don't run bibtex because of non-existent bibfiles
# (and setting to do this test)
# 2 => don't run bibtex because of setting
my @missing_bib_files = ();
if ( $rule =~ /^(bibtex|biber)/ ) {
$bibtex_not_run = 0;
if ($bibtex_use == 0) {
$bibtex_not_run = 2;
}
elsif ( ($bibtex_use == 1) || ($bibtex_use == 1.5) ) {
foreach ( keys %$PHsource ) {
if ( ( /\.bib$/ ) && (! -e $_) ) {
push @missing_bib_files, $_;
$bibtex_not_run = 1;
}
}
}
}
if ( ($$Prun_time == 0) && exists($possible_primaries{$rule}) ) {
push @rules_never_run, $rule;
$$Pout_of_date = 1;
$$Plast_result = -1;
}
else {
if ( $$Pdest && (! -e $$Pdest) ) {
# With a non-existent destination, if we haven't made any passes
# through a rule, rerunning the rule is good, because the file
# may fail to exist because of being deleted by the user (for ex.)
# rather than because of a failure on a previous run.
# (We could do better with a flag in fdb file.)
# But after the first pass, the situation is different.
# For a primary rule (pdf)latex, the lack of a destination file
# could result from there being zero content due to a missing
# essential input file. The input file could be generated
# by a program to be run later (e.g., a cusdep or bibtex),
# so we should wait until all passes are completed before
# deciding a non-existent destination file is an error.
# For a custom dependency, the rule may be obsolete, and
# if the source file does not exist also, we should simply
# not run the rule, but not set an error condition.
# Any error will arise at the (pdf)latex level due to a
# missing source file at that level.
if ( $$Psource && (! -e $$Psource)
&& ( ( $$Pcmd_type ne 'primary') )
) {
# Main source file doesn't exist, and rule is NOT primary.
# No action, since a run is pointless. Primary is different:
# file might be found elsewhere (by kpsearch from (pdf)latex),
# while non-existence of main source file is a clear error.
}
elsif ( $$Pcmd_type eq 'delegated' ) {
# Delegate to destination rule
}
elsif ( $pass{$rule}==0) {
push @no_dest, $$Pdest;
$$Pout_of_date = 1;
}
if ( $$Pcmd_type eq 'primary' ) {
$missing_dvi_pdf = $$Pdest;
}
}
}
&rdb_clear_change_record;
&rdb_flag_changes_here(0);
if (!$$Pout_of_date) {
return;
}
if ($diagnostics) { print " remake\n"; }
if (!$silent) {
print "$My_name: applying rule '$rule'...\n";
&rdb_diagnose_changes( "Rule '$rule': " );
}
# We are applying the rule, so its source file state for when it
# was last made is as of now:
# ??IS IT CORRECT TO DO NOTHING IN CURRENT VERSION?
# The actual run
my $return = 0; # Return code from called routine
# Rule may have been created since last run:
if ( ! defined $pass{$rule} ) {$pass{$rule} = 0; }
if ( $pass{$rule} >= $max_repeat ) {
# Avoid infinite loop by having a maximum repeat count
# Getting here represents some kind of weird error.
warn "$My_name: Maximum runs of $rule reached ",
"without getting stable files\n";
$too_many_passes = 1;
# Treat rule as completed, else in -pvc mode get infinite reruns:
$$Pout_of_date = 0;
$failure = 1;
$failure_msg = "'$rule' needed too many passes";
return;
}
$rules_applied{$rule} = 1;
$runs++;
$pass{$rule}++;
if ($bibtex_not_run > 0) {
if ($bibtex_not_run == 1 ) {
show_array ("$My_name: I WON'T RUN '$rule' because I don't find the following files:",
@missing_bib_files);
}
elsif ($bibtex_not_run == 2 ) {
warn "$My_name: I AM CONFIGURED/INVOKED NOT TO RUN '$rule'\n";
}
$return = &rdb_dummy_run1;
}
else {
warn_running( "Run number $pass{$rule} of rule '$rule'" );
if ($$Pcmd_type eq 'primary' ) {
$return = &rdb_primary_run;
}
else { $return = &rdb_run1; }
}
if ($$Pchanged) {
$newrule_nofile = 1;
$return = 0;
}
elsif ( $$Pdest && ( !-e $$Pdest ) && (! $failure) ){
# If there is a destination to make, but for some reason
# it did not get made, and no other error was reported,
# then a priori there appears to be an error condition:
# the run failed. But there are some important cases in
# which this is a wrong diagnosis.
if ( ( $$Pcmd_type eq 'cusdep') && $$Psource && (! -e $$Psource) ) {
# However, if the rule is a custom dependency, this is not by
# itself an error, if also the source file does not exist. In
# that case, we may have the situation that (1) the dest file is no
# longer needed by the tex file, and (2) therefore the user
# has deleted the source and dest files. After the next
# latex run and the consequent analysis of the log file, the
# cusdep rule will no longer be needed, and will be removed.
# So in this case, do NOT report an error
$$Pout_of_date = 0;
}
elsif ($$Pcmd_type eq 'primary' ) {
# For a primary rule, i.e., (pdf)latex, not to produce the
# expected output file may not be an error condition.
# Diagnostics were handled in parsing the log file.
# Special action in main loop in rdb_make
$missing_dvi_pdf = $$Pdest;
}
elsif ($return == -2) {
# Missing output file was reported to be NOT an error
$$Pout_of_date = 0;
}
elsif ( ($bibtex_use <= 1.5) && ($bibtex_not_run > 0) ) {
# Lack of destination file is not to be treated as an error
# for a bibtex rule when latexmk is configured not to treat
# this as an error, and the lack of a destination file is the
# only error.
$$Pout_of_date = 0;
}
else {
$failure = 1;
}
}
if ( ($return != 0) && ($return != -2) ) {
$failure = 1;
$$Plast_result = 2;
if ( !$$Plast_message ) {
$$Plast_message = "Run of rule '$rule' gave a non-zero error code";
}
# !!?? $failure_msg = $$Plast_message;
}
} #END rdb_make1
#************************************************************
sub rdb_classify_rules {
# Usage: &rdb_classify_rules
# Assume the following variables are available (global or local):
# Input:
# %target_rules # Set to target rules
# %target_files # Set to target files
# %possible_primaries
# Output:
# %current_primaries # Keys are actual primaries
# @pre_primary # Array of rules
# @post_primary # Array of rules
# @unusual_one_time # Array of rules
# @pre_primary and @post_primary are in natural order of application.
local @requested_targets = &rdb_target_array;
local $state = 0; # Post-primary
local @classify_stack = ();
%current_primaries = ();
@pre_primary = ();
@post_primary = ();
@unusual_one_time = ();
rdb_recurse( \@requested_targets, \&rdb_classify1, 0,0, \&rdb_classify2 );
# Reverse, as tendency is to find last rules first.
@pre_primary = reverse @pre_primary;
@post_primary = reverse @post_primary;
my @current_primaries = keys %current_primaries;
if ($#current_primaries < 0) {
die "$My_name: No active primary rules found. I have to stop.\n";
}
elsif ($#current_primaries > 0) {
die "$My_name: More than one active primary rule found. I have to stop.\n",
" Primary rules: @current_primaries\n";
}
$current_primary = $current_primaries[0];
if ($diagnostics) {
print "Rule classification: \n";
if ($#requested_targets < 0) {
print " No requested rules\n";
}
else {
print " Requested rules:\n";
foreach ( @requested_targets ) { print " $_\n"; }
}
if ($#pre_primary < 0) {
print " No pre-primaries\n";
}
else {
print " Pre-primaries:\n";
foreach (@pre_primary) { print " $_\n"; }
}
print " Primaries:\n";
foreach (keys %current_primaries) { print " $_\n"; }
if ($#post_primary < 0) {
print " No post-primaries\n";
}
else {
print " Post-primaries:\n";
foreach (@post_primary) { print " $_\n"; }
}
if ($#unusual_one_time < 0) {
print " No inner-level one_time rules, as expected\n";
}
else {
print " Inner-level one_time rules:\n";
foreach ( @unusual_one_time ) { print " $_\n"; }
}
my @normal_one_time = keys %one_time;
if ($#normal_one_time < 0) {
print " No outer-level one_time rules\n";
}
else {
print " Outer-level one_time rules:\n";
foreach ( @normal_one_time ) { print " $_\n"; }
}
} #end diagnostics
} #END rdb_classify_rules
#-------------------
sub rdb_classify1 {
# Helper routine for rdb_classify_rules
# Applied as rule_act1 in recursion over rules
# Assumes rule context, and local variables from rdb_classify_rules
push @classify_stack, [$state];
if ( exists $possible_one_time{$rule} ) {
# Normally, we will have already extracted the one_time rules,
# and they will never be accessed here. But just in case of
# problems or generalizations, we will cover all possibilities:
if ($depth > 1) {
warn "ONE TIME rule not at outer level '$rule'\n";
}
push @unusual_one_time, $rule;
}
elsif ($state == 0) {
if ( exists $possible_primaries{$rule} ) {
$state = 1; # In primary rule
$current_primaries{ $rule } = 1;
}
else {
push @post_primary, $rule;
}
}
else {
$state = 2; # in post-primary rule
push @pre_primary, $rule;
}
} #END rdb_classify1
#-------------------
sub rdb_classify2 {
# Helper routine for rdb_classify_rules
# Applied as rule_act2 in recursion over rules
# Assumes rule context
($state) = @{ pop @classify_stack };
} #END rdb_classify2
#************************************************************
sub rdb_run1 {
# Assumes contexts for: rule.
# Unconditionally apply the rule
# Returns return code from applying the rule.
# Otherwise: 0 on other kind of success,
# -1 on error,
# -2 when missing dest_file is to be ignored
# Source file data, by definition, correspond to the file state just
# before the latest run, and the run_time to the time just before the run:
&rdb_update_files;
$$Prun_time = time();
$$Pchanged = 0; # No special changes in files
$$Plast_result = 0;
$$Plast_message = '';
# Return values for external command:
my $return = 0;
# Find any internal command
my @int_args = @$PAint_cmd;
my $int_cmd = shift @int_args;
my @int_args_for_printing = @int_args;
foreach (@int_args_for_printing) {
if ( ! defined $_ ) { $_ = 'undef'; }
}
if ($int_cmd) {
print "For rule '$rule', running '\&$int_cmd( @int_args_for_printing )' ...\n";
$return = &$int_cmd( @int_args );
}
elsif ($$Pext_cmd) {
$return = &Run_subst() / 256;
}
else {
warn "$My_name: Either a bug OR a configuration error:\n",
" No command provided for '$rule'\n";
&traceback();
$return = -1;
$$Plast_result = 2;
$$Plast_message = "Bug or configuration error; incorrect command type";
}
if ( $rule =~ /^biber/ ) {
my @biber_source = ( );
my $retcode = check_biber_log( $$Pbase, \@biber_source );
foreach my $source ( @biber_source ) {
# if ( $source =~ /\"/ ) {next; }
print " ===Source file '$source' for '$rule'\n"
if ($diagnostics);
rdb_ensure_file( $rule, $source );
}
if ($retcode == 5) {
# Special treatment if sole missing file is bib file
# I don't want to treat that as an error
$return = 0;
$$Plast_result = 200;
$$Plast_message = "Could not find bib file for '$$Pbase'";
push @warnings, "Bib file not found for '$$Pbase'";
}
elsif ($retcode == 6) {
# Missing control file. Need to remake it (if possible)
# Don't treat missing bbl file as error.
warn "$My_name: bibtex control file missing. Since that can\n",
" be recreated, I'll try to do so.\n";
$return = -2;
rdb_for_some( [keys %current_primaries], sub{ $$Pout_of_date = 1; } );
}
elsif ($retcode == 4) {
$$Plast_result = 2;
$$Plast_message = "Could not find all biber source files for '$$Pbase'";
push @warnings, "Not all biber source files found for '$$Pbase'";
}
elsif ($retcode == 3) {
$$Plast_result = 2;
$$Plast_message = "Could not open biber log file for '$$Pbase'";
push @warnings, $$Plast_message;
}
elsif ($retcode == 2) {
$$Plast_message = "Biber errors: See file '$$Pbase.blg'";
push @warnings, $$Plast_message;
}
elsif ($retcode == 1) {
push @warnings, "Biber warnings for '$$Pbase'";
}
elsif ($retcode == 10) {
push @warnings, "Biber found no citations for '$$Pbase'";
# Biber doesn't generate a bbl file in this situation.
$return = -2;
}
elsif ($retcode == 11) {
push @warnings, "Biber: malformed bcf file for '$$Pbase'. IGNORE";
if (!$silent) {
warn "$My_name: biber found malformed bcf file for '$$Pbase'.\n",
" I'll ignore error, and delete any bbl file.\n";
}
# Malformed bcf file is a downstream consequence, normally,
# of an error in (pdf)latex run. So this is not an error
# condition in biber itself.
# Current version of biber deletes bbl file.
# Older versions (pre-2016) made an incorrect bbl file, which
# tended to cause latex errors, and give a self-perpetuating error.
# To be safe, ensure the bbl file doesn't exist.
unlink $$Pdest;
# The missing bbl file is now not an error:
$return = -2;
# ??????? BCF
# Following is intended to work, but creates infinite loop
# in malformed bcf file situation under -pvc.
# since on each check for change in ANY file, pvc finds changed file
# Need to restrict pvc reruns to case of changed USER files
# # To give good properties for (pdf)latex rule, it is best
# # to have a valid bbl file that exists:
# create_empty_file( $$Pdest );
# $return = 0;
}
}
if ( $rule =~ /^bibtex/ ) {
my $retcode = check_bibtex_log($$Pbase);
if ( ! -e $$Psource ) {
$retcode = 10;
rdb_for_some( [keys %current_primaries], sub{ $$Pout_of_date = 1; } );
}
if ($retcode == 3) {
$$Plast_result = 2;
$$Plast_message = "Could not open bibtex log file for '$$Pbase'";
push @warnings, $$Plast_message;
}
elsif ($retcode == 2) {
$$Plast_message = "Bibtex errors: See file '$$Pbase.blg'";
$failure = 1;
push @warnings, $$Plast_message;
}
elsif ($retcode == 1) {
push @warnings, "Bibtex warnings for '$$Pbase'";
}
elsif ($retcode == 10) {
push @warnings, "Bibtex found no citations for '$$Pbase',\n",
" or bibtex found a missing aux file\n";
if (! -e $$Pdest ) {
warn "$My_name: Bibtex did not produce '$$Pdest'. But that\n",
" was because of missing files, so I will continue.\n";
$return = -2;
}
else {
$return = 0;
}
}
}
$updated = 1;
if ($$Ptest_kind == 3) {
# We are time-criterion first time only. Now switch to
# file-change criterion
$$Ptest_kind = 1;
}
$$Pout_of_date = $$Pout_of_date_user = 0;
if ( ($$Plast_result == 0) && ($return != 0) && ($return != -2) ) {
$$Plast_result = 2;
if ($$Plast_message eq '') {
$$Plast_message = "Command for '$rule' gave return code $return";
if ($rule =~ /^(pdf|lua|xe|)latex/) {
$$Plast_message .= "\n Refer to '$log_name' for details";
}
elsif ($rule =~ /^makeindex/) {
$$Plast_message .= "\n Refer to '${aux_dir1}${root_filename}.ilg' for details";
}
}
}
elsif ( $$Pdest && (! -e $$Pdest) && ($return != -2) ) {
$$Plast_result = 1;
}
return $return;
} # END rdb_run1
#-----------------
sub rdb_dummy_run1 {
# Assumes contexts for: rule.
# Update rule state as if the rule ran successfully,
# but don't run the rule.
# Returns 0 (success code)
# Source file data, by definition, correspond to the file state just before
# the latest run, and the run_time to the time just before the run:
&rdb_update_files;
$$Prun_time = time();
$$Pchanged = 0; # No special changes in files
$$Plast_result = 0;
$$Plast_message = '';
if ($$Ptest_kind == 3) {
# We are time-criterion first time only. Now switch to
# file-change criterion
$$Ptest_kind = 1;
}
$$Pout_of_date = $$Pout_of_date_user = 0;
return 0;
} # END rdb_dummy_run1
#-----------------
sub Run_subst {
# Call: Run_subst( cmd, msg, options, source, dest, base )
# Runs command with substitutions.
# If an argument is omitted or undefined, it is replaced by a default:
# cmd is the command to execute
# msg is whether to print a message:
# 0 for not, 1 according to $silent setting, 2 always
# options, source, dest, base: correspond to placeholders.
# Substitutions:
# %S=source, %D=dest, %B=base, %R=root=base for latex, %O=options,
# %T=texfile, %Y=$aux_dir1, %Z=$out_dir1
# This is a globally usable subroutine, and works in a rule context,
# and outside.
# Defaults:
# cmd: $PPext_cmd if defined, else '';
# msg: 1
# options: ''
# source: $$Psource if defined, else $texfile_name;
# dest: $$Pdest if defined, else $view_file, else '';
# base: $$Pbase if defined, else $root_filename;
my ($ext_cmd, $msg, $options, $source, $dest, $base ) = @_;
$ext_cmd ||= ( $Pext_cmd ? $$Pext_cmd : '' );
$msg = ( defined $msg ? $msg : 1 );
$options ||= '';
$source ||= ( $Psource ? $$Psource : $texfile_name );
$dest ||= ( $Pdest ? $$Pdest : ( $view_file || '' ) );
$base ||= ( $Pbase ? $$Pbase : $root_filename );
if ( $ext_cmd eq '' ) {
return 0;
}
#Set character to surround filenames:
my $q = $quote_filenames ? '"' : '';
my %subst = (
'%A' => $q.$tex_basename.$q,
'%B' => $q.$base.$q,
'%D' => $q.$dest.$q,
'%O' => $options,
'%S' => $q.$source.$q,
'%R' => $q.$root_filename.$q,
'%S' => $q.$source.$q,
'%T' => $q.$texfile_name.$q,
'%Y' => $q.$aux_dir1.$q,
'%Z' => $q.$out_dir1.$q,
'%%' => '%' # To allow literal %B, %R, etc, by %%B.
);
if ($pre_tex_code) {
$subst{'%U'} = $q.$pre_tex_code.$q;
$subst{'%P'} = "$q$pre_tex_code\\input{$source}$q";
}
else {
$subst{'%U'} = '';
$subst{'%P'} = $subst{'%S'};
}
if ( ($^O eq "MSWin32" ) && $MSWin_back_slash ) {
foreach ( '%R', '%B', '%T', '%S', '%D', '%Y', '%Z' ) {
$subst{$_} =~ s(/)(\\)g;
}
}
my @tokens = split /(%.)/, $ext_cmd;
foreach (@tokens) {
if (exists($subst{$_})) { $_ = $subst{$_}; }
}
$ext_cmd = join '', @tokens;
my ($pid, $return) =
( ($msg == 0) || ( ($msg == 1) && $silent ) )
? &Run($ext_cmd)
: &Run_msg($ext_cmd);
return $return;
} #END Run_subst
#-----------------
sub rdb_primary_run {
#?? See multipass_run in previous version Aug 2007 for issues
# Call: rdb_primary_run
# Assumes contexts for: recursion, make, & rule.
# Assumes (a) the rule is a primary,
# (b) a run has to be made,
# (c) source files have been made.
# This routine carries out the run of the rule unconditionally,
# and then parses log file etc.
my $return = 0;
if ( ! $filetime_offset_measured ) {
$filetime_offset = get_filetime_offset( $aux_dir1."tmp" );
if ( (abs($filetime_offset) > $filetime_offset_report_threshold)
&& ($diagnostics || ! $silent) )
{
warn "$My_name: I am working around an offset relative to my system time by\n",
" $filetime_offset secs for file times in directory '$aux_dir1'.\n";
}
$filetime_offset_measured = 1;
}
# Need to reset the list of generated files. If we don't it can contain
# out-of-date items from previous run. (Think bibtopic, which writes
# bbl files!)
&rdb_initialize_generated;
my $return_latex = &rdb_run1;
# Need to worry about changed directory, changed output extension
# Where else is $missing_dvi_pdf set? Was it initialized?
if (-e $$Pdest) { $missing_dvi_pdf = '';}
# Handle case that log file is caused to be in an unexpected place,
# from a configuration error:
&find_set_log;
if ($recorder) {
# Handle problem that some version of (pdf)latex give fls files
# of name latex.fls or pdflatex.fls instead of $root_filename.fls.
# Also that setting of -output-directory -aux-directory is not
# respected by (pdf)latex, at least in some versions.
my $std_fls_file = $fls_name;
my @other_fls_names = ( );
if ( $rule =~ /^pdflatex/ ) {
push @other_fls_names, "pdflatex.fls";
}
else {
push @other_fls_names, "latex.fls";
}
if ( $aux_dir1 ne '' ) {
push @other_fls_names, "$root_filename.fls";
# MiKTeX uses out_dir for .fls. However, it seems logical to
# me for .fls to be in aux_dir. So I'll allow for this
# Possibility, although I don't know if it has been used.
push @other_fls_names, "$aux_dir1$root_filename.fls";
}
# Find the first non-standard fls file and copy it to the standard
# place. But only do this if the file time is compatible with being
# generated in the current run, and if the standard fls file hasn't
# been made in the current run, as tested by the use of
# test_gen_file; that avoids problems with fls files leftover from
# earlier runs with other versions of latex.
if ( ! test_gen_file( $std_fls_file ) ) {
foreach my $cand (@other_fls_names) {
if ( test_gen_file( $cand ) ) {
copy $cand, $std_fls_file;
last;
}
}
}
if ( ! test_gen_file( $std_fls_file ) ) {
warn "$My_name: fls file doesn't appear to have been made.\n";
}
}
# Find current set of source files:
&rdb_set_latex_deps;
# For each file of the kind made by epstopdf.sty during a run,
# if the file has changed during a run, then the new version of
# the file will have been read during the run. Unlike the usual
# case, we will NOT need to redo the primary run because of the
# change of this file during the run. Therefore set the file as
# up-to-date:
rdb_do_files( sub { if ($$Pcorrect_after_primary) {&rdb_update1;} } );
$updated = 1; # Flag that some dependent file has been remade
#?? # Fix the state of the files as of now: this will solve the
#?? # problem of latex and pdflatex interfering with each other,
#?? # at the expense of some non-optimality
#?? #?? Check this is correct:
#?? &rdb_update_files;
if ( $diagnostics ) {
print "$My_name: Rules after run: \n";
rdb_show();
}
$return = $return_latex;
# ???? Is the following needed?
if ($return_latex && $$Pout_of_date_user) {
print "Error in (pdf)LaTeX, but change of user file(s), ",
"so ignore error & provoke rerun\n"
if (! $silent);
$return = 0;
}
# Summarize issues that may have escaped notice:
@primary_warning_summary = ();
if ($bad_reference) {
push @primary_warning_summary,
"Latex failed to resolve $bad_reference reference(s)";
}
if ($mult_defined) {
push @primary_warning_summary,
"Latex found $mult_defined multiply defined reference(s)";
}
if ($bad_character) {
push @primary_warning_summary,
"=====Latex reported missing or unavailable character(s).\n".
"=====See log file for details.";
}
if ($bad_citation) {
push @primary_warning_summary,
"Latex failed to resolve $bad_citation citation(s)";
}
if ( $diagnostics && ($#primary_warning_summary > -1) ) {
show_array( "$My_name: Summary of warnings:", @primary_warning_summary );
}
return $return;
} #END rdb_primary_run
#************************************************************
sub rdb_clear_change_record {
# Initialize diagnostics for reasons for running rule.
@changed = ();
@changed_user = ();
@disappeared = ();
@no_dest = (); # We are not now using this
@rules_never_run = ();
@rules_to_apply = (); # This is used in recursive application
# of rdb_flag_changes_here, to list
# rules that were out-of-date for some reason.
} #END rdb_clear_change_record
#************************************************************
sub rdb_flag_changes_here {
# Flag changes in current rule.
# Assumes rule context.
# Usage: rdb_flag_changes_here( ignore_run_time )
# Argument: if true then fdb_get shouldn't do runtime test
# for recalculation of md5
local $ignore_run_time = $_[0];
if ( ! defined $ignore_run_time ) { $ignore_run_time = 0; }
$$Pcheck_time = time();
local $dest_mtime = 0;
$dest_mtime = get_mtime($$Pdest) if ($$Pdest);
rdb_do_files( \&rdb_file_change1);
if ($$Pout_of_date) {
push @rules_to_apply, $rule;
}
#?? print "======== flag: $rule $$Pout_of_date ==========\n";
} #END rdb_flag_changes_here
#************************************************************
sub rdb_file_change1 {
# Call: &rdb_file_change1
# Assumes rule and file context. Assumes $dest_mtime set.
# Flag whether $file in $rule has changed or disappeared.
# Set rule's make flag if there's a change.
my $check_time_argument = 0;
if (! $ignore_run_time ) {
$check_time_argument = max( $$Pcheck_time, $$Prun_time );
}
my ($new_time, $new_size, $new_md5) = fdb_get($file, $check_time_argument );
my $ext_no_period = ext_no_period( $file );
my $generated = exists $from_rules{$file};
if ( ($new_size < 0) && ($$Psize >= 0) ) {
# print "Disappeared '$file' in '$rule'\n";
push @disappeared, $file;
# No reaction is good.
#$$Pout_of_date = 1;
# ??? 1 Sep. 2008: I do NOT think so, for cusdep no-file-exists issue
# ??? 30 Sep 2008: I think I have this fixed. There were other changes
# needed. No-change-flagged is correct. The array @disappeared flags
# files that have disappeared, if I need to know. But having a source
# file disappear is not a reason for a remake unless I know how to
# make the file. If the file is a destination of a rule, that rule
# will be rerun. It may be that the user is changing another source
# in such a way that the disappeared file won't be needed. Before the
# change is applied we get a superfluous infinite loop.
return;
}
if ( ($new_size < 0) && ($$Psize < 0) ) {
return;
}
# Primarily use md5 signature to determine whether file contents have
# changed.
# Backup by file size change, but only in the case where there is
# no pattern of lines to ignore in testing for a change
if ( ($new_md5 ne $$Pmd5)
|| (
(! exists $hash_calc_ignore_pattern{$ext_no_period})
&& ($new_size != $$Psize)
)
) {
push @changed, $file;
$$Pout_of_date = 1;
if ( ! $generated ) {
push @changed_user, $file;
$$Pout_of_date_user = 1;
}
}
elsif ( $new_time != $$Ptime ) {
$$Ptime = $new_time;
}
if ( ( ($$Ptest_kind == 2) || ($$Ptest_kind == 3) )
&& (! $generated)
&& ( $new_time > $dest_mtime )
) {
push @changed, $file;
$$Pout_of_date = $$Pout_of_date_user = 1;
}
} #END rdb_file_change1
#************************************************************
sub rdb_user_changes {
# Argument(s): a set of top level rules.
# Aim: Find any changed user files for those rules and all ancestors.
# Assumption: List of from_rules for files is up-to-date.
&rdb_clear_change_record;
rdb_recurse( [@_], sub{ &rdb_flag_changes_here(1); } );
if ($#changed_user >=0) { show_array( 'User changed files', @changed_user ); }
return ($#changed_user >= 0);
} #END rdb_user_changes
#************************************************************
sub rdb_diagnose_changes {
# Call: rdb_diagnose_changes or rdb_diagnose_changes( heading )
# List changes on STDERR
# Precede the message by the optional heading, else by "$My_name: "
my $heading = defined($_[0]) ? $_[0] : "$My_name: ";
if ($#rules_never_run >= 0) {
warn "${heading}Rules & subrules not known to be previously run:\n";
foreach (@rules_never_run) { warn " $_\n"; }
}
if ( ($#changed >= 0) || ($#disappeared >= 0) || ($#no_dest >= 0) ) {
warn "${heading}File changes, etc:\n";
if ( $#changed >= 0 ) {
warn " Changed files, or newly in use since previous run(s):\n";
foreach (uniqs(@changed)) { warn " '$_'\n"; }
}
if ( $#disappeared >= 0 ) {
warn " No-longer-existing files:\n";
foreach (uniqs(@disappeared)) { warn " '$_'\n"; }
}
if ( $#no_dest >= 0 ) {
warn " Non-existent destination files:\n";
foreach (uniqs(@no_dest)) { warn " '$_'\n"; }
}
}
elsif ($#rules_to_apply >=0) {
warn "${heading}The following rules & subrules became out-of-date:\n";
foreach (@rules_to_apply) { warn " '$_'\n"; }
}
else {
warn "${heading}No file changes\n";
}
} #END rdb_diagnose_changes
#************************************************************
#************************************************************
#************************************************************
#************************************************************
#************************************************************
#************************************************************
#************************************************************
#************************************************************
# Routines for convenient looping and recursion through rule database
# ================= NEW VERSION ================
# There are several places where we need to loop through or recurse
# through rules and files. This tends to involve repeated, tedious
# and error-prone coding of much book-keeping detail. In particular,
# working on files and rules needs access to the variables involved,
# which either involves direct access to the elements of the database,
# and consequent fragility against changes and upgrades in the
# database structure, or involves lots of routines for reading and
# writing data in the database, then with lots of repetitious
# house-keeping code.
#
# The routines below provide a solution. Looping and recursion
# through the database are provided by a set of basic routines where
# each necessary kind of looping and iteration is coded once. The
# actual actions are provided as references to action subroutines.
# (These can be either actual references, as in \&routine, or
# anonymous subroutines, as in sub{...}, or aas a zero value 0 or an
# omitted argument, to indicate that no action is to be performed.)
#
# When the action subroutine(s) are actually called, a context for the
# rule and/or file (as appropriate) is given by setting named
## NEW ??
# variables to REFERENCES to the relevant data values. These can be
# used to retrieve and set the data values. As a convention,
# references to scalars are given by variables named start with "$P",
# as in "$Pdest", while references to arrays start with "$PA", as in
# "$PAint_cmd", and references to hashes with "$PH", as in "$PHsource".
# After the action subroutine has finished, checks for data
# consistency may be made.
## ??? OLD
# variables to the relevant data values. After the action subroutine
# has finished, the database is updated with the values of these named
# variables, with any necessary consistency checks. Thus the action
# subroutines can act on sensibly named variables without needed to
# know the database structure.
#
# The only routines that actually use the database structure and need
# to be changed if that is changed are: (a) the routines rdb_one_rule
# and rdb_one_file that implement the calling of the action subroutines,
# (b) routines for creation of single rules and file items, and (c) to
# a lesser extent, the routine for destroying a file item.
#
# Note that no routine is provided for destroying a rule. During a
# run, a rule, with its source files, may become inaccessible or
# unused. This happens dynamically, depending on the dependencies
# caused by changes in the source file or by error conditions that
# cause the computation of dependencies, particular of latex files, to
# become wrong. In that situation the files certainly come and go in
# the database, but subsidiary rules, with their content information
# on their source files, need to be retained so that their use can be
# reinstated later depending on dynamic changes in other files.
#
# However, there is a potential memory leak unless some pruning is
# done in what is written to the fdb file. (Probably only accessible
# rules and those for which source files exist. Other cases have no
# relevant information that needs to be preserved between runs.)
#
#
#************************************************************
# First the top level routines for recursion and iteration
#************************************************************
sub rdb_recurse {
# Call: rdb_recurse( rule | [ rules],
# \&rule_act1, \&file_act1, \&file_act2,
# \&rule_act2 )
# The actions are pointers to subroutines, and may be null (0, or
# undefined) to indicate no action to be applied.
# Recursively acts on the given rules and all ancestors:
# foreach rule found:
# apply rule_act1
# loop through its files:
# apply file_act1
# act on its ancestor rule, if any
# apply file_act2
# apply rule_act2
# Guards against loops.
# Access to the rule and file data by local variables, only
# for getting and setting.
# This routine sets a context for anything recursive, with @heads,
# %visited and $depth being set as local variables.
local @heads = ();
my $rules = shift;
# Distinguish between single rule (a string) and a reference to an
# array of rules:
if ( ref $rules eq 'ARRAY' ) { @heads = @$rules; }
else { @heads = ( $rules ); }
# Keep a list of visited rules, used to block loops in recursion:
local %visited = ();
local $depth = 0;
foreach $rule ( @heads ) {
if ( rdb_is_active($rule) ) { rdb_recurse_rule( $rule, @_ ); }
}
} #END rdb_recurse
#************************************************************
sub rdb_for_actives {
# Call: rdb_for_actives( \&rule_act1, \&file_act, \&rule_act2 )
# Loops through all rules and their source files, using the
# specified set of actions, which are pointers to subroutines.
# Sorts rules alphabetically.
# See rdb_for_some for details.
# rdb_for_some( [ sort keys %rule_db ], @_);
rdb_for_some( [ sort &rdb_actives ], @_);
} #END rdb_for_actives
#************************************************************
sub rdb_for_some {
# Call: rdb_for_some( rule | [ rules],
# \&rule_act1, \&file_act, \&rule_act2)
# Actions can be zero, and rules at tail of argument list can be
# omitted. E.g. rdb_for_some( rule, 0, \&file_act ).
# Anonymous subroutines can be used, e.g., rdb_for_some( rule, sub{...} ).
#
# Loops through rules and their source files, using the
# specified set of rules:
# foreach rule:
# apply rule_act1
# loop through its files:
# apply file_act
# apply rule_act2
#
# Rule data and file data are made available in local variables
# for access by the subroutines.
local @heads = ();
my $rules = shift;
# Distinguish between single rule (a string) and a reference to an
# array of rules:
if ( ref $rules eq 'ARRAY' ) { @heads = @$rules; }
else { @heads = ( $rules ); }
foreach $rule ( @heads ) {
# $rule is implicitly local
&rdb_one_rule( $rule, @_ );
}
} #END rdb_for_some
#************************************************************
sub rdb_for_one_file {
my $rule = shift;
# Avoid name collisions with general recursion and iteraction routines:
local $file1 = shift;
local $action1 = shift;
rdb_for_some( $rule, sub{rdb_one_file($file1,$action1)} );
} #END rdb_for_one_file
#************************************************************
# Routines for inner part of recursion and iterations
#************************************************************
sub rdb_recurse_rule {
# Call: rdb_recurse_rule($rule, \&rule_act1, \&file_act1, \&file_act2,
# \&rule_act2 )
# to do the work for one rule, recurisvely called from_rules for
# the sources of the rules.
# Assumes recursion context, i.e. that %visited, @heads, $depth.
# We are overriding actions:
my ($rule, $rule_act1, $new_file_act1, $new_file_act2, $rule_act2)
= @_;
if (! rdb_is_active($rule)) { return; }
# and must propagate the file actions:
local $file_act1 = $new_file_act1;
local $file_act2 = $new_file_act2;
# Prevent loops:
if ( (! $rule) || exists $visited{$rule} ) { return; }
$visited{$rule} = 1;
# Recursion depth
$depth++;
# We may need to repeat actions on dependent rules, without being
# blocked by the test on visited files. So save %visited:
# NOT CURRENTLY USED!! local %visited_at_rule_start = %visited;
# At end, the last value set for %visited wins.
rdb_one_rule( $rule, $rule_act1, \&rdb_recurse_file, $rule_act2 );
$depth--;
} #END rdb_recurse_rule
#************************************************************
sub rdb_recurse_file {
# Call: rdb_recurse_file to do the work for one file.
# This has no arguments, since it is used as an action subroutine,
# passed as a reference in calls in higher-level subroutine.
# Assumes contexts set for: Recursion, rule, and file
&$file_act1 if $file_act1;
rdb_recurse_rule( $$Pfrom_rule, $rule_act1, $file_act1, $file_act2,
$rule_act2 )
if $$Pfrom_rule;
&$file_act2 if $file_act2;
} #END rdb_recurse_file
#************************************************************
sub rdb_do_files {
# Assumes rule context, including $PHsource.
# Applies an action to all the source files of the rule.
local $file_act = shift;
my @file_list = sort keys %$PHsource;
foreach my $file ( @file_list ){
rdb_one_file( $file, $file_act );
}
} #END rdb_do_files
#************************************************************
# Routines for action on one rule and one file. These are the main
# places (in addition to creation and destruction routines for rules
# and files) where the database structure is accessed.
#************************************************************
sub rdb_one_rule {
# Call: rdb_one_rule( $rule, $rule_act1, $file_act, $rule_act2 )
# Sets context for rule and carries out the actions.
#===== Accesses rule part of database structure =======
local ( $rule, $rule_act1, $file_act, $rule_act2 ) = @_;
#?? &R1;
if ( (! $rule) || ! rdb_rule_exists($rule) ) { return; }
local ( $PArule_data, $PHsource, $PHdest ) = @{$rule_db{$rule}};
local ($Pcmd_type, $Pext_cmd, $PAint_cmd, $Ptest_kind,
$Psource, $Pdest, $Pbase,
$Pout_of_date, $Pout_of_date_user, $Prun_time, $Pcheck_time,
$Pchanged,
$Plast_result, $Plast_message, $PA_extra_gen )
= Parray( $PArule_data );
&$rule_act1 if $rule_act1;
&rdb_do_files( $file_act ) if $file_act;
&$rule_act2 if $rule_act2;
#?? &R2;
} #END rdb_one_rule
#************************************************************
sub rdb_activate {
# Usage rdb_activate( rule_names )
# Turns on active flag for the rules
foreach ( @_ ) {
if ( rdb_rule_exists($_) ) { $actives{$_} = 1; }
}
}
#--------------------------------------------------
sub rdb_deactivate {
# Usage rdb_deactivate( rule_names )
# Turns off active flag for the rules
foreach ( @_ ) { delete $actives{$_}; }
}
#--------------------------------------------------
sub rdb_activate_request {
# Usage rdb_activate_request( rule_names )
# Turns on active flag for the rules.
# Adds rules to target_rules list
foreach ( @_ ) {
if ( rdb_rule_exists($_) ) { $actives{$_} = 1; $target_rules{$_} = 1; }
}
}
#--------------------------------------------------
sub rdb_deactivate_derequest {
# Usage rdb_deactivate_derequest( rule_names )
# Turns off active flag for the rules
# Removes rules from target_rules list
foreach ( @_ ) { delete $actives{$_}; delete $target_rules{$_}; }
}
#--------------------------------------------------
sub rdb_is_active {
# Usage rdb_is_active( rule_name )
if ( (exists $actives{$_[0]}) && rdb_rule_exists($_[0]) ) { return 1; }
else { return 0; }
}
#--------------------------------------------------
sub rdb_actives {
# Returns array of active rules
return keys %actives;
}
#************************************************************
sub rdb_one_file {
# Call: rdb_one_file($file, $file_act)
# Sets context for file and carries out the action.
# Assumes $rule context set.
#===== Accesses file part of database structure =======
local ($file, $file_act) = @_;
#?? &F1;
if ( (!$file) ||(!exists ${$PHsource}{$file}) ) { return; }
local $PAfile_data = ${$PHsource}{$file};
local ($Ptime, $Psize, $Pmd5, $Pfrom_rule, $Pcorrect_after_primary )
= Parray( $PAfile_data );
&$file_act() if $file_act;
if ( ! rdb_rule_exists( $$Pfrom_rule ) ) {
$$Pfrom_rule = '';
}
#?? &F2;
} #END rdb_one_file
#************************************************************
# Routines for creation of rules and file items, and for removing file
# items.
#************************************************************
sub rdb_remove_rule {
# rdb_remove_rule( rule, ... )
foreach my $key (@_) {
delete $rule_db{$key};
delete $actives{$key};
}
}
#************************************************************
sub rdb_create_rule {
# rdb_create_rule( rule, command_type, ext_cmd, int_cmd, test_kind,
# source, dest, base,
# needs_making, run_time, check_time, set_file_not_exists,
# ref_to_array_of_specs_of_extra_generated_files )
# int_cmd is either a string naming a perl subroutine or it is a
# reference to an array containing the subroutine name and its
# arguments.
# Makes rule. Update rule if it already exists.
# Omitted arguments: replaced by 0 or '' as needed.
# Rule is made active
# ==== Sets rule data ====
my ( $rule, $cmd_type, $ext_cmd, $PAint_cmd, $test_kind,
$source, $dest, $base,
$needs_making, $run_time, $check_time, $set_file_not_exists, $extra_gen ) = @_;
my $active = 1;
my $changed = 0;
# Set defaults, and normalize parameters:
foreach ( $cmd_type, $ext_cmd, $PAint_cmd, $source, $dest, $base,
$set_file_not_exists ) {
if (! defined $_) { $_ = ''; }
}
if ( ($source =~ /\"/) || ($dest =~ /\"/) || ($base =~ /\"/) ) {
die "$My_name: Error. In rdb_create_rule there is a double quote in one of\n",
" source, destination or base parameters:\n",
" '$source', '$dest', '$base'\n",
" I cannot handle this.\n";
}
foreach ( $needs_making, $run_time, $check_time, $test_kind ) {
if (! defined $_) { $_ = 0; }
}
if (!defined $test_kind) {
# Default to test on file change
$test_kind = 1;
}
if ( ref( $PAint_cmd ) eq '' ) {
# It is a single command. Convert to array reference:
$PAint_cmd = [ $PAint_cmd ];
}
else {
# COPY the referenced array:
$PAint_cmd = [ @$PAint_cmd ];
}
my $PA_extra_gen = [];
if ($extra_gen) {
@$PA_extra_gen = @$extra_gen;
}
$rule_db{$rule} =
[ [$cmd_type, $ext_cmd, $PAint_cmd, $test_kind,
$source, $dest, $base,
$needs_making, 0, $run_time, $check_time, $changed,
-1, '', $PA_extra_gen ],
{},
{}
];
if ($source) {
rdb_ensure_file( $rule, $source, undef, $set_file_not_exists );
}
rdb_one_rule( $rule, \&rdb_initialize_generated );
if ($active) { rdb_activate($rule); }
else { rdb_deactivate($rule); }
} #END rdb_create_rule
#************************************************************
sub rdb_initialize_generated {
# Assume rule context.
# Initialize hash of generated files
%$PHdest = ();
if ($$Pdest) { rdb_add_generated($$Pdest); }
rdb_add_generated(@$PA_extra_gen);
} #END rdb_initialize_generated
#************************************************************
sub rdb_add_generated {
# Assume rule context.
# Add arguments to hash of generated files, and to global cache
foreach (@_) {
$$PHdest{$_} = 1;
$from_rules{$_} = $rule;
}
} #END rdb_add_generated
#************************************************************
sub rdb_remove_generated {
# Assume rule context.
# Remove arguments from hash of generated files
foreach (@_) { delete $$PHdest{$_}; }
} #END rdb_remove_generated
#************************************************************
sub rdb_ensure_file {
# rdb_ensure_file( rule, file[, fromrule[, set_not_exists]] )
# Ensures the source file item exists in the given rule.
# Then if the fromrule is specified, set it for the file item.
# If the item is created, then:
# (a) by default initialize it to current file state.
# (b) but if the fourth argument, set_not_exists, is true,
# initialize the item as if the file does not exist.
# This case is typically used when the log file for a run
# of latex/pdflatex claims that the file was non-existent
# at the beginning of a run.
#============ rule and file data set here ======================================
my $rule = shift;
local ( $new_file, $new_from_rule, $set_not_exists ) = @_;
if ( ! rdb_rule_exists( $rule ) ) {
die_trace( "$My_name: BUG in call to rdb_ensure_file: non-existent rule '$rule'" );
}
if ( ! defined $new_file ) {
die_trace( "$My_name: BUG in call to rdb_ensure_file: undefined file for '$rule'" );
}
if ( $new_file =~ /\"/ ) {
warn "$My_name: in rdb_ensure_file for rule '$rule', there is a double quote in\n",
" the filename: '$new_file'.\n",
" I cannot handle this, will ignore this file.\n";
return;
}
if ( ! defined $set_not_exists ) { $set_not_exists = 0; }
rdb_one_rule( $rule,
sub{
if (! exists ${$PHsource}{$new_file} ) {
if ( $set_not_exists ) {
${$PHsource}{$new_file} = [@nofile, '', 0];
}
else {
${$PHsource}{$new_file}
= [fdb_get($new_file, $$Prun_time), '', 0];
}
}
}
);
if (defined $new_from_rule ) {
rdb_for_one_file( $rule, $new_file, sub{ $$Pfrom_rule = $new_from_rule; });
}
} #END rdb_ensure_file
#************************************************************
sub rdb_remove_files {
# rdb_remove_file( rule, file, ... )
# Removes file(s) for the rule.
my $rule = shift;
if (!$rule) { return; }
local @files = @_;
rdb_one_rule( $rule,
sub{ foreach (@files) { delete ${$PHsource}{$_}; } }
);
} #END rdb_remove_files
#************************************************************
sub rdb_list_source {
# rdb_list_source( rule )
# Return array of source files for rule.
my $rule = shift;
my @files = ();
rdb_one_rule( $rule,
sub{ @files = keys %$PHsource; }
);
return @files;
} #END rdb_list_source
#************************************************************
sub rdb_set_source {
# rdb_set_source( rule, file, ... )
my $rule = shift;
if (!$rule) { return; }
my %files = ();
foreach (@_) {
# if ( /\"/ ) {next; }
rdb_ensure_file( $rule, $_ );
$files{$_} = 1;
}
foreach ( rdb_list_source($rule) ) {
if ( ! exists $files{$_} ) { rdb_remove_files( $rule, $_ ); }
}
return;
} #END rdb_list_source
#************************************************************
sub rdb_change_dest {
# Assumes rule context.
# Usage change_dest( new_dest [, flag] )
# Changes destination for this rule. Fixes from_rule links.
# If flag set, make the new_dest a source file in any rule
# for which the old destination is already set.
# No action if there's no change of destination.
local ($new_dest, $flag) = @_;
local $old_dest = $$Pdest;
if ($old_dest eq $new_dest) { return; }
# if ( $new_dest =~ /\"/ ) { return; }
rdb_remove_generated( $old_dest );
rdb_add_generated( $new_dest );
if ($flag) {
print "rdb_change_dest: fixing dependencies\n";
rdb_for_actives( sub{ if ( rdb_file_exists( $rule, $old_dest ) ) {
rdb_ensure_file( $rule, $new_dest );
rdb_remove_files( $rule, $old_dest );
}
}
);
}
$$Pdest = $new_dest;
# ??? Do I need to fix from_rule setting?
#&rdb_make_links;
return;
} #END rdb_change_dest
#************************************************************
sub rdb_rule_exists {
# Call rdb_rule_exists($rule): Returns whether rule exists.
my $rule = shift;
if (! $rule ) { return 0; }
return exists $rule_db{$rule};
} #END rdb_rule_exists
#************************************************************
sub rdb_file_exists {
# Call rdb_file_exists($rule, $file):
# Returns whether source file item in rule exists.
local ( $rule, $file ) = @_;
local $exists = 0;
rdb_one_rule( $rule,
sub{ $exists = exists( ${$PHsource}{$file} ) ? 1:0; }
);
return $exists;
} #END rdb_file_exists
#************************************************************
sub rdb_update_gen_files {
# Assumes rule context. Update source files of rule to current state.
rdb_do_files(
sub{
if ( exists $generated_exts_all{ ext_no_period($file) }
|| exists $$PHdest{$file}
) {
&rdb_update1;
}
}
);
} #END rdb_update_gen_files
#************************************************************
sub rdb_update_files {
# Call: rdb_update_files
# Assumes rule context. Update source files of rule to current state.
rdb_do_files( \&rdb_update1 );
}
#************************************************************
sub rdb_update1 {
# Call: rdb_update1.
# Assumes file context. Updates file data to correspond to
# current file state on disk
($$Ptime, $$Psize, $$Pmd5) = fdb_get($file);
}
#************************************************************
sub rdb_set_file1 {
# Call: fdb_file1(rule, file, new_time, new_size, new_md5)
# Sets file time, size and md5.
my $rule = shift;
my $file = shift;
local @new_file_data = @_;
rdb_for_one_file( $rule, $file, sub{ ($$Ptime,$$Psize,$$Pmd5)=@new_file_data; } );
}
#************************************************************
sub rdb_dummy_file {
# Returns file data for non-existent file
# ==== Uses rule_db structure ====
return (0, -1, 0, '');
}
#************************************************************
#************************************************************
# Predefined subroutines for custom dependency
sub cus_dep_delete_dest {
# This subroutine is used for situations like epstopdf.sty, when
# the destination (target) of the custom dependency invoking
# this subroutine will be made by the primary run provided the
# file (destination of the custom dependency, source of the
# primary run) doesn't exist.
# It is assumed that the resulting file will be read by the
# primary run.
# Remove the destination file, to indicate it needs to be remade:
unlink_or_move( $$Pdest );
# Arrange that the non-existent destination file is not treated as
# an error. The variable changed here is a bit misnamed.
$$Pchanged = 1;
# Ensure a primary run is done
&cus_dep_require_primary_run;
# Return success:
return 0;
}
#************************************************************
sub cus_dep_require_primary_run {
# This subroutine is used for situations like epstopdf.sty, when
# the destination (target) of the custom dependency invoking
# this subroutine will be made by the primary run provided the
# file (destination of the custom dependency, source of the
# primary run) doesn't exist.
# It is assumed that the resulting file will be read by the
# primary run.
local $cus_dep_target = $$Pdest;
# Loop over all rules and source files:
rdb_for_actives( 0,
sub { if ($file eq $cus_dep_target) {
$$Pout_of_date = 1;
$$Pcorrect_after_primary = 1;
}
}
);
# Return success:
return 0;
}
#************************************************************
#************************************************************
#************************************************************
#
# UTILITIES:
#
#************************************************************
# Miscellaneous
sub show_array {
# For use in diagnostics and debugging.
# On stderr, print line with $_[0] = label.
# Then print rest of @_, one item per line preceeded by some space
warn "$_[0]\n";
shift;
if ($#_ >= 0) { foreach (@_){ warn " $_\n";} }
else { warn " NONE\n"; }
}
#************************************************************
sub array_to_hash {
# Call: array_to_hash( items )
# Returns: hash mapping items to 1
my %hash = ();
foreach (@_) {$hash{$_} = 1; }
return %hash;
}
#************************************************************
sub Parray {
# Call: Parray( \@A )
# Returns array of references to the elements of @A
# But if an element of @A is already a reference, the
# reference will be returned in the output array, not a
# reference to the reference.
my $PA = shift;
my @P = (undef) x (1+$#$PA);
foreach my $i (0..$#$PA) {
$P[$i] = (ref $$PA[$i]) ? ($$PA[$i]) : (\$$PA[$i]);
}
return @P;
}
#************************************************************
sub glob_list1 {
# Glob a collection of filenames.
# But no sorting or elimination of duplicates
# Usage: e.g., @globbed = glob_list1(string, ...);
# Since perl's glob appears to use space as separator, I'll do a special check
# for existence of non-globbed file (assumed to be tex like)
my @globbed = ();
foreach my $file_spec (@_) {
# Problem, when the PATTERN contains spaces, the space(s) are
# treated as pattern separaters.
# Solution: I now the glob from use File::Glob.
# The following hack avoids issues with glob in the case that a file exists
# with the specified name (possibly with extension .tex):
if ( -e $file_spec || -e "$file_spec.tex" ) {
# Non-globbed file exists, return the file_spec.
# Return $file_spec only because this is not a file-finding subroutine, but
# only a globber
push @globbed, $file_spec;
}
else {
push @globbed, my_glob( "$file_spec" );
}
}
return @globbed;
} #END glob_list1
#************************************************************
# Miscellaneous
sub prefix {
#Usage: prefix( string, prefix );
#Return string with prefix inserted at the front of each line
my @line = split( /\n/, $_[0] );
my $prefix = $_[1];
for (my $i = 0; $i <= $#line; $i++ ) {
$line[$i] = $prefix.$line[$i]."\n";
}
return join( "", @line );
} #END prefix
#===============================
sub parse_quotes {
# Split string into words.
# Words are delimited by space, except that strings
# quoted all stay inside a word. E.g.,
# 'asdf B" df "d "jkl"'
# is split to ( 'asdf', 'B df d', 'jkl').
# An array is returned.
my @results = ();
my $item = '';
local $_ = shift;
pos($_) = 0;
ITEM:
while() {
/\G\s*/gc;
if ( /\G$/ ) {
last ITEM;
}
# Now pos (and \G) is at start of item:
PART:
while () {
if (/\G([^\s\"]*)/gc) {
$item .= $1;
}
if ( /\G\"([^\"]*)\"/gc ) {
# Match balanced quotes
$item .= $1;
next PART;
}
elsif ( /\G\"(.*)$/gc ) {
# Match unbalanced quote
$item .= $1;
warn "====Non-matching quotes in\n '$_'\n";
}
push @results, $item;
$item = '';
last PART;
}
}
return @results;
} #END parse_quotes
#************************************************************
#************************************************************
# File handling utilities:
#************************************************************
sub get_latest_mtime
# - arguments: each is a filename.
# - returns most recent modify time.
{
my $return_mtime = 0;
foreach my $include (@_)
{
my $include_mtime = &get_mtime($include);
# The file $include may not exist. If so ignore it, otherwise
# we'll get an undefined variable warning.
if ( ($include_mtime) && ($include_mtime > $return_mtime) )
{
$return_mtime = $include_mtime;
}
}
return $return_mtime;
}
#************************************************************
sub get_mtime_raw
{
my $mtime = (stat($_[0]))[9];
return $mtime;
}
#************************************************************
sub get_mtime {
return get_mtime0($_[0]);
}
#************************************************************
sub get_mtime0 {
# Return time of file named in argument
# If file does not exist, return 0;
if ( -e $_[0] ) {
return get_mtime_raw($_[0]);
}
else {
return 0;
}
}
#************************************************************
sub get_size {
# Return time of file named in argument
# If file does not exist, return 0;
if ( -e $_[0] ) {
return get_size_raw($_[0]);
}
else {
return 0;
}
}
#************************************************************
sub get_size_raw
{
my $size = (stat($_[0]))[7];
return $size;
}
#************************************************************
sub get_time_size {
# Return time and size of file named in argument
# If file does not exist, return (0,-1);
if ( -e $_[0] ) {
return get_time_size_raw($_[0]);
}
else {
return (0,-1);
}
}
#************************************************************
sub get_time_size_raw
{
my $mtime = (stat($_[0]))[9];
my $size = (stat($_[0]))[7];
return ($mtime, $size);
}
#************************************************************
sub processing_time
{ my ($user, $system, $cuser, $csystem) = times();
return $user + $system + $cuser + $csystem;
}
#************************************************************
sub get_checksum_md5 {
my $source = shift;
my $input = new FileHandle;
my $md5 = Digest::MD5->new;
my $ignore_pattern = undef;
#&traceback;
#warn "======= GETTING MD5: $source\n";
if ( -d $source ) {
# We won't use checksum for directory
return 0;
}
else {
open( $input, '<:bytes', $source )
or return 0;
my ($base, $path, $ext) = fileparseA( $source );
$ext =~ s/^\.//;
if ( exists $hash_calc_ignore_pattern{$ext} ) {
$ignore_pattern = $hash_calc_ignore_pattern{$ext};
}
}
if ( defined $ignore_pattern ) {
while (<$input>) {
if ( ! /$ignore_pattern/ ){
$md5->add($_);
}
}
}
else {
$md5->addfile($input);
}
close $input;
return $md5->hexdigest();
}
#************************************************************
#************************************************************
sub create_empty_file {
my $name = shift;
my $h = new FileHandle ">$name"
or return 1;
close ($h);
return 0;
}
#************************************************************
#************************************************************
sub find_file1 {
#?? Need to use kpsewhich, if possible
# Usage: find_file1(name, ref_to_array_search_path)
# Modified find_file, which doesn't die.
# Given filename and path, return array of:
# full name
# retcode
# On success: full_name = full name with path, retcode = 0
# On failure: full_name = given name, retcode = 1
my $name = $_[0];
# Make local copy of path, since we may rewrite it!
my @path = ();
if ($_[1]) {
@path = @{$_[1]};
}
if ( $name =~ /^\// ) {
# Absolute path (if under UNIX)
# This needs fixing, in general
if (-e $name) { return( $name, 0 );}
else { return( $name, 1 );}
}
foreach my $dir ( @path ) {
#??print "-------------dir='$dir', ";
# Make $dir concatenatable, and empty for current dir:
if ( $dir eq '.' ) {
$dir = '';
}
elsif ( $dir =~ /[\/\\:]$/ ) {
#OK if dir ends in / or \ or :
}
elsif ( $dir ne '' ) {
#Append directory separator only to non-empty dir
$dir = "$dir/";
}
#?? print " newdir='$dir'\n";
if (-e "$dir$name") {
return("$dir$name", 0);
}
}
my @kpse_result = kpsewhich( $name );
if ($#kpse_result > -1) {
return( $kpse_result[0], 0);
}
return("$name" , 1);
} #END find_file1
#************************************************************
sub find_file_list1 {
# Modified version of find_file_list that doesn't die.
# Given output and input arrays of filenames, a file suffix, and a path,
# fill the output array with full filenames
# Return array of not-found files.
# Usage: find_file_list1( ref_to_output_file_array,
# ref_to_input_file_array,
# suffix,
# ref_to_array_search_path
# )
# SPECIAL TREATMENT TO .bib extension, because of behavior of bibtex
# OTHER SPECIAL TREATMENT IF EXTENSION IS GIVEN.
my $ref_output = $_[0];
my $ref_input = $_[1];
my $suffix = $_[2];
my $ref_search = $_[3];
my @not_found = ();
#?? show_array( "=====find_file_list1. Suffix: '$suffix'\n Source:", @$ref_input );
#?? show_array( " Bibinputs:", @$ref_search );
my @return_list = (); # Generate list in local array, since input
# and output arrays may be same
my $retcode = 0;
foreach my $file1 (@$ref_input) {
my $file = $file1;
if ($suffix eq '.bib') { $file =~ s/\.bib$//; }
my ($tmp_file, $find_retcode) = &find_file1( "$file$suffix", $ref_search );
if ($tmp_file) {
push @return_list, $tmp_file;
}
if ( $find_retcode != 0 ) {
push @not_found, $file.$suffix;
}
}
@$ref_output = @return_list;
#?? show_array( " Output", @$ref_output );
#?? foreach (@$ref_output) { if ( /\/\// ) { print " ====== double slash in '$_'\n"; } }
return @not_found;
} #END find_file_list1
#************************************************************
sub unlink_or_move {
if ( $del_dir eq '' ) {
foreach (@_) {
if (!-e) {next;}
if (-d) {
if (!rmdir) {
warn "$My_name: Cannot remove directory '$_'\n";
}
}
else {
if (!unlink) {
warn "$My_name: Cannot remove file '$_'\n";
}
}
}
}
else {
foreach (@_) {
if (-e $_ && ! move $_, "$del_dir/$_" ) {
warn "$My_name: Cannot move '$_' to '$del_dir/$_'\n";
}
}
}
}
#************************************************************
sub kpsewhich {
# Usage: kpsewhich( filespec, ...)
# Returns array of files with paths as found by kpsewhich
# kpsewhich( 'try.sty', 'jcc.bib' );
# With standard use of kpsewhich (i.e., without -all option), the array
# has either 0 or 1 element.
# Can also do, e.g.,
# kpsewhich( '-format=bib', 'trial.bib', 'file with spaces');
my $cmd = $kpsewhich;
my @args = @_;
if ( ($cmd eq '') || ( $cmd =~ /^NONE($| )/ ) ) {
# Kpsewhich not set up.
warn "$My_name: Kpsewhich command needed but not set up\n";
return ();
}
foreach (@args) {
if ( ! /^-/ ) {
$_ = "\"$_\"";
}
}
$cmd =~ s/%[RBTDO]//g;
$cmd =~ s/%S/@args/g;
my @found = ();
local $fh;
if ( $kpsewhich_show || $diagnostics ) {
print "$My_name.kpsewhich: Running '$cmd'...\n";
}
open $fh, "$cmd|"
or die "Cannot open pipe for \"$cmd\"\n";
while ( <$fh> ) {
s/[\r\n]*$//;
push @found, $_;
}
close $fh;
if ( $kpsewhich_show || $diagnostics ) {
show_array( "$My_name.kpsewhich: '$cmd' ==>", @found );
}
return @found;
}
####################################################
sub add_cus_dep {
# Usage: add_cus_dep( from_ext, to_ext, flag, sub_name )
# Add cus_dep after removing old versions
my ($from_ext, $to_ext, $must, $sub_name) = @_;
remove_cus_dep( $from_ext, $to_ext );
push @cus_dep_list, "$from_ext $to_ext $must $sub_name";
}
####################################################
sub remove_cus_dep {
# Usage: remove_cus_dep( from_ext, to_ext )
my ($from_ext, $to_ext) = @_;
my $i = 0;
while ($i <= $#cus_dep_list) {
# Use \Q and \E round directory name in regex to avoid interpretation
# of metacharacters in directory name:
if ( $cus_dep_list[$i] =~ /^\Q$from_ext $to_ext \E/ ) {
splice @cus_dep_list, $i, 1;
}
else {
$i++;
}
}
}
####################################################
sub show_cus_dep {
show_array( "Custom dependency list:", @cus_dep_list );
}
####################################################
sub add_aux_hook {
# Usage: add_aux_hook( sub_name )
# Add the name subroutine to the array of hooks for
# processing lines of aux files.
# The argument is either a string naming the subroutine, e.g.
# add_aux_hook( 'subname' );
# or a Perl reference to the subroutine, e.g.,
# add_aux_hook( \&subname );
# It is also possible to use an anonymous subroutine, e.g.,
# add_aux_hook( sub{ code of subroutine... } );
my ($sub_name) = @_;
push @aux_hooks, $sub_name;
}
####################################################
sub set_input_ext {
# Usage: set_input_ext( rule, ext, ... )
# Set list of extension(s) (specified without a leading period)
# for the given rule ('latex', 'pdflatex', etc).
# These extensions are used when an input
# file without an extension is found by (pdf)latex, as in
# \input{file} or \includegraphics{figure}. When latexmk searches
# custom dependencies to make the missing file, it will assume that
# the file has one of the specified extensions.
my $rule = shift;
$input_extensions{$rule} = {};
my $Prule = $input_extensions{$rule};
foreach (@_) { $$Prule{$_} = 1; }
}
####################################################
sub show_input_ext {
# Usage: show_input_ext( rule )
my $rule = shift;
show_array ("Input extensions for rule '$rule': ",
keys %{$input_extensions{$rule}} );
}
####################################################
sub find_dirs1 {
# Same as find_dirs, but argument is single string with directories
# separated by $search_path_separator
find_dirs( &split_search_path( $search_path_separator, ".", $_[0] ) );
}
#************************************************************
sub find_dirs {
# @_ is list of directories
# return: same list of directories, except that for each directory
# name ending in //, a list of all subdirectories (recursive)
# is added to the list.
# Non-existent directories and non-directories are removed from the list
# Trailing "/"s and "\"s are removed
local @result = ();
my $find_action
= sub
{ ## Subroutine for use in File::find
## Check to see if we have a directory
if (-d) { push @result, $File::Find::name; }
};
foreach my $directory (@_) {
my $recurse = ( $directory =~ m[//$] );
# Remove all trailing /s, since directory name with trailing /
# is not always allowed:
$directory =~ s[/+$][];
# Similarly for MSWin reverse slash
$directory =~ s[\\+$][];
if ( ! -e $directory ){
next;
}
elsif ( $recurse ){
# Recursively search directory
find( $find_action, $directory );
}
else {
push @result, $directory;
}
}
return @result;
}
#************************************************************
sub uniq
# Read arguments, delete neighboring items that are identical,
# return array of results
{
my @sort = ();
my ($current, $prev);
my $first = 1;
while (@_)
{
$current = shift;
if ($first || ($current ne $prev) )
{
push @sort, $current;
$prev = $current;
$first = 0;
}
}
return @sort;
}
#==================================================
sub uniq1 {
# Usage: uniq1( strings )
# Returns array of strings with duplicates later in list than
# first occurence deleted. Otherwise preserves order.
my @strings = ();
my %string_hash = ();
foreach my $string (@_) {
if (!exists( $string_hash{$string} )) {
$string_hash{$string} = 1;
push @strings, $string;
}
}
return @strings;
}
#************************************************************
sub uniqs {
# Usage: uniq2( strings )
# Returns array of strings sorted and with duplicates deleted
return uniq( sort @_ );
}
#************************************************************
sub ext {
# Return extension of filename. Extension includes the period
my $file_name = $_[0];
my ($base_name, $path, $ext) = fileparseA( $file_name );
return $ext;
}
#************************************************************
sub ext_no_period {
# Return extension of filename. Extension excludes the period
my $file_name = $_[0];
my ($base_name, $path, $ext) = fileparseA( $file_name );
$ext =~ s/^\.//;
return $ext;
}
#************************************************************
sub fileparseA {
# Like fileparse but replace $path for current dir ('./' or '.\') by ''
# Also default second argument to get normal extension.
my $given = $_[0];
my $pattern = '\.[^\.]*';
if ($#_ > 0 ) { $pattern = $_[1]; }
my ($base_name, $path, $ext) = fileparse( $given, $pattern );
if ( ($path eq './') || ($path eq '.\\') ) {
$path = '';
}
return ($base_name, $path, $ext);
}
#************************************************************
sub fileparseB {
# Like fileparse but with default second argument for normal extension
my $given = $_[0];
my $pattern = '\.[^\.]*';
if ($#_ > 0 ) { $pattern = $_[1]; }
my ($base_name, $path, $ext) = fileparse( $given, $pattern );
return ($base_name, $path, $ext);
}
#************************************************************
sub split_search_path
{
# Usage: &split_search_path( separator, default, string )
# Splits string by separator and returns array of the elements
# Allow empty last component.
# Replace empty terms by the default.
my $separator = $_[0];
my $default = $_[1];
my $search_path = $_[2];
my @list = split( /$separator/, $search_path);
if ( $search_path =~ /$separator$/ ) {
# If search path ends in a blank item, the split subroutine
# won't have picked it up.
# So add it to the list by hand:
push @list, "";
}
# Replace each blank argument (default) by current directory:
for ($i = 0; $i <= $#list ; $i++ ) {
if ($list[$i] eq "") {$list[$i] = $default;}
}
return @list;
}
#################################
sub get_filetime_offset {
# Usage: get_filetime_offset( prefix, [suffix] )
# Measures offset between filetime in a directory and system time
# Makes a temporary file of a unique name, and deletes in.
# Filename is of form concatenation of prefix, an integer, suffix.
# Prefix is normally of form dir/ or dir/tmp.
# Default default suffix ".tmp".
my $prefix = $_[0];
my $suffix = $_[1] || '.tmp';
my $tmp_file_count = 0;
while (1==1) {
# Find a new temporary file, and make it.
$tmp_file_count++;
my $tmp_file = "${prefix}${tmp_file_count}${suffix}";
if ( ! -e $tmp_file ) {
open( TMP, ">$tmp_file" )
or die "$My_name.get_filetime_offset: In measuring filetime offset, couldn't write to\n",
" temporary file '$tmp_file'\n";
my $time = time();
close(TMP);
my $offset = get_mtime($tmp_file) - $time;
unlink $tmp_file;
return $offset;
}
}
die "$My_name.get_filetime_offset: BUG TO ARRIVE HERE\n";
}
#################################
sub tempfile1 {
# Makes a temporary file of a unique name. I could use file::temp,
# but it is not present in all versions of perl.
# Filename is of form $tmpdir/$_[0]nnn$suffix, where nnn is an integer
my $tmp_file_count = 0;
my $prefix = $_[0];
my $suffix = $_[1];
while (1==1) {
# Find a new temporary file, and make it.
$tmp_file_count++;
my $tmp_file = "${tmpdir}/${prefix}${tmp_file_count}${suffix}";
if ( ! -e $tmp_file ) {
open( TMP, ">$tmp_file" )
or next;
close(TMP);
return $tmp_file;
}
}
die "$My_name.tempfile1: BUG TO ARRIVE HERE\n";
}
#################################
#************************************************************
#************************************************************
# Process/subprocess routines
sub Run_msg {
# Same as Run, but give message about my running
warn_running( "Running '$_[0]'" );
return Run($_[0]);
} #END Run_msg
#==================
sub Run {
# This is wrapper around Run_no_time to capture timing information
my $time1 = processing_time();
my ($pid, $return) = Run_no_time($_[0]);
my $time = processing_time() - $time1;
push @timings, "'$_[0]': time = $time\n";
return ($pid, $return);
} #END Run_msg
#==================
sub Run_no_time {
# Usage: Run_no_time ("command string");
# or Run_no_time ("one-or-more keywords command string");
# Possible keywords: internal, NONE, start, nostart.
#
# A command string not started by keywords just gives a call to system with
# the specified string, I return after that has finished executing.
# Exceptions to this behavior are triggered by keywords.
# The general form of the string is
# Zero or more occurences of the start keyword,
# followed by at most one of the other key words (internal, nostart, NONE),
# followed by (a) a command string to be executed by the systerm
# or (b) if the command string is specified to be internal, then
# it is of the form
#
# routine arguments
#
# which implies invocation of the named Perl subroutine
# with the given arguments, which are obtained by splitting
# the string into words, delimited by spaces, but with
# allowance for double quotes.
#
# The meaning of the keywords is:
#
# start: The command line is to be running detached, as appropriate for
# a previewer. The method is appropriate for the operating system
# (and the keyword is inspired by the action of the start command
# that implements in under MSWin).
# HOWEVER: the start keyword is countermanded by the nostart,
# internal, and NONE keywords. This allows rules that do
# previewing to insert a start keyword to create a presumption
# of detached running unless otherwise.
# nostart: Countermands a previous start keyword; the following command
# string is then to be obeyed by the system, and any necessary
# detaching (as of a previewer) is done by the executed command(s).
# internal: The following command string, of the form 'routine arguments'
# specifies a call to the named Perl subroutine.
# NONE: This does not run anything, but causes an error message to be
# printed. This is provided to allow program names defined in the
# configuration to flag themselves as unimplemented.
# Note that if the word "start" is duplicated at the beginning, that is
# equivalent to a single "start".
#
# Return value is a list (pid, exitcode):
# If a process is spawned sucessfully, and I know the PID,
# return (pid, 0),
# else if process is spawned sucessfully, but I do not know the PID,
# return (0, 0),
# else if process is run,
# return (0, exitcode of process)
# else if I fail to run the requested process
# return (0, suitable return code)
# where return code is 1 if cmdline is null or begins with "NONE" (for
# an unimplemented command)
# or the return value of the Perl subroutine.
my $cmd_line = $_[0];
if ( $cmd_line eq '' ) {
traceback( "$My_name: Bug OR configuration error\n".
" In run of '$rule', attempt to run a null program" );
return (0, 1);
}
# Deal with latexmk-defined pseudocommands 'start' and 'NONE'
# at front of command line:
my $detach = 0;
while ( $cmd_line =~ s/^start +// ) {
# But first remove extra starts (which may have been inserted
# to force a command to be run detached, when the command
# already contained a "start").
$detach = 1;
}
if ( $cmd_line =~ s/^nostart +// ) {
$detach = 0;
}
if ( $cmd_line =~ /^internal\s+([a-zA-Z_]\w*)\s+(.*)$/ ) {
my $routine = $1;
my @args = parse_quotes( $2 );
warn "$My_name: calling $routine( $2 )\n"
if (! $silent);
return ( 0, &$routine( @args ) );
}
elsif ( $cmd_line =~ /^internal\s+([a-zA-Z_]\w*)\s*$/ ) {
my $routine = $1;
warn "$My_name: calling $routine()\n"
if (! $silent);
return ( 0, &$routine() );
}
elsif ( $cmd_line =~ /^NONE/ ) {
warn "$My_name: ",
"Program not implemented for this version. Command line:\n";
warn " '$cmd_line'\n";
return (0, 1);
}
elsif ($detach) {
# Run detached. How to do this depends on the OS
return &Run_Detached( $cmd_line );
}
else {
# The command is given to system as a single argument, to force shell
# metacharacters to be interpreted:
return( 0, system( $cmd_line ) );
}
} #END Run
#************************************************************
sub Run_Detached {
# Usage: Run_Detached ("program arguments ");
# Runs program detached. Returns 0 on success, 1 on failure.
# Under UNIX use a trick to avoid the program being killed when the
# parent process, i.e., me, gets a ctrl/C, which is undesirable for pvc
# mode. (The simplest method, system("program arguments &"), makes the
# child process respond to the ctrl/C.)
# Return value is a list (pid, exitcode):
# If process is spawned sucessfully, and I know the PID,
# return (pid, 0),
# else if process is spawned sucessfully, but I do not know the PID,
# return (0, 0),
# else if I fail to spawn a process
# return (0, 1)
my $cmd_line = $_[0];
## warn "Running '$cmd_line' detached...\n";
if ( $cmd_line =~ /^NONE / ) {
warn "$My_name: ",
"Program not implemented for this version. Command line:\n";
warn " '$cmd_line'\n";
return (0, 1);
}
if ( "$^O" eq "MSWin32" ){
# Win95, WinNT, etc: Use MS's start command:
# Need extra double quotes to deal with quoted filenames:
# MSWin start takes first quoted argument to be a Window title.
return( 0, system( "start \"\" $cmd_line" ) );
} else {
# Assume anything else is UNIX or clone
# For this purpose cygwin behaves like UNIX.
## warn "Run_Detached.UNIX: A\n";
my $pid = fork();
## warn "Run_Detached.UNIX: B pid=$pid\n";
if ( ! defined $pid ) {
## warn "Run_Detached.UNIX: C\n";
warn "$My_name: Could not fork to run the following command:\n";
warn " '$cmd_line'\n";
return (0, 1);
}
elsif( $pid == 0 ){
## warn "Run_Detached.UNIX: D\n";
# Forked child process arrives here
# Insulate child process from interruption by ctrl/C to kill parent:
# setpgrp(0,0);
# Perhaps this works if setpgrp doesn't exist
# (and therefore gives fatal error):
eval{ setpgrp(0,0);};
exec( $cmd_line );
# Exec never returns; it replaces current process by new process
die "$My_name forked process: could not run the command\n",
" '$cmd_line'\n";
}
##warn "Run_Detached.UNIX: E\n";
# Original process arrives here
return ($pid, 0);
}
# NEVER GET HERE.
##warn "Run_Detached.UNIX: F\n";
} #END Run_Detached
#************************************************************
sub find_process_id {
# find_process_id(string) finds id of process containing string and
# being run by the present user. Typically the string will be the
# name of the process or part of its command line.
# On success, this subroutine returns the process ID.
# On failure, it returns 0.
# This subroutine only works on UNIX systems at the moment.
if ( $pid_position < 0 ) {
# I cannot do a ps on this system
return (0);
}
my $looking_for = $_[0];
my @ps_output = `$pscmd`;
my @ps_lines = ();
# There may be multiple processes. Find only latest,
# almost surely the one with the highest process number
# This will deal with cases like xdvi where a script is used to
# run the viewer and both the script and the actual viewer binary
# have running processes.
my @found = ();
shift(@ps_output); # Discard the header line from ps
foreach (@ps_output) {
next unless ( /$looking_for/ ) ;
s/^\s*//;
my @ps_line = split ('\s+');
push @found, $ps_line[$pid_position];
push @ps_lines, $_;
}
if ($#found < 0) {
# No luck in finding the specified process.
return(0);
}
@found = reverse sort @found;
if ($diagnostics) {
print "Found the following processes concerning '$looking_for'\n",
" @found\n",
" I will use $found[0]\n";
print " The relevant lines from '$pscmd' were:\n";
foreach (@ps_lines) { print " $_"; }
}
return $found[0];
}
#************************************************************
#************************************************************
#************************************************************
#============================================
sub cache_good_cwd {
# Set cached value of cwd to current cwd.
# Under cygwin, the cached value is converted to a native MSWin path so
# that the result can be used for input to MSWin programs as well
# as cygwin programs.
# Similarly for msys.
my $cwd = cwd();
if ( $^O eq "cygwin" ) {
my $cmd = "cygpath -w \"$cwd\"";
my $Win_cwd = `$cmd`;
chomp $Win_cwd;
if ( $Win_cwd ) {
$cwd = $Win_cwd;
}
else {
warn "$My_name: Could not correctly run command\n",
" '$cmd'\n",
" to get MSWin version of cygwin path\n",
" '$cwd'\n",
" The result was\n",
" '$Win_cwd'\n";
}
}
elsif ( $^O eq "msys" ) {
$cwd =~ s[^/([a-z])/][\u$1:/];
}
$cache{cwd} = $cwd;
} # END cache_good_cwd
#============================================
sub good_cwd {
# Return cwd, but under cygwin (or ...), convert to MSWin path.
# Use cached result, to save a possible expensive computation (running
# of extenal program under cygwin).
return $cache{cwd};
} # END good_cwd
#============================================
# Directory stack routines
sub pushd {
push @dir_stack, [cwd(), $cache{cwd}];
if ( $#_ > -1) {
chdir $_[0];
&cache_good_cwd;
}
}
#************************************************************
sub popd {
if ($#dir_stack > -1 ) {
my $Parr = pop @dir_stack;
chdir $$Parr[0];
$cache{cwd} = $$Parr[1];
}
}
#************************************************************
sub ifcd_popd {
if ( $do_cd ) {
warn "$My_name: Undoing directory change\n"
if !$silent;
&popd;
}
}
#************************************************************
sub finish_dir_stack {
while ($#dir_stack > -1 ) { &popd; }
}
#************************************************************
#************************************************************
# Break handling routines (for wait-loop in preview continuous)
sub end_wait {
# Handler for break: Set global variable $have_break to 1.
# Some systems (e.g., MSWin reset) appear to reset the handler.
# So I'll re-enable it
&catch_break;
$have_break = 1;
}
#========================
sub catch_break {
# Capture ctrl/C and ctrl/break.
# $SIG{INT} corresponds to ctrl/C on LINUX/?UNIX and MSWin
# $SIG{BREAK} corresponds to ctrl/break on MSWin, doesn't exist on LINUX
$SIG{INT} = \&end_wait;
if ( exists $SIG{BREAK} ) {
$SIG{BREAK} = \&end_wait;
}
}
#========================
sub default_break {
# Arrange for ctrl/C and ctrl/break to give default behavior
$SIG{INT} = 'DEFAULT';
if ( exists $SIG{BREAK} ) {
$SIG{BREAK} = 'DEFAULT';
}
}
#************************************************************
#************************************************************
| 40.457932 | 122 | 0.543311 |
ed3b8ce40e3fbfe580d9e02cd11844acd3bb6b0f | 288 | t | Perl | master/t/pod.t | bldewolf/munin | dd3945db1af900110244db2b5d496a135d2ecdb2 | [
"BSD-3-Clause-Attribution"
]
| 1 | 2017-06-02T13:34:09.000Z | 2017-06-02T13:34:09.000Z | master/t/pod.t | bldewolf/munin | dd3945db1af900110244db2b5d496a135d2ecdb2 | [
"BSD-3-Clause-Attribution"
]
| null | null | null | master/t/pod.t | bldewolf/munin | dd3945db1af900110244db2b5d496a135d2ecdb2 | [
"BSD-3-Clause-Attribution"
]
| null | null | null | use strict;
use warnings;
use Test::More;
use FindBin;
use lib "$FindBin::Bin/../lib";
plan skip_all => 'set TEST_POD to enable this test' unless $ENV{TEST_POD};
eval 'use Test::Pod';
plan (
skip_all => "Test::Pod required for testing for POD errors"
) if $@;
all_pod_files_ok();
| 18 | 74 | 0.684028 |
73e3c76bc2f9615ac3eb19ecd1e3664516c2135f | 2,050 | pm | Perl | auto-lib/Paws/AuditManager/BatchDeleteDelegationByAssessmentError.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 164 | 2015-01-08T14:58:53.000Z | 2022-02-20T19:16:24.000Z | auto-lib/Paws/AuditManager/BatchDeleteDelegationByAssessmentError.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 348 | 2015-01-07T22:08:38.000Z | 2022-01-27T14:34:44.000Z | auto-lib/Paws/AuditManager/BatchDeleteDelegationByAssessmentError.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 87 | 2015-04-22T06:29:47.000Z | 2021-09-29T14:45:55.000Z | # Generated by default/object.tt
package Paws::AuditManager::BatchDeleteDelegationByAssessmentError;
use Moose;
has DelegationId => (is => 'ro', isa => 'Str', request_name => 'delegationId', traits => ['NameInRequest']);
has ErrorCode => (is => 'ro', isa => 'Str', request_name => 'errorCode', traits => ['NameInRequest']);
has ErrorMessage => (is => 'ro', isa => 'Str', request_name => 'errorMessage', traits => ['NameInRequest']);
1;
### main pod documentation begin ###
=head1 NAME
Paws::AuditManager::BatchDeleteDelegationByAssessmentError
=head1 USAGE
This class represents one of two things:
=head3 Arguments in a call to a service
Use the attributes of this class as arguments to methods. You shouldn't make instances of this class.
Each attribute should be used as a named argument in the calls that expect this type of object.
As an example, if Att1 is expected to be a Paws::AuditManager::BatchDeleteDelegationByAssessmentError object:
$service_obj->Method(Att1 => { DelegationId => $value, ..., ErrorMessage => $value });
=head3 Results returned from an API call
Use accessors for each attribute. If Att1 is expected to be an Paws::AuditManager::BatchDeleteDelegationByAssessmentError object:
$result = $service_obj->Method(...);
$result->Att1->DelegationId
=head1 DESCRIPTION
An error entity for the C<BatchDeleteDelegationByAssessment> API. This
is used to provide more meaningful errors than a simple string message.
=head1 ATTRIBUTES
=head2 DelegationId => Str
The identifier for the specified delegation.
=head2 ErrorCode => Str
The error code returned by the C<BatchDeleteDelegationByAssessment>
API.
=head2 ErrorMessage => Str
The error message returned by the C<BatchDeleteDelegationByAssessment>
API.
=head1 SEE ALSO
This class forms part of L<Paws>, describing an object used in L<Paws::AuditManager>
=head1 BUGS and CONTRIBUTIONS
The source code is located here: L<https://github.com/pplu/aws-sdk-perl>
Please report bugs to: L<https://github.com/pplu/aws-sdk-perl/issues>
=cut
| 27.702703 | 129 | 0.749268 |
ed1cae970923fa027c4d786fd8408db9f88d3d38 | 231 | pm | Perl | auto-lib/Azure/Insights/GetComponentQuotaStatusResult.pm | pplu/azure-sdk-perl | 26cbef2d926f571bc1617c26338c106856f95568 | [
"Apache-2.0"
]
| null | null | null | auto-lib/Azure/Insights/GetComponentQuotaStatusResult.pm | pplu/azure-sdk-perl | 26cbef2d926f571bc1617c26338c106856f95568 | [
"Apache-2.0"
]
| null | null | null | auto-lib/Azure/Insights/GetComponentQuotaStatusResult.pm | pplu/azure-sdk-perl | 26cbef2d926f571bc1617c26338c106856f95568 | [
"Apache-2.0"
]
| 1 | 2021-04-08T15:26:39.000Z | 2021-04-08T15:26:39.000Z | package Azure::Insights::GetComponentQuotaStatusResult;
use Moose;
has AppId => (is => 'ro', isa => 'Str' );
has ExpirationTime => (is => 'ro', isa => 'Str' );
has ShouldBeThrottled => (is => 'ro', isa => 'Bool' );
1;
| 25.666667 | 57 | 0.580087 |
ed377bbdc66641370dffb49672d0f096dc77b864 | 1,699 | pm | Perl | PerlLib/ChimericCigarParser.pm | STAR-Fusion/STAR-Fusion | bd4da24434697199c980e5736665dbb1ae525f01 | [
"BSD-3-Clause"
]
| 172 | 2015-04-13T18:27:25.000Z | 2022-03-31T05:39:13.000Z | PerlLib/ChimericCigarParser.pm | JING-Bio/STAR-Fusion | f6e383312918f0af59125a37d90eb862a9216a72 | [
"BSD-3-Clause"
]
| 300 | 2015-04-23T04:24:08.000Z | 2022-03-16T21:51:56.000Z | PerlLib/ChimericCigarParser.pm | JING-Bio/STAR-Fusion | f6e383312918f0af59125a37d90eb862a9216a72 | [
"BSD-3-Clause"
]
| 80 | 2015-07-14T15:39:32.000Z | 2022-03-23T09:11:49.000Z | package ChimericCigarParser;
use strict;
use warnings;
use Carp;
require Exporter;
our @ISA = qw(Exporter);
our @EXPORT = qw(get_genome_coords_via_cigar);
####
sub get_genome_coords_via_cigar {
my ($rst, $cigar) = @_;
## borrowing this code from my SAM_entry.pm
my $genome_lend = $rst;
my $alignment = $cigar;
my $query_lend = 0;
my @genome_coords;
my @query_coords;
$genome_lend--; # move pointer just before first position.
while ($alignment =~ /(\d+)([A-Zp])/g) {
my $len = $1;
my $code = $2;
unless ($code =~ /^[MSDNIHp]$/) {
confess "Error, cannot parse cigar code [$code] ";
}
# print "parsed $len,$code\n";
if ($code eq 'M') { # aligned bases match or mismatch
my $genome_rend = $genome_lend + $len;
my $query_rend = $query_lend + $len;
push (@genome_coords, [$genome_lend+1, $genome_rend]);
push (@query_coords, [$query_lend+1, $query_rend]);
# reset coord pointers
$genome_lend = $genome_rend;
$query_lend = $query_rend;
}
elsif ($code eq 'D' || $code eq 'N' || $code eq 'p') { # insertion in the genome or gap in query (intron, perhaps)
$genome_lend += $len;
}
elsif ($code eq 'I' # gap in genome or insertion in query
||
$code eq 'S' || $code eq 'H') # masked region of query
{
$query_lend += $len;
}
}
return(\@genome_coords, \@query_coords);
}
1; #EOM
| 23.929577 | 122 | 0.501471 |
ed1027fba0e4497cfd170be45d3c084d27f564a8 | 1,755 | pm | Perl | lib/MetaCPAN/Web/Controller/Requires.pm | mjemmeson/metacpan-web | 76873d88e93f455d7f04cd6708d11e578b07cea3 | [
"Artistic-1.0"
]
| null | null | null | lib/MetaCPAN/Web/Controller/Requires.pm | mjemmeson/metacpan-web | 76873d88e93f455d7f04cd6708d11e578b07cea3 | [
"Artistic-1.0"
]
| null | null | null | lib/MetaCPAN/Web/Controller/Requires.pm | mjemmeson/metacpan-web | 76873d88e93f455d7f04cd6708d11e578b07cea3 | [
"Artistic-1.0"
]
| null | null | null | package MetaCPAN::Web::Controller::Requires;
use Moose;
use namespace::autoclean;
BEGIN { extends 'MetaCPAN::Web::Controller' }
# The order of the columns matters here. It aims to be compatible
# to jQuery tablesorter plugin.
__PACKAGE__->config(
sort => {
distribution => {
columns => [qw(name abstract date)],
default => [qw(date desc)],
},
module => {
columns => [qw(name abstract date)],
default => [qw(date desc)],
}
}
);
sub index : Chained('/') : PathPart('requires') : CaptureArgs(0) {
}
sub distribution : Chained('index') : PathPart : Args(1) : Does('Sortable') {
my ( $self, $c, $distribution, $sort ) = @_;
my $cv = AE::cv();
my $page_size = $c->req->get_page_size(50);
my $data
= $c->model('API::Release')
->reverse_dependencies( $distribution, $c->req->page, $page_size,
$sort )->recv;
$c->stash(
{
%{$data},
type_of_required => 'distribution',
required => $distribution,
page_size => $page_size,
template => 'requires.html'
}
);
}
sub module : Chained('index') : PathPart : Args(1) : Does('Sortable') {
my ( $self, $c, $module, $sort ) = @_;
my $cv = AE::cv();
my $page_size = $c->req->get_page_size(50);
my $data
= $c->model('API::Module')
->requires( $module, $c->req->page, $page_size, $sort )->recv;
$c->stash(
{
%{$data},
type_of_required => 'module',
required => $module,
page_size => $page_size,
template => 'requires.html'
}
);
}
1;
| 25.808824 | 77 | 0.499145 |
ed223c5b378b30edb088c164c96c2a8587f4060d | 2,484 | pl | Perl | dockers/perl-dev/cpan_config.pl | CowboyTim/perl-docker | 3957579888352711ac4ac4fbb0aa717399803fd8 | [
"Apache-2.0"
]
| 1 | 2020-10-30T17:31:24.000Z | 2020-10-30T17:31:24.000Z | dockers/perl-dev/cpan_config.pl | CowboyTim/perl-docker | 3957579888352711ac4ac4fbb0aa717399803fd8 | [
"Apache-2.0"
]
| null | null | null | dockers/perl-dev/cpan_config.pl | CowboyTim/perl-docker | 3957579888352711ac4ac4fbb0aa717399803fd8 | [
"Apache-2.0"
]
| null | null | null |
no warnings 'once';
my $b_dir = "/opt/";
my $base_dir = $ENV{CPAN_HOME} || "/opt/tmp/cpan";
my $install_base = $ENV{INSTALL_BASE};
my $destdir = $ENV{DESTDIR};
$ENV{PERL5LIB} ||= "";
$ENV{PERL5LIB} .= "$b_dir/lib/perl5:$b_dir/lib/perl5/auto:$b_dir/lib/perl5/x86_64:$b_dir/lib/perl5/x86_64/auto";
$CPAN::Config = {
'applypatch' => q[],
'auto_commit' => q[0],
'build_cache' => q[100],
'build_dir' => "$base_dir/build",
'build_dir_reuse' => q[0],
'build_requires_install_policy' => q[yes],
'bzip2' => q[bzip2],
'cache_metadata' => q[1],
'check_sigs' => q[0],
'cleanup_after_install' => q[0],
'colorize_output' => q[0],
'commandnumber_in_prompt' => q[1],
'connect_to_internet_ok' => q[1],
'cpan_home' => $base_dir,
'ftp_passive' => q[1],
'ftp_proxy' => q[],
'getcwd' => q[cwd],
'gpg' => q[gpg],
'gzip' => q[gzip],
'halt_on_failure' => q[0],
'histfile' => "$base_dir/histfile",
'histsize' => q[100],
'http_proxy' => q[],
'inactivity_timeout' => q[0],
'index_expire' => q[0.001],
'inhibit_startup_message' => q[0],
'keep_source_where' => "$base_dir/sources",
'load_module_verbosity' => q[none],
'make' => q[make],
'make_arg' => q[-j8],
'make_install_arg' => ($destdir?"DESTDIR=$destdir":""),
'make_install_make_command' => q[make],
'makepl_arg' => "INSTALLDIRS=site",
'mbuild_arg' => q[],
'mbuild_install_arg' => "".($destdir?"--destdir $destdir":""),
'mbuild_install_build_command' => "MAKEFLAGS=-j8 ./Build",
'mbuildpl_arg' => "--installdirs site ".($destdir?"--destdir $destdir":"")." ".($install_base?"--install_base=$install_base":""),
'no_proxy' => q[],
'pager' => q[less],
'patch' => q[patch],
'perl5lib_verbosity' => q[none],
'prefer_external_tar' => q[1],
'prefer_installer' => q[MB],
'prefs_dir' => $base_dir,
'prerequisites_policy' => q[follow],
'recommends_policy' => q[1],
'scan_cache' => q[atstart],
'shell' => q[bash],
'show_unparsable_versions' => q[0],
'show_upload_date' => q[0],
'show_zero_versions' => q[0],
'suggests_policy' => q[0],
'tar' => q[tar],
'tar_verbosity' => q[none],
'term_is_latin' => q[1],
'term_ornaments' => q[1],
'test_report' => q[0],
'trust_test_report_history' => q[0],
'unzip' => q[unzip],
'urllist' => [q[http://www.cpan.org/]],
'use_prompt_default' => q[0],
'use_sqlite' => q[0],
'version_timeout' => q[15],
'wget' => q[wget],
'yaml_load_code' => q[0],
'yaml_module' => q[YAML],
};
1;
__END__
| 31.443038 | 131 | 0.595813 |
ed21ac546568d09514e1df8cc9dde5f4d1385f34 | 472 | pl | Perl | KOST-Val/src/main/resources_notJar/resources/ExifTool-10.15/Perl/lib/unicore/lib/BidiR.pl | rebplu/KOST-VAL | 1537125425068d5faec3bc4f5263df715956ae76 | [
"BSD-3-Clause-No-Nuclear-Warranty"
]
| null | null | null | KOST-Val/src/main/resources_notJar/resources/ExifTool-10.15/Perl/lib/unicore/lib/BidiR.pl | rebplu/KOST-VAL | 1537125425068d5faec3bc4f5263df715956ae76 | [
"BSD-3-Clause-No-Nuclear-Warranty"
]
| null | null | null | KOST-Val/src/main/resources_notJar/resources/ExifTool-10.15/Perl/lib/unicore/lib/BidiR.pl | rebplu/KOST-VAL | 1537125425068d5faec3bc4f5263df715956ae76 | [
"BSD-3-Clause-No-Nuclear-Warranty"
]
| null | null | null | # !!!!!!! DO NOT EDIT THIS FILE !!!!!!!
# This file is built by ./mktables from e.g. UnicodeData.txt.
# Any changes made here will be lost!
#
# This file supports:
# \p{BidiR}
#
# Meaning: Bi-directional category 'R'
#
return <<'END';
05BE
05C0
05C3
05D0 05EA
05F0 05F4
200F
FB1D
FB1F FB28
FB2A FB36
FB38 FB3C
FB3E
FB40 FB41
FB43 FB44
FB46 FB4F
10800 10805
10808
1080A 10835
10837 10838
1083C
1083F
END
| 14.30303 | 62 | 0.605932 |
ed12b3ea15d5e8106849a86e4d9e3713f251f852 | 826 | t | Perl | t/208-T-Basic-contract-is.t | dallaylaen/assert-contract-perl | 3271521525e08d82d5dc4c3175650293c2636881 | [
"Artistic-2.0",
"Unlicense"
]
| null | null | null | t/208-T-Basic-contract-is.t | dallaylaen/assert-contract-perl | 3271521525e08d82d5dc4c3175650293c2636881 | [
"Artistic-2.0",
"Unlicense"
]
| null | null | null | t/208-T-Basic-contract-is.t | dallaylaen/assert-contract-perl | 3271521525e08d82d5dc4c3175650293c2636881 | [
"Artistic-2.0",
"Unlicense"
]
| null | null | null | #!perl
use strict;
use warnings;
BEGIN{ delete @ENV{qw(NDEBUG PERL_NDEBUG)} };
use Test::More;
use Assert::Refute qw(:core);
use Assert::Refute::Contract qw(contract);
my $inner = contract {
refute shift, "t1";
refute shift, "t2";
};
my $outer = contract {
my $exp = shift;
contract_is $inner->apply(@_), $exp, "Contract as expected";
};
my $run1 = $outer->apply( "t2d", 0, 0 );
is $run1->get_sign, "t1d", "Happy case";
note $run1->get_tap;
my $run2 = $outer->apply( "tNNd", 42, 137 );
is $run2->get_sign, "t1d", "Inner failed";
note $run2->get_tap;
my $run3 = $outer->apply( "tNNd", 0, 0 );
is $run3->get_sign, "tNd", "Outer failed";
note $run3->get_tap;
like $run3->get_tap
, qr([Ss]ignature.*Got.*t2d.*Expected.*tNNd.*log.*# ok 1.*# ok 2.*# 1..2)s
, "Reason explained in tap";
done_testing;
| 22.324324 | 78 | 0.623487 |
ed1fd3aa5b8c090fb14a32d42e600913b805cc36 | 2,699 | pm | Perl | auto-lib/Paws/S3/CopyObjectOutput.pm | cah-rfelsburg/paws | de9ffb8d49627635a2da588066df26f852af37e4 | [
"Apache-2.0"
]
| 2 | 2016-09-22T09:18:33.000Z | 2017-06-20T01:36:58.000Z | auto-lib/Paws/S3/CopyObjectOutput.pm | cah-rfelsburg/paws | de9ffb8d49627635a2da588066df26f852af37e4 | [
"Apache-2.0"
]
| null | null | null | auto-lib/Paws/S3/CopyObjectOutput.pm | cah-rfelsburg/paws | de9ffb8d49627635a2da588066df26f852af37e4 | [
"Apache-2.0"
]
| null | null | null |
package Paws::S3::CopyObjectOutput;
use Moose;
has CopyObjectResult => (is => 'ro', isa => 'Paws::S3::CopyObjectResult');
has CopySourceVersionId => (is => 'ro', isa => 'Str');
has Expiration => (is => 'ro', isa => 'Str');
has RequestCharged => (is => 'ro', isa => 'Str');
has ServerSideEncryption => (is => 'ro', isa => 'Str');
has SSECustomerAlgorithm => (is => 'ro', isa => 'Str');
has SSECustomerKeyMD5 => (is => 'ro', isa => 'Str');
has SSEKMSKeyId => (is => 'ro', isa => 'Str');
has VersionId => (is => 'ro', isa => 'Str');
1;
### main pod documentation begin ###
=head1 NAME
Paws::S3:: - Arguments for method on Paws::S3
=head1 DESCRIPTION
This class represents the parameters used for calling the method on the
Amazon Simple Storage Service service. Use the attributes of this class
as arguments to method .
You shouldn't make instances of this class. Each attribute should be used as a named argument in the call to .
As an example:
$service_obj->(Att1 => $value1, Att2 => $value2, ...);
Values for attributes that are native types (Int, String, Float, etc) can passed as-is (scalar values). Values for complex Types (objects) can be passed as a HashRef. The keys and values of the hashref will be used to instance the underlying object.
=head1 ATTRIBUTES
=head2 CopyObjectResult => L<Paws::S3::CopyObjectResult>
=head2 CopySourceVersionId => Str
=head2 Expiration => Str
If the object expiration is configured, the response includes this
header.
=head2 RequestCharged => Str
Valid values are: C<"requester">
=head2 ServerSideEncryption => Str
The Server-side encryption algorithm used when storing this object in
S3 (e.g., AES256, aws:kms).
Valid values are: C<"AES256">, C<"aws:kms">
=head2 SSECustomerAlgorithm => Str
If server-side encryption with a customer-provided encryption key was
requested, the response will include this header confirming the
encryption algorithm used.
=head2 SSECustomerKeyMD5 => Str
If server-side encryption with a customer-provided encryption key was
requested, the response will include this header to provide round trip
message integrity verification of the customer-provided encryption key.
=head2 SSEKMSKeyId => Str
If present, specifies the ID of the AWS Key Management Service (KMS)
master encryption key that was used for the object.
=head2 VersionId => Str
Version ID of the newly created copy.
=head1 SEE ALSO
This class forms part of L<Paws>, documenting arguments for method in L<Paws::S3>
=head1 BUGS and CONTRIBUTIONS
The source code is located here: https://github.com/pplu/aws-sdk-perl
Please report bugs to: https://github.com/pplu/aws-sdk-perl/issues
=cut
| 23.884956 | 249 | 0.718044 |
73f2e010cfc8c75374c0a5cd6a7c04af4fa151cb | 3,528 | pl | Perl | scripts/import/parse_association.pl | fayerodgers/ensembl-variation | 566bbdcda60d91ad4c0afa00e13882bdbd81c14e | [
"Apache-2.0"
]
| null | null | null | scripts/import/parse_association.pl | fayerodgers/ensembl-variation | 566bbdcda60d91ad4c0afa00e13882bdbd81c14e | [
"Apache-2.0"
]
| null | null | null | scripts/import/parse_association.pl | fayerodgers/ensembl-variation | 566bbdcda60d91ad4c0afa00e13882bdbd81c14e | [
"Apache-2.0"
]
| null | null | null | #!/usr/bin/env perl
# Copyright [1999-2015] Wellcome Trust Sanger Institute and the EMBL-European Bioinformatics Institute
# Copyright [2016-2019] EMBL-European Bioinformatics Institute
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
=head1 CONTACT
Please email comments or questions to the public Ensembl
developers list at <http://lists.ensembl.org/mailman/listinfo/dev>.
Questions may also be sent to the Ensembl help desk at
<http://www.ensembl.org/Help/Contact>.
=cut
use strict;
#use DBH;
use Bio::EnsEMBL::Registry;
use FindBin qw( $Bin );
use Getopt::Long;
use ImportUtils qw(dumpSQL debug load);
our ($input_file, $species, $TMP_DIR, $TMP_FILE);
GetOptions('species=s' => \$species,
'input_file=s' => \$input_file,
'tmpdir=s' => \$ImportUtils::TMP_DIR,
'tmpfile=s' => \$ImportUtils::TMP_FILE
);
usage('-species argument is required') if(!$species);
$TMP_DIR = $ImportUtils::TMP_DIR;
$TMP_FILE = $ImportUtils::TMP_FILE;
my $registry_file;
$registry_file ||= $Bin . "/ensembl.registry";
Bio::EnsEMBL::Registry->load_all( $registry_file );
my $dbCore = Bio::EnsEMBL::Registry->get_DBAdaptor($species,'core');
my $dbVariation = Bio::EnsEMBL::Registry->get_DBAdaptor($species,'variation');
my $variation_adaptor = $dbVariation->get_VariationAdaptor;
my $gene_adaptor = $dbCore->get_GeneAdaptor;
my $dbentry_adaptor = $dbCore->get_DBEntryAdaptor();
open IN, "<$input_file" || die "Could not open inout file to parse: $!\n";
#let's parse the file
<IN>; #ignore first line, the header
my ($variation_name,$gene_xref,$p_value);
my ($variation,$genes);
my @row;
my $buffer = {}; #buffer to store the lines to be written
while (<IN>){
chomp;
@row = split;
$variation_name = $row[0];
$gene_xref = $row[2];
$p_value = $row[8];
$variation = $variation_adaptor->fetch_by_name($variation_name);
if (!defined $variation){
print "Variation $variation_name not in the database\n";
next;
}
$genes = $gene_adaptor->fetch_all_by_external_name($gene_xref);
if (!defined $genes->[0]){
print "Gene $gene_xref not in the database\n";
next;
}
print_buffered($buffer,"$TMP_DIR/$TMP_FILE",join("\t",$variation->dbID,$genes->[0]->dbID,"population",$p_value,'gene_expression',"citation") . "\n");
}
print_buffered($buffer);
close IN || die "Could not close file with association data: $!\n";
#import the file
load($dbVariation->dbc,"association","variation_id","gene_id","population","p_value","association_type","citation");
sub print_buffered {
my $buffer = shift;
my $filename = shift;
my $text = shift;
local *FH;
if( ! $filename ) {
# flush the buffer
foreach my $file (keys %{$buffer}){
open( FH, ">>$file" ) or die;
print FH $buffer->{ $file };
close FH;
}
} else {
$buffer->{ $filename } .= $text;
if( length( $buffer->{ $filename } ) > 10_000 ) {
open( FH, ">>$filename" ) or die;
print FH $buffer->{ $filename };
close FH;
$buffer->{ $filename } = '';
}
}
}
| 29.157025 | 153 | 0.680272 |
ed41289634695d80f716e1897edc27d61c7e1db6 | 1,163 | t | Perl | t/00-compile.t | gitpan/Data-Clean-JSON | 160510fe7bb3dfbefff14c28d8824c328d215af5 | [
"Artistic-1.0"
]
| null | null | null | t/00-compile.t | gitpan/Data-Clean-JSON | 160510fe7bb3dfbefff14c28d8824c328d215af5 | [
"Artistic-1.0"
]
| null | null | null | t/00-compile.t | gitpan/Data-Clean-JSON | 160510fe7bb3dfbefff14c28d8824c328d215af5 | [
"Artistic-1.0"
]
| null | null | null | use 5.006;
use strict;
use warnings;
# this test was generated with Dist::Zilla::Plugin::Test::Compile 2.051
use Test::More;
plan tests => 3 + ($ENV{AUTHOR_TESTING} ? 1 : 0);
my @module_files = (
'Data/Clean/Base.pm',
'Data/Clean/FromJSON.pm',
'Data/Clean/JSON.pm'
);
# no fake home requested
my $inc_switch = -d 'blib' ? '-Mblib' : '-Ilib';
use File::Spec;
use IPC::Open3;
use IO::Handle;
open my $stdin, '<', File::Spec->devnull or die "can't open devnull: $!";
my @warnings;
for my $lib (@module_files)
{
# see L<perlfaq8/How can I capture STDERR from an external command?>
my $stderr = IO::Handle->new;
my $pid = open3($stdin, '>&STDERR', $stderr, $^X, $inc_switch, '-e', "require q[$lib]");
binmode $stderr, ':crlf' if $^O eq 'MSWin32';
my @_warnings = <$stderr>;
waitpid($pid, 0);
is($?, 0, "$lib loaded ok");
if (@_warnings)
{
warn @_warnings;
push @warnings, @_warnings;
}
}
is(scalar(@warnings), 0, 'no warnings found')
or diag 'got warnings: ', ( Test::More->can('explain') ? Test::More::explain(\@warnings) : join("\n", '', @warnings) ) if $ENV{AUTHOR_TESTING};
| 21.537037 | 147 | 0.600172 |
ed2a83268ae3664eef6aa5f234558550c9f4006e | 43,502 | pl | Perl | tests/ftpserver.pl | bhargavkumar040/android-source-browsing.platform--external--curl | d43abe883892fe84137052fd27ecd956a2c7cacf | [
"curl"
]
| 7 | 2017-07-13T10:34:54.000Z | 2021-04-16T05:40:35.000Z | tests/ftpserver.pl | bhargavkumar040/android-source-browsing.platform--external--curl | d43abe883892fe84137052fd27ecd956a2c7cacf | [
"curl"
]
| 7 | 2020-04-12T22:25:46.000Z | 2020-04-13T07:50:40.000Z | tests/ftpserver.pl | bhargavkumar040/android-source-browsing.platform--external--curl | d43abe883892fe84137052fd27ecd956a2c7cacf | [
"curl"
]
| 9 | 2017-07-13T12:33:20.000Z | 2021-06-19T02:46:48.000Z | #!/usr/bin/env perl
#***************************************************************************
# _ _ ____ _
# Project ___| | | | _ \| |
# / __| | | | |_) | |
# | (__| |_| | _ <| |___
# \___|\___/|_| \_\_____|
#
# Copyright (C) 1998 - 2010, Daniel Stenberg, <daniel@haxx.se>, et al.
#
# This software is licensed as described in the file COPYING, which
# you should have received as part of this distribution. The terms
# are also available at http://curl.haxx.se/docs/copyright.html.
#
# You may opt to use, copy, modify, merge, publish, distribute and/or sell
# copies of the Software, and permit persons to whom the Software is
# furnished to do so, under the terms of the COPYING file.
#
# This software is distributed on an "AS IS" basis, WITHOUT WARRANTY OF ANY
# KIND, either express or implied.
#
###########################################################################
# This is a server designed for the curl test suite.
#
# In December 2009 we started remaking the server to support more protocols
# that are similar in spirit. Like POP3, IMAP and SMTP in addition to the FTP
# it already supported since a long time. Note that it still only supports one
# protocol per invoke. You need to start mulitple servers to support multiple
# protocols simultaneously.
#
# It is meant to exercise curl, it is not meant to be a fully working
# or even very standard compliant server.
#
# You may optionally specify port on the command line, otherwise it'll
# default to port 8921.
#
# All socket/network/TCP related stuff is done by the 'sockfilt' program.
#
BEGIN {
@INC=(@INC, $ENV{'srcdir'}, '.');
# sub second timestamping needs Time::HiRes
eval {
no warnings "all";
require Time::HiRes;
import Time::HiRes qw( gettimeofday );
}
}
use strict;
use warnings;
use IPC::Open2;
require "getpart.pm";
require "ftp.pm";
require "directories.pm";
use serverhelp qw(
servername_str
server_pidfilename
server_logfilename
mainsockf_pidfilename
mainsockf_logfilename
datasockf_pidfilename
datasockf_logfilename
);
#**********************************************************************
# global vars...
#
my $verbose = 0; # set to 1 for debugging
my $idstr = ""; # server instance string
my $idnum = 1; # server instance number
my $ipvnum = 4; # server IPv number (4 or 6)
my $proto = 'ftp'; # default server protocol
my $srcdir; # directory where ftpserver.pl is located
my $srvrname; # server name for presentation purposes
my $grok_eprt;
my $path = '.';
my $logdir = $path .'/log';
#**********************************************************************
# global vars used for server address and primary listener port
#
my $port = 8921; # default primary listener port
my $listenaddr = '127.0.0.1'; # default address for listener port
#**********************************************************************
# global vars used for file names
#
my $pidfile; # server pid file name
my $logfile; # server log file name
my $mainsockf_pidfile; # pid file for primary connection sockfilt process
my $mainsockf_logfile; # log file for primary connection sockfilt process
my $datasockf_pidfile; # pid file for secondary connection sockfilt process
my $datasockf_logfile; # log file for secondary connection sockfilt process
#**********************************************************************
# global vars used for server logs advisor read lock handling
#
my $SERVERLOGS_LOCK = 'log/serverlogs.lock';
my $serverlogslocked = 0;
#**********************************************************************
# global vars used for child processes PID tracking
#
my $sfpid; # PID for primary connection sockfilt process
my $slavepid; # PID for secondary connection sockfilt process
#**********************************************************************
# global typeglob filehandle vars to read/write from/to sockfilters
#
local *SFREAD; # used to read from primary connection
local *SFWRITE; # used to write to primary connection
local *DREAD; # used to read from secondary connection
local *DWRITE; # used to write to secondary connection
#**********************************************************************
# global vars which depend on server protocol selection
#
my %commandfunc; # protocol command specific function callbacks
my %displaytext; # text returned to client before callback runs
my @welcome; # text returned to client upon connection
#**********************************************************************
# global vars customized for each test from the server commands file
#
my $ctrldelay; # set if server should throttle ctrl stream
my $datadelay; # set if server should throttle data stream
my $retrweirdo; # set if ftp server should use RETRWEIRDO
my $retrnosize; # set if ftp server should use RETRNOSIZE
my $pasvbadip; # set if ftp server should use PASVBADIP
my $nosave; # set if ftp server should not save uploaded data
my %customreply; #
my %customcount; #
my %delayreply; #
#**********************************************************************
# global variables for to test ftp wildcardmatching or other test that
# need flexible LIST responses.. and corresponding files.
# $ftptargetdir is keeping the fake "name" of LIST directory.
my $ftplistparserstate;
my $ftptargetdir;
#**********************************************************************
# global vars used for signal handling
#
my $got_exit_signal = 0; # set if program should finish execution ASAP
my $exit_signal; # first signal handled in exit_signal_handler
#**********************************************************************
# exit_signal_handler will be triggered to indicate that the program
# should finish its execution in a controlled way as soon as possible.
# For now, program will also terminate from within this handler.
#
sub exit_signal_handler {
my $signame = shift;
# For now, simply mimic old behavior.
killsockfilters($proto, $ipvnum, $idnum, $verbose);
unlink($pidfile);
if($serverlogslocked) {
$serverlogslocked = 0;
clear_advisor_read_lock($SERVERLOGS_LOCK);
}
exit;
}
#**********************************************************************
# logmsg is general message logging subroutine for our test servers.
#
sub logmsg {
my $now;
# sub second timestamping needs Time::HiRes
if($Time::HiRes::VERSION) {
my ($seconds, $usec) = gettimeofday();
my ($sec,$min,$hour,$mday,$mon,$year,$wday,$yday,$isdst) =
localtime($seconds);
$now = sprintf("%02d:%02d:%02d.%06d ", $hour, $min, $sec, $usec);
}
else {
my $seconds = time();
my ($sec,$min,$hour,$mday,$mon,$year,$wday,$yday,$isdst) =
localtime($seconds);
$now = sprintf("%02d:%02d:%02d ", $hour, $min, $sec);
}
if(open(LOGFILEFH, ">>$logfile")) {
print LOGFILEFH $now;
print LOGFILEFH @_;
close(LOGFILEFH);
}
}
sub ftpmsg {
# append to the server.input file
open(INPUT, ">>log/server$idstr.input") ||
logmsg "failed to open log/server$idstr.input\n";
print INPUT @_;
close(INPUT);
# use this, open->print->close system only to make the file
# open as little as possible, to make the test suite run
# better on windows/cygwin
}
sub sysread_or_die {
my $FH = shift;
my $scalar = shift;
my $length = shift;
my $fcaller;
my $lcaller;
my $result;
$result = sysread($$FH, $$scalar, $length);
if(not defined $result) {
($fcaller, $lcaller) = (caller)[1,2];
logmsg "Failed to read input\n";
logmsg "Error: $srvrname server, sysread error: $!\n";
logmsg "Exited from sysread_or_die() at $fcaller " .
"line $lcaller. $srvrname server, sysread error: $!\n";
killsockfilters($proto, $ipvnum, $idnum, $verbose);
unlink($pidfile);
if($serverlogslocked) {
$serverlogslocked = 0;
clear_advisor_read_lock($SERVERLOGS_LOCK);
}
exit;
}
elsif($result == 0) {
($fcaller, $lcaller) = (caller)[1,2];
logmsg "Failed to read input\n";
logmsg "Error: $srvrname server, read zero\n";
logmsg "Exited from sysread_or_die() at $fcaller " .
"line $lcaller. $srvrname server, read zero\n";
killsockfilters($proto, $ipvnum, $idnum, $verbose);
unlink($pidfile);
if($serverlogslocked) {
$serverlogslocked = 0;
clear_advisor_read_lock($SERVERLOGS_LOCK);
}
exit;
}
return $result;
}
sub startsf {
my $mainsockfcmd = "./server/sockfilt " .
"--ipv$ipvnum --port $port " .
"--pidfile \"$mainsockf_pidfile\" " .
"--logfile \"$mainsockf_logfile\"";
$sfpid = open2(*SFREAD, *SFWRITE, $mainsockfcmd);
print STDERR "$mainsockfcmd\n" if($verbose);
print SFWRITE "PING\n";
my $pong;
sysread_or_die(\*SFREAD, \$pong, 5);
if($pong !~ /^PONG/) {
logmsg "Failed sockfilt command: $mainsockfcmd\n";
killsockfilters($proto, $ipvnum, $idnum, $verbose);
unlink($pidfile);
if($serverlogslocked) {
$serverlogslocked = 0;
clear_advisor_read_lock($SERVERLOGS_LOCK);
}
die "Failed to start sockfilt!";
}
}
sub sockfilt {
my $l;
foreach $l (@_) {
printf SFWRITE "DATA\n%04x\n", length($l);
print SFWRITE $l;
}
}
sub sockfiltsecondary {
my $l;
foreach $l (@_) {
printf DWRITE "DATA\n%04x\n", length($l);
print DWRITE $l;
}
}
# Send data to the client on the control stream, which happens to be plain
# stdout.
sub sendcontrol {
if(!$ctrldelay) {
# spit it all out at once
sockfilt @_;
}
else {
my $a = join("", @_);
my @a = split("", $a);
for(@a) {
sockfilt $_;
select(undef, undef, undef, 0.01);
}
}
my $log;
foreach $log (@_) {
my $l = $log;
$l =~ s/[\r\n]//g;
logmsg "> \"$l\"\n";
}
}
# Send data to the client on the data stream
sub senddata {
my $l;
foreach $l (@_) {
if(!$datadelay) {
# spit it all out at once
sockfiltsecondary $l;
}
else {
# pause between each byte
for (split(//,$l)) {
sockfiltsecondary $_;
select(undef, undef, undef, 0.01);
}
}
}
}
#**********************************************************************
# protocolsetup initializes the 'displaytext' and 'commandfunc' hashes
# for the given protocol. References to protocol command callbacks are
# stored in 'commandfunc' hash, and text which will be returned to the
# client before the command callback runs is stored in 'displaytext'.
#
sub protocolsetup {
my $proto = $_[0];
if($proto eq 'ftp') {
%commandfunc = (
'PORT' => \&PORT_ftp,
'EPRT' => \&PORT_ftp,
'LIST' => \&LIST_ftp,
'NLST' => \&NLST_ftp,
'PASV' => \&PASV_ftp,
'CWD' => \&CWD_ftp,
'PWD' => \&PWD_ftp,
'EPSV' => \&PASV_ftp,
'RETR' => \&RETR_ftp,
'SIZE' => \&SIZE_ftp,
'REST' => \&REST_ftp,
'STOR' => \&STOR_ftp,
'APPE' => \&STOR_ftp, # append looks like upload
'MDTM' => \&MDTM_ftp,
);
%displaytext = (
'USER' => '331 We are happy you popped in!',
'PASS' => '230 Welcome you silly person',
'PORT' => '200 You said PORT - I say FINE',
'TYPE' => '200 I modify TYPE as you wanted',
'LIST' => '150 here comes a directory',
'NLST' => '150 here comes a directory',
'CWD' => '250 CWD command successful.',
'SYST' => '215 UNIX Type: L8', # just fake something
'QUIT' => '221 bye bye baby', # just reply something
'MKD' => '257 Created your requested directory',
'REST' => '350 Yeah yeah we set it there for you',
'DELE' => '200 OK OK OK whatever you say',
'RNFR' => '350 Received your order. Please provide more',
'RNTO' => '250 Ok, thanks. File renaming completed.',
'NOOP' => '200 Yes, I\'m very good at doing nothing.',
'PBSZ' => '500 PBSZ not implemented',
'PROT' => '500 PROT not implemented',
);
@welcome = (
'220- _ _ ____ _ '."\r\n",
'220- ___| | | | _ \| | '."\r\n",
'220- / __| | | | |_) | | '."\r\n",
'220- | (__| |_| | _ <| |___ '."\r\n",
'220 \___|\___/|_| \_\_____|'."\r\n"
);
}
elsif($proto eq 'pop3') {
%commandfunc = (
'RETR' => \&RETR_pop3,
);
%displaytext = (
'USER' => '+OK We are happy you popped in!',
'PASS' => '+OK Access granted',
'QUIT' => '+OK byebye',
);
@welcome = (
' _ _ ____ _ '."\r\n",
' ___| | | | _ \| | '."\r\n",
' / __| | | | |_) | | '."\r\n",
' | (__| |_| | _ <| |___ '."\r\n",
' \___|\___/|_| \_\_____|'."\r\n",
'+OK cURL POP3 server ready to serve'."\r\n"
);
}
elsif($proto eq 'imap') {
%commandfunc = (
'FETCH' => \&FETCH_imap,
'SELECT' => \&SELECT_imap,
);
%displaytext = (
'LOGIN' => ' OK We are happy you popped in!',
'SELECT' => ' OK selection done',
'LOGOUT' => ' OK thanks for the fish',
);
@welcome = (
' _ _ ____ _ '."\r\n",
' ___| | | | _ \| | '."\r\n",
' / __| | | | |_) | | '."\r\n",
' | (__| |_| | _ <| |___ '."\r\n",
' \___|\___/|_| \_\_____|'."\r\n",
'* OK cURL IMAP server ready to serve'."\r\n"
);
}
elsif($proto eq 'smtp') {
%commandfunc = (
'DATA' => \&DATA_smtp,
'RCPT' => \&RCPT_smtp,
);
%displaytext = (
'EHLO' => '230 We are happy you popped in!',
'MAIL' => '200 Note taken',
'RCPT' => '200 Receivers accepted',
'QUIT' => '200 byebye',
);
@welcome = (
'220- _ _ ____ _ '."\r\n",
'220- ___| | | | _ \| | '."\r\n",
'220- / __| | | | |_) | | '."\r\n",
'220- | (__| |_| | _ <| |___ '."\r\n",
'220 \___|\___/|_| \_\_____|'."\r\n"
);
}
}
sub close_dataconn {
my ($closed)=@_; # non-zero if already disconnected
my $datapid = processexists($datasockf_pidfile);
if(!$closed) {
logmsg "* disconnect data connection\n";
if($datapid > 0) {
print DWRITE "DISC\n";
my $i;
sysread DREAD, $i, 5;
}
}
else {
logmsg "data connection already disconnected\n";
}
logmsg "=====> Closed data connection\n";
logmsg "* quit sockfilt for data (pid $datapid)\n";
if($datapid > 0) {
print DWRITE "QUIT\n";
waitpid($datapid, 0);
unlink($datasockf_pidfile) if(-f $datasockf_pidfile);
}
}
################
################ SMTP commands
################
# what set by "RCPT"
my $smtp_rcpt;
sub DATA_smtp {
my $testno;
if($smtp_rcpt =~ /^TO:(.*)/) {
$testno = $1;
}
else {
return; # failure
}
if($testno eq "<verifiedserver>") {
sendcontrol "554 WE ROOLZ: $$\r\n";
return 0; # don't wait for data now
}
else {
$testno =~ s/^([^0-9]*)([0-9]+).*/$2/;
sendcontrol "354 Show me the mail\r\n";
}
logmsg "===> rcpt $testno was $smtp_rcpt\n";
my $filename = "log/upload.$testno";
logmsg "Store test number $testno in $filename\n";
open(FILE, ">$filename") ||
return 0; # failed to open output
my $line;
my $ulsize=0;
my $disc=0;
my $raw;
while (5 == (sysread \*SFREAD, $line, 5)) {
if($line eq "DATA\n") {
my $i;
my $eob;
sysread \*SFREAD, $i, 5;
my $size = 0;
if($i =~ /^([0-9a-fA-F]{4})\n/) {
$size = hex($1);
}
sysread \*SFREAD, $line, $size;
$ulsize += $size;
print FILE $line if(!$nosave);
$raw .= $line;
if($raw =~ /\x0d\x0a\x2e\x0d\x0a/) {
# end of data marker!
$eob = 1;
}
logmsg "> Appending $size bytes to file\n";
if($eob) {
logmsg "Found SMTP EOB marker\n";
last;
}
}
elsif($line eq "DISC\n") {
# disconnect!
$disc=1;
last;
}
else {
logmsg "No support for: $line";
last;
}
}
if($nosave) {
print FILE "$ulsize bytes would've been stored here\n";
}
close(FILE);
sendcontrol "250 OK, data received!\r\n";
logmsg "received $ulsize bytes upload\n";
}
sub RCPT_smtp {
my ($args) = @_;
$smtp_rcpt = $args;
}
################
################ IMAP commands
################
# global to allow the command functions to read it
my $cmdid;
# what was picked by SELECT
my $selected;
sub SELECT_imap {
my ($testno) = @_;
my @data;
my $size;
logmsg "SELECT_imap got test $testno\n";
$selected = $testno;
return 0;
}
sub FETCH_imap {
my ($testno) = @_;
my @data;
my $size;
logmsg "FETCH_imap got test $testno\n";
$testno = $selected;
if($testno =~ /^verifiedserver$/) {
# this is the secret command that verifies that this actually is
# the curl test server
my $response = "WE ROOLZ: $$\r\n";
if($verbose) {
print STDERR "FTPD: We returned proof we are the test server\n";
}
$data[0] = $response;
logmsg "return proof we are we\n";
}
else {
logmsg "retrieve a mail\n";
$testno =~ s/^([^0-9]*)//;
my $testpart = "";
if ($testno > 10000) {
$testpart = $testno % 10000;
$testno = int($testno / 10000);
}
# send mail content
loadtest("$srcdir/data/test$testno");
@data = getpart("reply", "data$testpart");
}
for (@data) {
$size += length($_);
}
sendcontrol "* FETCH starts {$size}\r\n";
for my $d (@data) {
sendcontrol $d;
}
sendcontrol "$cmdid OK FETCH completed\r\n";
return 0;
}
################
################ POP3 commands
################
sub RETR_pop3 {
my ($testno) = @_;
my @data;
if($testno =~ /^verifiedserver$/) {
# this is the secret command that verifies that this actually is
# the curl test server
my $response = "WE ROOLZ: $$\r\n";
if($verbose) {
print STDERR "FTPD: We returned proof we are the test server\n";
}
$data[0] = $response;
logmsg "return proof we are we\n";
}
else {
logmsg "retrieve a mail\n";
$testno =~ s/^([^0-9]*)//;
my $testpart = "";
if ($testno > 10000) {
$testpart = $testno % 10000;
$testno = int($testno / 10000);
}
# send mail content
loadtest("$srcdir/data/test$testno");
@data = getpart("reply", "data$testpart");
}
sendcontrol "+OK Mail transfer starts\r\n";
for my $d (@data) {
sendcontrol $d;
}
# end with the magic 5-byte end of mail marker
sendcontrol "\r\n.\r\n";
return 0;
}
################
################ FTP commands
################
my $rest=0;
sub REST_ftp {
$rest = $_[0];
logmsg "Set REST position to $rest\n"
}
sub switch_directory_goto {
my $target_dir = $_;
if(!$ftptargetdir) {
$ftptargetdir = "/";
}
if($target_dir eq "") {
$ftptargetdir = "/";
}
elsif($target_dir eq "..") {
if($ftptargetdir eq "/") {
$ftptargetdir = "/";
}
else {
$ftptargetdir =~ s/[[:alnum:]]+\/$//;
}
}
else {
$ftptargetdir .= $target_dir . "/";
}
}
sub switch_directory {
my $target_dir = $_[0];
if($target_dir eq "/") {
$ftptargetdir = "/";
}
else {
my @dirs = split("/", $target_dir);
for(@dirs) {
switch_directory_goto($_);
}
}
}
sub CWD_ftp {
my ($folder, $fullcommand) = $_[0];
switch_directory($folder);
if($ftptargetdir =~ /^\/fully_simulated/) {
$ftplistparserstate = "enabled";
}
else {
undef $ftplistparserstate;
}
}
sub PWD_ftp {
my $mydir;
$mydir = $ftptargetdir ? $ftptargetdir : "/";
if($mydir ne "/") {
$mydir =~ s/\/$//;
}
sendcontrol "257 \"$mydir\" is current directory\r\n";
}
sub LIST_ftp {
# print "150 ASCII data connection for /bin/ls (193.15.23.1,59196) (0 bytes)\r\n";
# this is a built-in fake-dir ;-)
my @ftpdir=("total 20\r\n",
"drwxr-xr-x 8 98 98 512 Oct 22 13:06 .\r\n",
"drwxr-xr-x 8 98 98 512 Oct 22 13:06 ..\r\n",
"drwxr-xr-x 2 98 98 512 May 2 1996 .NeXT\r\n",
"-r--r--r-- 1 0 1 35 Jul 16 1996 README\r\n",
"lrwxrwxrwx 1 0 1 7 Dec 9 1999 bin -> usr/bin\r\n",
"dr-xr-xr-x 2 0 1 512 Oct 1 1997 dev\r\n",
"drwxrwxrwx 2 98 98 512 May 29 16:04 download.html\r\n",
"dr-xr-xr-x 2 0 1 512 Nov 30 1995 etc\r\n",
"drwxrwxrwx 2 98 1 512 Oct 30 14:33 pub\r\n",
"dr-xr-xr-x 5 0 1 512 Oct 1 1997 usr\r\n");
if($ftplistparserstate) {
@ftpdir = ftp_contentlist($ftptargetdir);
}
logmsg "pass LIST data on data connection\n";
for(@ftpdir) {
senddata $_;
}
close_dataconn(0);
sendcontrol "226 ASCII transfer complete\r\n";
return 0;
}
sub NLST_ftp {
my @ftpdir=("file", "with space", "fake", "..", " ..", "funny", "README");
logmsg "pass NLST data on data connection\n";
for(@ftpdir) {
senddata "$_\r\n";
}
close_dataconn(0);
sendcontrol "226 ASCII transfer complete\r\n";
return 0;
}
sub MDTM_ftp {
my $testno = $_[0];
my $testpart = "";
if ($testno > 10000) {
$testpart = $testno % 10000;
$testno = int($testno / 10000);
}
loadtest("$srcdir/data/test$testno");
my @data = getpart("reply", "mdtm");
my $reply = $data[0];
chomp $reply if($reply);
if($reply && ($reply =~ /^[+-]?\d+$/) && ($reply < 0)) {
sendcontrol "550 $testno: no such file.\r\n";
}
elsif($reply) {
sendcontrol "$reply\r\n";
}
else {
sendcontrol "500 MDTM: no such command.\r\n";
}
return 0;
}
sub SIZE_ftp {
my $testno = $_[0];
if($ftplistparserstate) {
my $size = wildcard_filesize($ftptargetdir, $testno);
if($size == -1) {
sendcontrol "550 $testno: No such file or directory.\r\n";
}
else {
sendcontrol "213 $size\r\n";
}
return 0;
}
if($testno =~ /^verifiedserver$/) {
my $response = "WE ROOLZ: $$\r\n";
my $size = length($response);
sendcontrol "213 $size\r\n";
return 0;
}
if($testno =~ /(\d+)\/?$/) {
$testno = $1;
}
else {
print STDERR "SIZE_ftp: invalid test number: $testno\n";
return 1;
}
my $testpart = "";
if($testno > 10000) {
$testpart = $testno % 10000;
$testno = int($testno / 10000);
}
loadtest("$srcdir/data/test$testno");
my @data = getpart("reply", "size");
my $size = $data[0];
if($size) {
if($size > -1) {
sendcontrol "213 $size\r\n";
}
else {
sendcontrol "550 $testno: No such file or directory.\r\n";
}
}
else {
$size=0;
@data = getpart("reply", "data$testpart");
for(@data) {
$size += length($_);
}
if($size) {
sendcontrol "213 $size\r\n";
}
else {
sendcontrol "550 $testno: No such file or directory.\r\n";
}
}
return 0;
}
sub RETR_ftp {
my ($testno) = @_;
if($ftplistparserstate) {
my @content = wildcard_getfile($ftptargetdir, $testno);
if($content[0] == -1) {
#file not found
}
else {
my $size = length $content[1];
sendcontrol "150 Binary data connection for $testno ($size bytes).\r\n",
senddata $content[1];
close_dataconn(0);
sendcontrol "226 File transfer complete\r\n";
}
return 0;
}
if($testno =~ /^verifiedserver$/) {
# this is the secret command that verifies that this actually is
# the curl test server
my $response = "WE ROOLZ: $$\r\n";
my $len = length($response);
sendcontrol "150 Binary junk ($len bytes).\r\n";
senddata "WE ROOLZ: $$\r\n";
close_dataconn(0);
sendcontrol "226 File transfer complete\r\n";
if($verbose) {
print STDERR "FTPD: We returned proof we are the test server\n";
}
return 0;
}
$testno =~ s/^([^0-9]*)//;
my $testpart = "";
if ($testno > 10000) {
$testpart = $testno % 10000;
$testno = int($testno / 10000);
}
loadtest("$srcdir/data/test$testno");
my @data = getpart("reply", "data$testpart");
my $size=0;
for(@data) {
$size += length($_);
}
my %hash = getpartattr("reply", "data$testpart");
if($size || $hash{'sendzero'}) {
if($rest) {
# move read pointer forward
$size -= $rest;
logmsg "REST $rest was removed from size, makes $size left\n";
$rest = 0; # reset REST offset again
}
if($retrweirdo) {
sendcontrol "150 Binary data connection for $testno () ($size bytes).\r\n",
"226 File transfer complete\r\n";
for(@data) {
my $send = $_;
senddata $send;
}
close_dataconn(0);
$retrweirdo=0; # switch off the weirdo again!
}
else {
my $sz = "($size bytes)";
if($retrnosize) {
$sz = "size?";
}
sendcontrol "150 Binary data connection for $testno () $sz.\r\n";
for(@data) {
my $send = $_;
senddata $send;
}
close_dataconn(0);
sendcontrol "226 File transfer complete\r\n";
}
}
else {
sendcontrol "550 $testno: No such file or directory.\r\n";
}
return 0;
}
sub STOR_ftp {
my $testno=$_[0];
my $filename = "log/upload.$testno";
logmsg "STOR test number $testno in $filename\n";
sendcontrol "125 Gimme gimme gimme!\r\n";
open(FILE, ">$filename") ||
return 0; # failed to open output
my $line;
my $ulsize=0;
my $disc=0;
while (5 == (sysread DREAD, $line, 5)) {
if($line eq "DATA\n") {
my $i;
sysread DREAD, $i, 5;
my $size = 0;
if($i =~ /^([0-9a-fA-F]{4})\n/) {
$size = hex($1);
}
sysread DREAD, $line, $size;
#print STDERR " GOT: $size bytes\n";
$ulsize += $size;
print FILE $line if(!$nosave);
logmsg "> Appending $size bytes to file\n";
}
elsif($line eq "DISC\n") {
# disconnect!
$disc=1;
last;
}
else {
logmsg "No support for: $line";
last;
}
}
if($nosave) {
print FILE "$ulsize bytes would've been stored here\n";
}
close(FILE);
close_dataconn($disc);
logmsg "received $ulsize bytes upload\n";
sendcontrol "226 File transfer complete\r\n";
return 0;
}
sub PASV_ftp {
my ($arg, $cmd)=@_;
my $pasvport;
# kill previous data connection sockfilt when alive
killsockfilters($proto, $ipvnum, $idnum, $verbose, 'data');
# We fire up a new sockfilt to do the data transfer for us.
my $datasockfcmd = "./server/sockfilt " .
"--ipv$ipvnum --port 0 " .
"--pidfile \"$datasockf_pidfile\" " .
"--logfile \"$datasockf_logfile\"";
$slavepid = open2(\*DREAD, \*DWRITE, $datasockfcmd);
print DWRITE "PING\n";
my $pong;
sysread_or_die(\*DREAD, \$pong, 5);
if($pong !~ /^PONG/) {
logmsg "failed to run sockfilt for data connection\n";
killsockfilters($proto, $ipvnum, $idnum, $verbose, 'data');
sendcontrol "500 no free ports!\r\n";
return 0;
}
logmsg "Run sockfilt for data on pid $slavepid\n";
# Find out what port we listen on
my $i;
print DWRITE "PORT\n";
# READ the response code
sysread_or_die(\*DREAD, \$i, 5);
# READ the response size
sysread_or_die(\*DREAD, \$i, 5);
my $size = 0;
if($i =~ /^([0-9a-fA-F]{4})\n/) {
$size = hex($1);
}
# READ the response data
sysread_or_die(\*DREAD, \$i, $size);
# The data is in the format
# IPvX/NNN
if($i =~ /IPv(\d)\/(\d+)/) {
# FIX: deal with IP protocol version
$pasvport = $2;
}
if($cmd ne "EPSV") {
# PASV reply
my $p=$listenaddr;
$p =~ s/\./,/g;
if($pasvbadip) {
$p="1,2,3,4";
}
sendcontrol sprintf("227 Entering Passive Mode ($p,%d,%d)\n",
($pasvport/256), ($pasvport%256));
}
else {
# EPSV reply
sendcontrol sprintf("229 Entering Passive Mode (|||%d|)\n", $pasvport);
}
eval {
local $SIG{ALRM} = sub { die "alarm\n" };
# assume swift operations unless explicitly slow
alarm ($datadelay?20:10);
# Wait for 'CNCT'
my $input;
while(sysread(DREAD, $input, 5)) {
if($input !~ /^CNCT/) {
# we wait for a connected client
logmsg "Odd, we got $input from client\n";
next;
}
logmsg "====> Client DATA connect\n";
last;
}
alarm 0;
};
if ($@) {
# timed out
logmsg "$srvrname server timed out awaiting data connection ".
"on port $pasvport\n";
logmsg "accept failed or connection not even attempted\n";
killsockfilters($proto, $ipvnum, $idnum, $verbose, 'data');
return;
}
else {
logmsg "data connection setup on port $pasvport\n";
}
return;
}
# Support both PORT and EPRT here. Consider LPRT too.
sub PORT_ftp {
my ($arg, $cmd) = @_;
my $port;
my $addr;
# We always ignore the given IP and use localhost.
if($cmd eq "PORT") {
if($arg !~ /(\d+),(\d+),(\d+),(\d+),(\d+),(\d+)/) {
logmsg "bad PORT-line: $arg\n";
sendcontrol "500 silly you, go away\r\n";
return 0;
}
$port = ($5<<8)+$6;
$addr = "$1.$2.$3.$4";
}
# EPRT |2|::1|49706|
elsif(($cmd eq "EPRT") && ($grok_eprt)) {
if($arg !~ /(\d+)\|([^\|]+)\|(\d+)/) {
sendcontrol "500 silly you, go away\r\n";
return 0;
}
sendcontrol "200 Thanks for dropping by. We contact you later\r\n";
$port = $3;
$addr = $2;
}
else {
sendcontrol "500 we don't like $cmd now\r\n";
return 0;
}
if(!$port || $port > 65535) {
print STDERR "very illegal PORT number: $port\n";
return 1;
}
# We fire up a new sockfilt to do the data transfer for us.
my $datasockfcmd = "./server/sockfilt " .
"--ipv$ipvnum --connect $port --addr \"$addr\" " .
"--pidfile \"$datasockf_pidfile\" " .
"--logfile \"$datasockf_logfile\"";
$slavepid = open2(\*DREAD, \*DWRITE, $datasockfcmd);
print STDERR "$datasockfcmd\n" if($verbose);
print DWRITE "PING\n";
my $pong;
sysread_or_die(\*DREAD, \$pong, 5);
if($pong !~ /^PONG/) {
logmsg "Failed sockfilt for data connection\n";
killsockfilters($proto, $ipvnum, $idnum, $verbose, 'data');
}
logmsg "====> Client DATA connect to port $port\n";
return;
}
#**********************************************************************
# customize configures test server operation for each curl test, reading
# configuration commands/parameters from server commands file each time
# a new client control connection is established with the test server.
# On success returns 1, otherwise zero.
#
sub customize {
$ctrldelay = 0; # default is no throttling of the ctrl stream
$datadelay = 0; # default is no throttling of the data stream
$retrweirdo = 0; # default is no use of RETRWEIRDO
$retrnosize = 0; # default is no use of RETRNOSIZE
$pasvbadip = 0; # default is no use of PASVBADIP
$nosave = 0; # default is to actually save uploaded data to file
%customreply = (); #
%customcount = (); #
%delayreply = (); #
open(CUSTOM, "<log/ftpserver.cmd") ||
return 1;
logmsg "FTPD: Getting commands from log/ftpserver.cmd\n";
while(<CUSTOM>) {
if($_ =~ /REPLY ([A-Za-z0-9+\/=]+) (.*)/) {
$customreply{$1}=eval "qq{$2}";
logmsg "FTPD: set custom reply for $1\n";
}
if($_ =~ /COUNT ([A-Z]+) (.*)/) {
# we blank the customreply for this command when having
# been used this number of times
$customcount{$1}=$2;
logmsg "FTPD: blank custom reply for $1 after $2 uses\n";
}
elsif($_ =~ /DELAY ([A-Z]+) (\d*)/) {
$delayreply{$1}=$2;
logmsg "FTPD: delay reply for $1 with $2 seconds\n";
}
elsif($_ =~ /SLOWDOWN/) {
$ctrldelay=1;
$datadelay=1;
logmsg "FTPD: send response with 0.01 sec delay between each byte\n";
}
elsif($_ =~ /RETRWEIRDO/) {
logmsg "FTPD: instructed to use RETRWEIRDO\n";
$retrweirdo=1;
}
elsif($_ =~ /RETRNOSIZE/) {
logmsg "FTPD: instructed to use RETRNOSIZE\n";
$retrnosize=1;
}
elsif($_ =~ /PASVBADIP/) {
logmsg "FTPD: instructed to use PASVBADIP\n";
$pasvbadip=1;
}
elsif($_ =~ /NOSAVE/) {
# don't actually store the file we upload - to be used when
# uploading insanely huge amounts
$nosave = 1;
logmsg "FTPD: NOSAVE prevents saving of uploaded data\n";
}
}
close(CUSTOM);
}
#----------------------------------------------------------------------
#----------------------------------------------------------------------
#--------------------------- END OF SUBS ----------------------------
#----------------------------------------------------------------------
#----------------------------------------------------------------------
#**********************************************************************
# Parse command line options
#
# Options:
#
# --verbose # verbose
# --srcdir # source directory
# --id # server instance number
# --proto # server protocol
# --pidfile # server pid file
# --logfile # server log file
# --ipv4 # server IP version 4
# --ipv6 # server IP version 6
# --port # server listener port
# --addr # server address for listener port binding
#
while(@ARGV) {
if($ARGV[0] eq '--verbose') {
$verbose = 1;
}
elsif($ARGV[0] eq '--srcdir') {
if($ARGV[1]) {
$srcdir = $ARGV[1];
shift @ARGV;
}
}
elsif($ARGV[0] eq '--id') {
if($ARGV[1] && ($ARGV[1] =~ /^(\d+)$/)) {
$idnum = $1 if($1 > 0);
shift @ARGV;
}
}
elsif($ARGV[0] eq '--proto') {
if($ARGV[1] && ($ARGV[1] =~ /^(ftp|imap|pop3|smtp)$/)) {
$proto = $1;
shift @ARGV;
}
else {
die "unsupported protocol $ARGV[1]";
}
}
elsif($ARGV[0] eq '--pidfile') {
if($ARGV[1]) {
$pidfile = $ARGV[1];
shift @ARGV;
}
}
elsif($ARGV[0] eq '--logfile') {
if($ARGV[1]) {
$logfile = $ARGV[1];
shift @ARGV;
}
}
elsif($ARGV[0] eq '--ipv4') {
$ipvnum = 4;
$listenaddr = '127.0.0.1' if($listenaddr eq '::1');
$grok_eprt = 0;
}
elsif($ARGV[0] eq '--ipv6') {
$ipvnum = 6;
$listenaddr = '::1' if($listenaddr eq '127.0.0.1');
$grok_eprt = 1;
}
elsif($ARGV[0] eq '--port') {
if($ARGV[1] && ($ARGV[1] =~ /^(\d+)$/)) {
$port = $1 if($1 > 1024);
shift @ARGV;
}
}
elsif($ARGV[0] eq '--addr') {
if($ARGV[1]) {
my $tmpstr = $ARGV[1];
if($tmpstr =~ /^(\d\d?\d?)\.(\d\d?\d?)\.(\d\d?\d?)\.(\d\d?\d?)$/) {
$listenaddr = "$1.$2.$3.$4" if($ipvnum == 4);
}
elsif($ipvnum == 6) {
$listenaddr = $tmpstr;
$listenaddr =~ s/^\[(.*)\]$/$1/;
}
shift @ARGV;
}
}
else {
print STDERR "\nWarning: ftpserver.pl unknown parameter: $ARGV[0]\n";
}
shift @ARGV;
}
#***************************************************************************
# Initialize command line option dependant variables
#
if(!$srcdir) {
$srcdir = $ENV{'srcdir'} || '.';
}
if(!$pidfile) {
$pidfile = "$path/". server_pidfilename($proto, $ipvnum, $idnum);
}
if(!$logfile) {
$logfile = server_logfilename($logdir, $proto, $ipvnum, $idnum);
}
$mainsockf_pidfile = "$path/".
mainsockf_pidfilename($proto, $ipvnum, $idnum);
$mainsockf_logfile =
mainsockf_logfilename($logdir, $proto, $ipvnum, $idnum);
if($proto eq 'ftp') {
$datasockf_pidfile = "$path/".
datasockf_pidfilename($proto, $ipvnum, $idnum);
$datasockf_logfile =
datasockf_logfilename($logdir, $proto, $ipvnum, $idnum);
}
$srvrname = servername_str($proto, $ipvnum, $idnum);
$idstr = "$idnum" if($idnum > 1);
protocolsetup($proto);
$SIG{INT} = \&exit_signal_handler;
$SIG{TERM} = \&exit_signal_handler;
startsf();
logmsg sprintf("%s server listens on port IPv${ipvnum}/${port}\n", uc($proto));
open(PID, ">$pidfile");
print PID $$."\n";
close(PID);
logmsg("logged pid $$ in $pidfile\n");
while(1) {
#
# We read 'sockfilt' commands.
#
my $input;
logmsg "Awaiting input\n";
sysread_or_die(\*SFREAD, \$input, 5);
if($input !~ /^CNCT/) {
# we wait for a connected client
logmsg "sockfilt said: $input";
next;
}
logmsg "====> Client connect\n";
set_advisor_read_lock($SERVERLOGS_LOCK);
$serverlogslocked = 1;
# flush data:
$| = 1;
killsockfilters($proto, $ipvnum, $idnum, $verbose, 'data');
&customize(); # read test control instructions
sendcontrol @welcome;
#remove global variables from last connection
if($ftplistparserstate) {
undef $ftplistparserstate;
}
if($ftptargetdir) {
undef $ftptargetdir;
}
if($verbose) {
for(@welcome) {
print STDERR "OUT: $_";
}
}
while(1) {
my $i;
# Now we expect to read DATA\n[hex size]\n[prot], where the [prot]
# part only is FTP lingo.
# COMMAND
sysread_or_die(\*SFREAD, \$i, 5);
if($i !~ /^DATA/) {
logmsg "sockfilt said $i";
if($i =~ /^DISC/) {
# disconnect
last;
}
next;
}
# SIZE of data
sysread_or_die(\*SFREAD, \$i, 5);
my $size = 0;
if($i =~ /^([0-9a-fA-F]{4})\n/) {
$size = hex($1);
}
# data
sysread SFREAD, $_, $size;
ftpmsg $_;
# Remove trailing CRLF.
s/[\n\r]+$//;
my $FTPCMD;
my $FTPARG;
my $full=$_;
if($proto eq "imap") {
# IMAP is different with its identifier first on the command line
unless (m/^([^ ]+) ([^ ]+) (.*)/ ||
m/^([^ ]+) ([^ ]+)/) {
sendcontrol "$1 '$_': command not understood.\r\n";
last;
}
$cmdid=$1; # set the global variable
$FTPCMD=$2;
$FTPARG=$3;
}
elsif (m/^([A-Z]{3,4})(\s(.*))?$/i) {
$FTPCMD=$1;
$FTPARG=$3;
}
elsif($proto eq "smtp" && m/^[A-Z0-9+\/]{0,512}={0,2}$/i) {
# SMTP long "commands" are base64 authentication data.
$FTPCMD=$_;
$FTPARG="";
}
else {
sendcontrol "500 '$_': command not understood.\r\n";
last;
}
logmsg "< \"$full\"\n";
if($verbose) {
print STDERR "IN: $full\n";
}
my $delay = $delayreply{$FTPCMD};
if($delay) {
# just go sleep this many seconds!
logmsg("Sleep for $delay seconds\n");
my $twentieths = $delay * 20;
while($twentieths--) {
select(undef, undef, undef, 0.05) unless($got_exit_signal);
}
}
my $text;
$text = $customreply{$FTPCMD};
my $fake = $text;
if($text && ($text ne "")) {
if($customcount{$FTPCMD} && (!--$customcount{$FTPCMD})) {
# used enough number of times, now blank the customreply
$customreply{$FTPCMD}="";
}
}
else {
$text = $displaytext{$FTPCMD};
}
my $check;
if($text && ($text ne "")) {
if($cmdid && ($cmdid ne "")) {
sendcontrol "$cmdid$text\r\n";
}
else {
sendcontrol "$text\r\n";
}
}
else {
$check=1; # no response yet
}
unless($fake && ($fake ne "")) {
# only perform this if we're not faking a reply
my $func = $commandfunc{$FTPCMD};
if($func) {
&$func($FTPARG, $FTPCMD);
$check=0; # taken care of
}
}
if($check) {
logmsg "$FTPCMD wasn't handled!\n";
sendcontrol "500 $FTPCMD is not dealt with!\r\n";
}
} # while(1)
logmsg "====> Client disconnected\n";
if($serverlogslocked) {
$serverlogslocked = 0;
clear_advisor_read_lock($SERVERLOGS_LOCK);
}
}
killsockfilters($proto, $ipvnum, $idnum, $verbose);
unlink($pidfile);
if($serverlogslocked) {
$serverlogslocked = 0;
clear_advisor_read_lock($SERVERLOGS_LOCK);
}
exit;
| 27.620317 | 87 | 0.491173 |
ed03fb4769df01444090a7332259292ae8a57676 | 909 | al | Perl | Apps/CZ/CoreLocalizationPack/app/Src/PageExtensions/BlanketSalesOrdSubform.PageExt.al | manjulchauhan/ALAppExtensions | 3f2f1d6e5337188b1af9c0275420f1c1de036a7f | [
"MIT"
]
| 127 | 2018-04-17T18:03:03.000Z | 2019-05-06T18:54:17.000Z | Apps/CZ/CoreLocalizationPack/app/Src/PageExtensions/BlanketSalesOrdSubform.PageExt.al | snu-development/ALAppExtensions | 371a27fe48483be776642dde19483a87ae27289c | [
"MIT"
]
| 2,279 | 2018-09-12T12:01:49.000Z | 2019-05-06T13:59:35.000Z | Apps/CZ/CoreLocalizationPack/app/Src/PageExtensions/BlanketSalesOrdSubform.PageExt.al | snu-development/ALAppExtensions | 371a27fe48483be776642dde19483a87ae27289c | [
"MIT"
]
| 41 | 2018-05-17T11:19:52.000Z | 2019-04-30T17:30:38.000Z | pageextension 11778 "Blanket Sales Ord. Subform CZL" extends "Blanket Sales Order Subform"
{
layout
{
addafter("Allow Invoice Disc.")
{
field("Tariff No. CZL"; Rec."Tariff No. CZL")
{
ApplicationArea = Basic, Suite;
ToolTip = 'Specifies a code for the item''s tariff number.';
Visible = false;
}
field("Statistic Indication CZL"; Rec."Statistic Indication CZL")
{
ApplicationArea = Basic, Suite;
ToolTip = 'Specifies the statistic indication code.';
Visible = false;
}
field("Net Weight CZL"; Rec."Net Weight")
{
ApplicationArea = Basic, Suite;
ToolTip = 'Specifies the net weight of the item.';
Visible = false;
}
}
}
}
| 32.464286 | 90 | 0.493949 |
ed24c1e992c2d671f2485a84e0a8ab91e4f77575 | 34,981 | pm | Perl | lib/Gtk2/Ex/DbLinker/Form.pm | gitpan/Gtk2-Ex-DbLinker | 5f337521928ca94abaf82faa51abedc7c84dbe09 | [
"Artistic-1.0-cl8"
]
| null | null | null | lib/Gtk2/Ex/DbLinker/Form.pm | gitpan/Gtk2-Ex-DbLinker | 5f337521928ca94abaf82faa51abedc7c84dbe09 | [
"Artistic-1.0-cl8"
]
| null | null | null | lib/Gtk2/Ex/DbLinker/Form.pm | gitpan/Gtk2-Ex-DbLinker | 5f337521928ca94abaf82faa51abedc7c84dbe09 | [
"Artistic-1.0-cl8"
]
| null | null | null | package Gtk2::Ex::DbLinker::Form;
use Gtk2::Ex::DbLinker;
our $VERSION = $Gtk2::Ex::DbLinker::VERSION;
use strict;
use warnings;
use Glib qw/TRUE FALSE/;
use Carp;
use DateTime::Format::Strptime;
my %fieldtype = (
varchar => "Glib::String" ,
char =>"Glib::String" ,
integer => "Glib::Int",
boolean => "Glib::Boolean",
date => "Glib::String",
serial=> "Glib::Int",
text => "Glib::String",
smallint => "Glib::Int",
mediumint => "Glib::Int",
timestamp => "Glib::String",
enum => "Glib::String",
);
my %signals = (
'GtkCalendar' => 'day_selected',
'GtkToggleButton' => 'toggled',
'GtkTextView' => \&_get_textbuffer,
'Gtk2::TextBuffer' => 'changed',
'GtkComboBoxEntry' => 'changed',
'GtkComboBox' => 'changed',
'GtkCheckButton' => 'toggled',
'GtkEntry' => 'changed',
'GtkSpinButton' => 'value_changed'
);
#
#coderef to place the value of record x in each field, combo, toggle...
#
my %setter = (
'GtkEntry' => \&_set_entry,
'GtkToggleButton' => \&_set_check,
'GtkComboBox' => \&_set_combo,
'GtkComboBoxEntry' => \&_set_combo,
'GtkCheckButton' => \&_set_check,
'GtkSpinButton' => \&_set_spinbutton,
'GtkTextView' => \&_set_textentry
);
my %getter = (
'GtkEntry' => sub {my $w = shift; return $w->get_text;},
'GtkToggleButton' => sub { return shift->get_active;},
'GtkComboBox' => , \&_get_combobox_firstvalue,
'GtkComboBoxEntry' => \&_get_combobox_firstvalue,
'GtkCheckButton' => sub { return shift->get_active;},
'GtkSpinButton' => sub { return shift->get_active;},
'GtkTextView' => sub{my $textview = shift; my $buffer = $textview->get_buffer; return $buffer->get_text($buffer->get_bounds, FALSE);},
);
# 'GtkSpinButton' => \&set_spinbutton,
# sub {return shift->child->get_text; },
# sub {my $c = shift; print "getter_cbe\n"; my $iter = $c->get_active_iter; return $c->get_model->get( $iter ); }
#
sub new {
my ($class, $req)=@_;
my $self ={
dman => $$req{data_manager},
cols => $$req{datawidgets},
null_string => $$req{null_string} || "null",
builder => $$req{builder},
after_insert => $$req{after_insert},
on_changed => $$req{on_changed},
rec_spinner => $$req{rec_spinner} || "RecordSpinner",
status_label => $$req{status_label} || "lbl_RecordStatus",
rec_count_label => $$req{rec_count_label} || "lbl_RecordCount",
on_current => $$req{on_current},
date_formatters => $$req{date_formatters},
time_zone => $$req{time_zone},
locale => $$req{locale} || 'fr_CH',
auto_apply => (defined $$req{auto_apply} ? $$req{auto_apply} : 1),
};
bless $self, $class;
#$self->{cols} = [];
$self->_init;
my @dates;
$self->{subform} = [];
#my %formatters_db;
#my %formatters_f;
# $self->{dates_formatted} = \(keys %{$self->{date_formatters}});
foreach my $v ( keys %{$self->{date_formatters}}){
$self->{log}->debug("** " . $v . " **");
push @dates, $v;
}
$self->{dates_formatted} = \@dates;
$self->{dates_formatters} = {};
$self->{pos2del} = [];
return $self;
} #new
sub _init {
my ($self) = @_;
$self->{painting}=1;
# get a ref to the Gtk widget used for the record spinner or if the id has been guiven, get the ref via the builder
$self->{rec_spinner} =(ref $self->{rec_spinner} ? $self->{rec_spinner} : $self->{builder}->get_object( $self->{rec_spinner} ));
$self->{rec_count_label} = (ref $self->{rec_count_label} ? $self->{rec_count_label} : $self->{builder}->get_object( $self->{rec_count_label} ));
$self->{status_label} = (ref $self->{status_label} ? $self->{status_label} : $self->{builder}->get_object( $self->{status_label} ));
$self->{log} = Log::Log4perl->get_logger(__PACKAGE__);
$self->{log}->debug(" ** New Form object ** ");
$self->{changed} = 0;
if (! defined $self->{cols}){
my @col = $self->{dman}->get_field_names;
$self->{cols} = \@col;
}
$self->_bind_on_changed;
$self->_set_recordspinner;
croak __PACKAGE__ . ": a data manager is required" unless (defined $self->{dman});
$self->{dman}->set_row_pos(0);
}
sub set_data_manager {
my ($self, $dman) = @_;
$self->{dman} = $dman;
}
sub add_childform {
my ($self, $sf) = @_;
$self->{log}->warn("add_childform : do not set auto_apply to 0 if you call this method") unless ($self->{auto_apply});
#carp("add_childform : do not set auto_apply to 0 if you call this method") unless ($self->{auto_apply});
push @{$self->{subform}}, $sf;
}
#dman must contains all the rows
sub add_combo{
my ($self, $req)=@_;
my $combo = {
dman => $$req{data_manager},
id => $$req{id},
fields=> $$req{fields},
};
my $column_no = 0;
my @cols;
if ( defined $combo->{fields}) {
@cols= @{$combo->{fields}};
} else {
@cols = $combo->{dman}->get_field_names;
}
my @list_def;
if ( $$req{builder} && (ref $self eq "")){ #static init
$self = {};
$self->{builder} = $$req{builder};
$self->{log} = Log::Log4perl->get_logger("Gtk2::Ex::DbLinker::Form");
my $w = $self->{builder}->get_object($combo->{id});
if ($w) {
my $name = $w->get_name;
$self->{datawidgets}->{ $combo->{id} } = $w;
$self->{datawidgetsName}->{ $combo->{id} }= $name;
} else {
croak "no widget found for combo " . $combo->{id};
}
}
$self->{log}->debug("cols: " . join(" ", @cols));
my $w = $self->{datawidgets}->{$combo->{id}};
croak('no widget found for combo ' . $combo->{id}) unless ($w);
#my @col = @{$self->{cols}};
croak ("no fields found for combo $combo->{id}") unless(@cols);
my $lastfield = @cols;
#the column to show is either the first (pos 0) if it's the only column or
#the first ( and the next )
my $displayedcol = ($lastfield > 1 ? 1 : 0);
$w->set_text_column( $displayedcol );
my $model = $w->get_model;
foreach my $field ( @cols ) {
#push @list_def, "Glib::String";
my $type = $combo->{dman}->get_field_type($field);
my $gtype = $fieldtype{ $type } if ($type);
if ($gtype) {
$self->{log}->debug("field: " . $field . " type : " . $type);
} else {
$self->{log}->debug("no Glib type found for field $field assuming Glib::String");
$gtype = "Glib::String";
}
push @list_def, $gtype;
$self->{log}->debug("add_combo: $field $column_no $gtype");
#column 0 is not shown unless it's the only column
#column 1 is display in the entrycompletrion code below
#column above 1 are displayed here:
if ( ( ! defined $model) && $column_no > 1 ) {
$self->{log}->debug("new renderer for $column_no");
my $renderer = Gtk2::CellRendererText->new;
$w->pack_start( $renderer, TRUE);
# $self->{log}->debug("add_combo: " . $field . " set text for " . $column_no);
$w->set_attributes( $renderer, 'text' => $column_no );
#$combo->{renderers_setup} = 1;
}
$column_no ++;
} #for each
#$combo->{renderers_setup} = 1;
if ($model) {
$self->{log}->debug("clearing existing model");
$model->clear;
} else {
$model = Gtk2::ListStore->new( @list_def );
$w->set_model($model);
}
$self->{log}->debug(join(" ", @list_def));
my $i;
my $last = $combo->{dman}->row_count -1 ;
for ($i = 0; $i <= $last; $i++) {
#$row = $d->column_accessor_value_pairs;
$combo->{dman}->set_row_pos($i);
my @model_row;
my $column = 0;
push @model_row, $model->append;
foreach my $field ( @cols ) {
#push @model_row, $column, $row->{$field};
my $value = $combo->{dman}->get_field($field);
#$self->{log}->debug("add_combo: " . $value);
push @model_row, $column++, $value;
#$column ++;
}
$self->{log}->debug("row : " . join(" ", @model_row));
$model->set( @model_row );
}
$self->{log}->debug("add_combo: " . $i . " rows added");
if ($self->{datawidgetsName}->{$combo->{id}} eq "GtkComboBoxEntry" ){
#if ( ! $self->{combos_set}->{$combo->{id}} ) {
#$w->set_text_column( 1 );
#$self->{combos_set}->{ $combo->{id} } = TRUE;
#}
my $entrycompletion = Gtk2::EntryCompletion->new;
$entrycompletion->set_minimum_key_length( 1 );
$entrycompletion->set_model( $model );
$entrycompletion->set_text_column( $displayedcol );
$w->get_child->set_completion( $entrycompletion );
}
} #sub
sub _display_data {
my ($self, $pos ) = @_;
# $self->{log}->debug( "display_data for row at pos " . $pos );
my $dman = $self->{dman};
$self->{pos} = $pos;
$dman->set_row_pos($pos) unless ($pos<0);
$self->{painting}=1;
#foreach my $id (keys %{$self->{datawidgets}}){
foreach my $id (@{$self->{cols}}) {
my $w = $self->{datawidgets}->{$id};
my $name = $self->{datawidgetsName}->{$id};
my $x;
#my $row = $self->{data}[$pos];
if ($pos < 0) {
$x= undef;
} else {
#$x = $row->$id() if ($row);
$x = $dman->get_field($id);
my $ref = ref $x;
$self->{log}->debug("ref: " . $ref) if ($ref);
if ($ref && $ref eq "ARRAY") {
# my @set = $row->$id();
#my @set = $dman->get_field($id);
my @set = @$x;
$x = join(',', @set);
$self->{log}->debug( "id: " . $id . " gtkname : " . $name . " ref value: " . ($x?ref($x):"") . " value: " . ($x?$x:"") . " type : ". $self->{dman}->get_field_type($id) );
}
}
# $w->signal_handler_block()
if ( $id ~~ @{$self->{dates_formatted}}){
#$x = $self->_dateformatter($self->{date_formatters}->{$id}, $x);
if ( defined $x){
#my $ff = $self->{dates_formatters_f}->{$id};
#my $fdb = $self->{dates_formatters_db}->{$id};
# $self->{log}->debug("display_data formatted received date: ". $x);
$x = $self->_format_date(0, $id, $x);
}
}
$setter{$name}($self, $w, $x) if($name && $setter{$name});
}
#$self->{pos}= $pos;
my $first = ($pos < 0 ? 0 : 1);
$self->_set_record_status_label;
$self->_set_rs_range($first);
$self->{on_current}() if ($self->{on_current});
$self->{painting}=0;
$self->{changed}=0;
}
sub undo{
my $self = shift;
$self->{changed}=0;
$self->{pos2del}= [];
$self->_display_data( $self->{pos} );
if ($self->{rec_spinner}){
$self->{rec_spinner}->signal_handler_block( $self->{rs_value_changed_signal} );
$self->{rec_spinner}->set_value($self->{pos} + 1);
$self->{rec_spinner}->signal_handler_unblock( $self->{rs_value_changed_signal} );
}
}
sub insert {
my $self = shift;
$self->{log}->debug("insert");
# my $row = $self->{data}[0]->new;
#$self->{pos} = $self->{count} + 1;
#afficher des champs vides
$self->_display_data(-1);
#data_manager->new_row is called when apply is cliked
if ($self->{rec_spinner}){
# my $last = $self->{dman}->row_count;
$self->{rec_spinner}->signal_handler_block( $self->{rs_value_changed_signal} );
$self->{rec_spinner}->set_value(0);
$self->{rec_spinner}->signal_handler_unblock( $self->{rs_value_changed_signal} );
}
}
sub delete {
my $self = shift;
$self->{log}->debug("Linker::Main delete at " . $self->{dman}->get_row_pos );
#my $pos = $self->{pos};
#my $row = $self->{data}[$pos];
#$row->delete;
#$self->next;
$self->{changed} = 1;
# $self->{dman}->delete;
push @{$self->{pos2del}}, $self->{dman}->get_row_pos;
#$self->set_rs_range(1);
$self->_set_record_status_label;
}
sub apply{
my $self = shift;
my $row;
#we are adding a new record if $pos < 0
$self->{log}->debug("apply: pos : " . $self->{pos} );
if ($self->{pos}<0){
#my $class = $self->{class};
#$row = $class->new;
$self->{dman}->new_row;
#push @{$self->{data}}, $row;
# $self->{count} ++;
$self->{log}->debug("New row");
# $self->{dman}->set_row_pos($self->{dman}->row_count);
}
# deleting a (or some) record
for my $p (@{$self->{pos2del}}){
$self->{dman}->set_row_pos($p);
$self->{dman}->delete;
}
$self->{log}->debug("items in pos2del: " . scalar @{ $self->{pos2del} } );
if (scalar @{$self->{pos2del}}){
$self->{pos2del} = [];
$self->{changed} = 0;
# $self->set_record_status_label;
$self->{rec_spinner}->set_value(1) if ($self->{rec_spinner});
return;
}
#updating a new or an existing record
#foreach widget in the form, get the value from the widget and place it in the field unless it's a primary key
#with an autogenerated value
my @pk;
$self->{log}->debug("cols: " . join(" ", @{$self->{cols}}));
foreach my $id (@{$self->{cols}}){
if (exists $self->{datawidgets}->{$id}){
my $w = $self->{datawidgets}->{$id};
$self->{log}->debug($self->{datawidgetsName}->{$id});
my $coderef = $getter{ $self->{datawidgetsName}->{$id} };
my $v = &$coderef( $w );
$self->{log}->debug("apply id: $id value: ". ($v?$v:""));
@pk = $self->{dman}->get_autoinc_primarykeys;
if ($id ~~ @pk) {
$self->{log}->debug("not done because it's a auto incremented pk");
} else {
$v = ($v eq "" ? undef : $v);
$self->{log}->debug($id . ": value undef") unless ( defined $v);
if ( defined $v && ( $id ~~ @{$self->{dates_formatted}})){
#my $ff = $self->{dates_formatters_f}->{$id};
#my $date = $ff->parse_datetime($v);
$v = $self->_format_date(1, $id, $v);
# $v = $self->{dates_formatters_db}->{$id}->format_datetime($date);
#$v = $self->dateformatter('%Y-%m-%d', $date);
}
if ($self->{pos} < -1 ) {
$self->{log}->debug("current row pos: " . $self->{dman}->get_row_pos);
# $self->{log}->debug("last row pos: " . $self->{dman}->row_count -1);
# $self->{dman}->set_row_pos($self->{dman}->get_row_count);
$self->{dman}->set_field($id, $v);
} else {
$self->{dman}->set_field($id, $v);
}
$self->{log}->debug("done");
} # not in @pk
} # if exists
else {
$self->{log}->debug($id . " not in data");
}
} #foreach
#$row->save;
$self->{dman}->save;
# $self->{log}->debug("nofm: " . $row->nofm);
# $self->set_rs_range;
#if we were adding a row, put it at the end of the array, and display all the values in the form
#ie the value from the user or default value from the database.
my %pk_val;
for my $pk (@pk) {
$self->{log}->debug("Primary Key: " . $pk);
my $value = $self->{dman}->get_field($pk);
#if (my $ref = eval { $row->can( $pk ) }) {
#$value = $row->$ref();
$pk_val{$pk} = $value;
#}
}
#push @pk_val, $id
if ($self->{after_insert}){
my $coderef = $self->{after_insert};
&$coderef(undef, \%pk_val );
}
if ($self->{pos}<0){
my $last = $self->{dman}->row_count -1;
$self->{log}->debug("last is " . $last );
$self->_display_data( $last );
if ($self->{rec_spinner}){
# my $last = $self->{dman}->row_count;
$self->{rec_spinner}->signal_handler_block( $self->{rs_value_changed_signal} );
$self->{rec_spinner}->set_value($last+1);
$self->{rec_spinner}->signal_handler_unblock( $self->{rs_value_changed_signal} );
}
} else {
$self->{changed}=0;
}
$self->_save_subforms;
$self->_set_record_status_label;
}
sub next{
my $self = shift;
if ($self->{auto_apply} && $self->has_changed){ $self->apply;}
$self->_display_data($self->{dman}->next);
}
sub previous {
my $self = shift;
if ($self->{auto_apply} && $self->has_changed){ $self->apply;}
$self->_display_data($self->{dman}->previous);
}
sub first{
my $self = shift;
if ($self->{auto_apply} && $self->has_changed){ $self->apply;}
$self->_display_data($self->{dman}->first);
}
sub last {
my $self = shift;
if ($self->{auto_apply} && $self->has_changed){ $self->apply;}
$self->_display_data($self->{dman}->last);
}
sub has_changed {
my $self = shift;
my $result= $self->{changed};
if ($self->{auto_apply}) {
foreach my $sf (@{$self->{subform}}){
if ($sf->has_changed){
$result = 1;
last;
}
}
}
return $result;
}
#bind an onchanged sub with each modification of the datafields
sub _bind_on_changed {
my $self = shift;
# my @cols = $self->{dman}->get_field_names;
foreach my $id ( @{$self->{cols}} ){
my $w = $self->{builder}->get_object($id);
$self->{log}->debug("bind_on_changed looking for widget " . $id);
if ($w) {
my $name = $w->get_name;
$self->{datawidgets}->{$id} = $w;
$self->{datawidgetsName}->{$id}= $name;
if ( ref( $signals{$name}) eq "CODE"){
my $coderef = $signals{$name};
$w = &$coderef($self, $w);
$name = ref $w;
}
$self->{log}->debug("bind $name $id with self->changed \n");
$w->signal_connect_after( $signals{$name} => sub{ $self->_changed( $id )});
} else { $self->{log}->debug(" ... not found ");}
}
}
# Associe une fonction sur value_changed du record_spinner qui appelle move avec abs: valeur lue dans l'etiquette du recordspinner
# Place
sub _set_recordspinner {
my $self = shift;
$self->{log}->debug("set_recordspinner");
# die unless($self->{rec_spinner});
my $coderef;
if ( $self->{rec_spinner} ) {
# The return type of the signal_connect() function is a tag that identifies your callback function.
# You may have as many callbacks per signal and per object as you need, and each will be executed in turn,
# in the order they were attached.
$coderef = $self->{rec_spinner}->signal_connect_after( value_changed => sub {
my $pos = $self->{rec_spinner}->get_text -1;
$self->{log}->debug("rs_value changed will move to " . $pos);
$self->{rec_spinner}->signal_handler_block( $coderef );
#$self->move( undef, $pos);
if ($self->{auto_apply} && $self->has_changed){ $self->apply;}
$self->{dman}->set_row_pos($pos);
$self->_display_data($pos);
$self->{rec_spinner}->signal_handler_unblock( $coderef );
return TRUE;
}
);
$self->{rs_value_changed_signal}= $coderef;
$self->{log}->debug("recordspinner set");
}
}
sub _set_rs_range {
my ( $self, $first ) = @_;
# Convenience function that sets the min / max value of the record spinner
$self->{log}->debug("set_rs_range first : " . $first);
if ( $self->{rec_spinner} ) {
my $ad = $self->{rec_spinner}->get_adjustment;
$self->{log}->debug("adj lower : ". $ad->lower);
if ($first < $ad->lower){ $ad->lower($first); $self->{rec_spinner}->set_adjustment( $ad ); }
$self->{rec_spinner}->signal_handler_block( $self->{rs_value_changed_signal} );
$self->{rec_spinner}->set_range( $first, $self->{dman}->row_count );
$self->{rec_spinner}->signal_handler_unblock( $self->{rs_value_changed_signal} );
}
$self->{rec_count_label}->set_text(" / " . $self->{dman}->row_count);
return TRUE;
}
sub _set_entry {
my ($self, $w, $x) = @_;
if (defined $x){
$self->{log}->debug("set_entry: " . $x);
$w->set_text( $x ) ;
} else {
$self->{log}->debug("set_entry: text entry undef " . $w->get_name) ;
$w->set_text("");
}
}
sub _set_textentry {
my ($self, $w, $x) = @_;
$self->{log}->debug("set_textentry text entry undef") if (! defined $x);
$w->get_buffer->set_text($x || "");
}
sub _set_combo {
my ($self, $w, $x) = @_;
$self->{log}->debug("set_combo value " . ( defined $x ? $x : " undef") . " widget: ". ref $w );
my $m = $w->get_model;
my $iter = $m->get_iter_first;
if ( ref $w eq "Gtk2::ComboBoxEntry" ) {
$w->get_child->set_text( "" );
}
my $match_found = 0;
while ( $iter ) {
if ( ( defined $x ) && ( $x eq $m->get( $iter, 0 ) ) ) {
$match_found = 1;
$w->set_active_iter( $iter );
last;
}
$iter = $m->iter_next( $iter );
}
if ( ! $match_found && $x ) {
$self->{log}->debug( "Failed to set " . ref $w . " to $x\n" );
}
}
sub _set_check {
my ($self, $w, $x) = @_;
$w->set_active( $x );
}
sub _get_combobox_firstvalue {
my ($c) = @_;
#print "getter_cb\n";
my $iter = $c->get_active_iter;
return ($iter ? $c->get_model->get( $iter,0) : undef );
}
sub _set_spinbutton {
my ($self, $w, $x) = @_;
if ($self->getID($w) eq $self->getID($self->{rec_spinner})) {$self->{log}->debug("Found record_spinner... leaving"); return;}
$w->set_value( $x || 0 );
}
sub _get_textbuffer {
my ($self, $w) = @_;
return $w->get_buffer;
}
sub _changed {
my ( $self, $fieldname ) = @_;
# $self->{log}->debug("self->changed for $fieldname");
if (! $self->{painting}){
$self->{changed}=1;
if ( $self->{on_changed} ) {
$self->{on_changed}();
}
$self->_set_record_status_label;
}
return FALSE;
}
sub _save_subforms {
my ($self) = @_;
return unless ($self->{auto_apply});
foreach my $sf (@{$self->{subform}}){
$sf->apply if ($sf->has_changed);
}
}
sub _set_record_status_label {
my $self = shift;
# $self->{log}->debug("set_record_satus_label changed is " . $self->{changed});
if ( $self->{status_label} ) {
if ( $self->{data_lock} ) {
$self->{status_label}->set_markup( "<b><i><span color='red'>Locked</span></i></b>" );
} elsif ($self->{changed}) {
$self->{status_label}->set_markup( "<b><span color='red'>Changed</span></b>" );
} else {
$self->{status_label}->set_markup( "<b><span color='blue'>Synchronized</span></b>" );
}
}
}
sub set_widget_value {
my ($self, $wid, $x) = @_;
$self->{log}->debug("set_widget_value: " . $wid . " to " . $x);
my $w = $self->{builder}->get_object($wid);
if ($w) {
my $coderef = $setter{ $self->{datawidgetsName}->{$wid} };
&$coderef($self, $w, $x );
}
}
sub get_widget_value {
my ($self, $wid) = @_;
my $x;
$self->{log}->debug("get_widget_value: " . $wid);
my $w = $self->{builder}->get_object($wid);
$self->{log}->debug("no widget found") unless ($w);
if ($w && $self->{datawidgetsName}) {
my $coderef = $getter{ $self->{datawidgetsName}->{$wid} };
$x = &$coderef( $w );
}
$self->{log}->debug("found: " . ($x ? $x : " undef"));
return ($x ? $x: "");
}
sub update{
my ($self) = @_;
my @col = $self->{dman}->get_field_names;
$self->{log}->debug("update cols are " . (@col ? join(" " , @col) : " cols undef "));
if ( $self->{dman}->row_count > 0) {
$self->_display_data(0);
} else {
$self->_display_data(-1)
}
}
#parameter $in_db is 0 or 1 :
# 0 we are reading from the db, and the format to use are at the pos 0 and 1 in the array of format for the field
# 1 we are writing to the db and the format are to use in a revers order
# $id is the field id
# $v the date string from the form (if in_db is 1) or from the db (if in_db is 0)
sub _format_date{
my ($self, $in_db, $id, $v) = @_;
$self->{log}->debug("format_date received date: ". $v);
my ($pos1, $pos2 ) = ( $in_db ? (1, 0) : (0, 1));
my $format = $self->{date_formatters}->{$id}->[$pos1];
my $f = $self->_get_dateformatter($format);
my $dt = $f->parse_datetime($v) or croak($f->errmsg);
$self->{log}->debug("format_date: date time object ymd: " . $dt->ymd);
$format = $self->{date_formatters}->{$id}->[$pos2];
$f = $self->_get_dateformatter($format);
my $r = $f->format_datetime($dt) or croak($f->errmsg);
$self->{log}->debug("format_date formatted date: ". $r);
return $r;
}
# create a formatter if none is found in the hash for the corresponding formatting string and store it for later use, and return it or
# return an existing formatter
sub _get_dateformatter {
my ($self, $format) = @_;
my %hf = %{$self->{dates_formatters}};
my $f;
if (exists $hf{$format}){
$self->{log}->debug("get_dateformatter : return an existing formatter for " . $format);
$f = $hf{$format};
} else {
$self->{log}->debug("get_dateformatter: new formatter for " . $format);
$f = new DateTime::Format::Strptime(
pattern => $format,
locale => $self->{locale},
time_zone => $self->{time_zone},
on_error =>'undef',
);
$hf{$format} = $f;
}
$self->{dates_formatters} = \%hf;
return $f;
}
sub get_data_manager{
return shift->{dman};
}
1;
__END__
=head1 NAME
Gtk2::Ex::DbLinker::Form - a module that display data from a database in glade generated Gtk2 interface
=head1 VERSION
See Version in L<Gtk2::Ex::DbLinker>
=head1 SYNOPSIS
use Rdb::Coll::Manager;
use Rdb::Biblio::Manager;
use Gtk2::Ex::DbLinker::RdbDataManager;
use Gtk2::Ex::DbLinker::Form;
use Gtk2 -init;
use Gtk2::GladeXML;
my $builder = Gtk2::Builder->new();
$builder->add_from_file($path_to_glade_file);
$builder->connect_signals($self);
This gets the Rose::DB::Object::Manager (we could have use plain sql command, or DBIx::Class object instead), and the DataManager object we pass to the form constructor.
my $data = Rdb::Mytable::Manager->get_mytable(query => [pk_field => {eq => $value]);
my $dman = Gtk2::Ex::DbLinker::RdbDataManager->new({data=> $data, meta => Rdb::Mytable->meta });
This create the form.
$self->{form_coll} = Gtk2::Ex::DbLinker::Form->new({
data_manager => $dman,
meta => Rdb::Mytable->meta,
builder => $builder,
rec_spinner => $self->{dnav}->get_object('RecordSpinner'),
status_label=> $self->{dnav}->get_object('lbl_RecordStatus'),
rec_count_label => $self->{dnav}->get_object("lbl_recordCount"),
on_current => sub {on_current($self)},
date_formatters => {
field_id1 => ["%Y-%m-%d", "%d-%m-%Y"],
field_id2 => ["%Y-%m-%d", "%d-%m-%Y"], },
time_zone => 'Europe/Zurich',
locale => 'fr_CH',
});
C<rec_spinner>, C<status_label>, C<rec_count_label> are Gtk2 widget used to display the position of the current record. See one of the example 2 files in the examples folder for more details.
C<date_formatters> receives a hash of id for the Gtk2::Entries in the Glade file (keys) and an arrays (values) of formating strings.
In this array
=over
=item *
pos 0 is the date format of the database.
=item *
pos 1 is the format to display the date in the form.
=back
C<time_zone> and C<locale> are needed by Date::Time::Strptime.
To display new rows on a bound subform, connect the on_changed event to the field of the primary key in the main form.
In this sub, call a sub to synchonize the form:
In the main form:
sub on_nofm_changed {
my $widget = shift;
my $self = shift;
my $pk_value = $widget->get_text();
$self->{subform_a}->synchronize_with($pk_value);
...
}
In the subform_a module
sub synchronize_with {
my ($self,$value) = @_;
my $data = Rdb::Product::Manager->get_product(with_objects => ['seller_product'], query => ['seller_product.no_seller' => {eq => $value}]);
$self->{subform_a}->get_data_manager->query($data);
$self->{subform_a}->update;
}
=head2 Dealing with many to many relationship
It's the sellers and products situation where a seller sells many products and a product is selled by many sellers.
One way is to have a insert statement that insert a new row in the linking table (named transaction for example) each time a new row is added in the product table.
An other way is to create a data manager for the transaction table
With DBI
$dman = Gtk2::Ex::DbLinker::DbiDataManager->new({ dbh => $self->{dbh}, sql =>{select =>"no_seller, no_product", from => "transaction", where => ""}});
With Rose::DB::Object
$data = Rdb::Transaction::Manager->get_transaction(query=> [no_seller => {eq => $current_seller }]);
$dman = Gtk2::Ex::DbLinker::RdbDataManager->new({data => $data, meta=> Rdb::Transaction->meta});
And keep a reference of this for latter
$self->{linking_data} = $dman;
If you want to link a new row in the table product with the current seller, create a method that is passed and array of primary key values for the current seller and the new product.
sub update_linking_table {
my ( $self, $keysref) = @_;
my @keys = keys %{$keysref};
my $f = $self->{main_form};
my $dman = $self->{main_abo}->{linking_data};
$dman->new_row;
foreach my $k (@keys){
my $value = ${$keysref}{$k};
$dman->set_field($k, $value );
}
$dman->save;
}
This method is to be called when a new row has been added to the product table:
sub on_newproduct_applied_clicked {
my $button = shift;
my $self = shift;
my $main = $f->{main_form};
$self->{product}->apply;
my %h;
$h{no_seller}= $main->{no_seller};
$h{no_product}= $self->{abo}->get_widget_value("no_product");
$self->update_linking_table(\%h);
}
You may use the same method to delete a row from the linking table
my $data = Rdb::Transaction::Manager->get_transaction(query=> [no_seller => {eq => $seller }, no_product=>{eq => $product } ] );
$f->{linking_data}->query($data);
$f->{linking_data}->delete;
=head1 DESCRIPTION
This module automates the process of tying data from a database to widgets on a Glade-generated form.
All that is required is that you name your widgets the same as the fields in your data source.
Steps for use:
=over
=item *
Create a xxxDataManager object that contains the rows to display
=item *
Create a Gtk2::GladeXML object (the form widget)
=item *
Create a Gtk2::Ex::DbLinker::Form object that links the data and your form
=item *
You would then typically connect the buttons to the methods below to handle common actions
such as inserting, moving, deleting, etc.
=back
=head1 METHODS
=head2 constructor
The C<new();> method expects a hash reference of key / value pairs
=over
=item *
C<data_manager> a instance of a xxxDataManager object
=item *
C<builder> a Gtk2::GladeXML builder
=back
The following keys are optional
=over
=item *
C<datawidgets> a reference to an array of id in the glade file that will display the fields
=item *
C<rec_spinner> the name of a GtkSpinButton to use as the record spinner or a reference to this widget. The default is to use a
widget called RecordSpinner.
=item *
C<rec_count_label> name (default to "lblRecordCount") or a reference to a label that indicate the position of the current row in the rowset
=item *
C<status_label> name (default to "lbl_RecordStatus") or a reference to a label that indicate the changed or syncronized flag of the current row
=item *
C<on_current> a reference to sub that will be called when moving to a new record
=item *
C<date_formatters> a reference to an hash of Gtk2Entries id (keys), and format strings that follow Rose::DateTime::Util (value) to display formatted Date
=item *
C<auto_apply> defaults to 1, meaning that apply will be called if a changed has been made in a widget before moving to another record. Set this to 0 if you don't want this feature
=back
=head2 C<add_combo( { data_manager =E<gt> $dman, id =E<gt> 'noed', fields =E<gt> ["id", "nom"], }); >
Once the constructor has been called, combo designed in the glade file received their rows with this method.
The parameter is a hash reference, and the key and value are
=over
=item *
C<data_manager> a dataManager instance that holds the rows of the combo
=item *
C<id> the id of the widget in the glade file
=item *
C<fields> an array reference holdings the names of fields in the combo (this parameter is needed with RdbDataManager only)
=back
=head2 C< Gtk2::Ex::DbLinker::Form->add_combo({ data_manager =E<gt> $combodata, id =E<gt> 'countryid', builder =E<gt> $builder, }); >
This method can also be called as a class method, when the underlying form is not bound to any table. You need to pass the Gtk2::Builder object as a supplemental parameter.
=head2 C<update();>
Reflect in the user interface the changes made after the data manager has been queried, or on the form creation
=head2 C<get_data_manager();>
Returns the data manager to be queried
=head2 C<set_data_manager( $dman ); >
Replaces the current data manager with the one receives. The columns should not changed, but this method can be use to change the join clause.
=head2 C<get_widget_value ( $widget_id );>
Returns the value of a data widget from its id
=head2 C<set_widget_value ( $widget_id, $value )>;
Sets the value of a data widget from its id
=head2 Methods applied to a row of data
=over
=item *
C<insert()>;
Displays an empty rows at position 0 in the record_count_label.
=item *
C<delete();>
Marks the current row to be deleted. The delele itself will be done on apply.
=item *
C<apply():>
Save a new row, save changes on an existing row, or delete the row(s) marked for deletion.
=item *
C<undo();>
Revert the row to the original state in displaying the values fetch from the database.
=item *
C<next();>
=item *
C<previous()>;
=item *
C<first();>
=item *
C<last();>
=item *
C<add_childform( $childform );>
You may add any dependant form or datasheet object with this call if you want that a changed in this subform/datasheet be applied when the apply method of this form is called.
=item *
C<has_changed();>
Return 1 if the data has been edited in the form and in any subform added with C<add_childform()> but not saved to the database. Return 0 otherwise.
=back
=head1 SUPPORT
Any Gk2::Ex::DbLinker questions or problems can be posted to the the mailing list. To subscribe to the list or view the archives, go here:
L<http://groups.google.com/group/gtk2-ex-dblinker>.
You may also send emails to gtk2-ex-dblinker@googlegroups.com.
The current state of the source can be extract using Mercurial from
L<http://code.google.com/p/gtk2-ex-dblinker/>.
=head1 AUTHOR
FranE<ccedil>ois Rappaz <rappazf@gmail.com>
=head1 COPYRIGHT
Copyright (c) 2014 by F. Rappaz. All rights reserved.
This program is free software; you can redistribute
it and/or modify it under the same terms as Perl itself.
=head1 SEE ALSO
L<Gtk2::Ex::DBI>
=head1 CREDIT
Daniel Kasak, whose modules initiate this work.
=cut
1;
| 28.814662 | 193 | 0.58992 |
ed18fc1c39924f32bde94d2130080a2764081aa5 | 5,733 | pl | Perl | egs/wsj/s5/steps/nnet3/get_saturation.pl | ajaech/kaldi | cd27a83f17164c9f4b65f3c32df6c1f5288337cd | [
"Apache-2.0"
]
| 805 | 2018-05-28T02:32:04.000Z | 2022-03-26T09:13:12.000Z | egs/wsj/s5/steps/nnet3/get_saturation.pl | ajaech/kaldi | cd27a83f17164c9f4b65f3c32df6c1f5288337cd | [
"Apache-2.0"
]
| 49 | 2015-10-24T22:06:28.000Z | 2019-12-24T11:13:34.000Z | egs/wsj/s5/steps/nnet3/get_saturation.pl | ajaech/kaldi | cd27a83f17164c9f4b65f3c32df6c1f5288337cd | [
"Apache-2.0"
]
| 267 | 2018-06-07T08:33:28.000Z | 2022-03-30T12:18:33.000Z | #!/usr/bin/env perl
# This program parses the output of nnet3-am-info or nnet3-info,
# and prints out a number between zero and one that reflects
# how saturated the (sigmoid and tanh) nonlinearities are, on average
# over the model.
#
# This is based on the 'avg-deriv' (average-derivative) values printed
# out for the sigmoid and tanh components. The 'saturation' of such a component
# is defined as (1.0 - its avg-deriv / the maximum possible derivative of that nonlinearity),
# where the denominator is 1.0 for tanh and 0.25 for sigmoid.
# This component averages the saturation over all the sigmoid/tanh units in
# the network.
#
# It parses the Info() output of components of type SigmoidComponent,
# TanhComponent, and LstmNonlinearityComponent. It prints an error message to
# stderr and returns with status 1 if it could not find the info for any such components
# in the input stream.
# Usage: nnet3-am-info 10.mdl | steps/nnet3/get_saturation.pl
# or: nnet3-info 10.raw | steps/nnet3/get_saturation.pl
use warnings;
my $num_nonlinearities = 0;
my $total_saturation = 0.0;
while (<STDIN>) {
if (m/type=SigmoidComponent/) {
# a line like:
# component name=Lstm1_f type=SigmoidComponent, dim=1280, count=5.02e+05,
# value-avg=[percentiles(0,1,2,5 10,20,50,80,90
# 95,98,99,100)=(0.06,0.17,0.19,0.24 0.28,0.33,0.44,0.62,0.79
# 0.96,0.99,1.0,1.0), mean=0.482, stddev=0.198],
# deriv-avg=[percentiles(0,1,2,5 10,20,50,80,90
# 95,98,99,100)=(0.0001,0.003,0.004,0.03 0.12,0.18,0.22,0.24,0.25
# 0.25,0.25,0.25,0.25), mean=0.198, stddev=0.0591]
if (m/deriv-avg=[^m]+mean=([^,]+),/) {
$num_nonlinearities += 1;
my $this_saturation = 1.0 - ($1 / 0.25);
$total_saturation += $this_saturation;
} else {
print STDERR "$0: could not make sense of line (no deriv-avg?): $_";
}
} elsif (m/type=TanhComponent/) {
if (m/deriv-avg=[^m]+mean=([^,]+),/) {
$num_nonlinearities += 1;
my $this_saturation = 1.0 - ($1 / 1.0);
$total_saturation += $this_saturation;
} else {
print STDERR "$0: could not make sense of line (no deriv-avg?): $_";
}
} elsif (m/type=LstmNonlinearityComponent/) {
# An example of a line like this is right at the bottom of this program, it's extremely long.
my $ok = 1;
foreach my $sigmoid_name ( ("i_t", "f_t", "o_t") ) {
if (m/${sigmoid_name}_sigmoid=[{][^}]+deriv-avg=[^}]+mean=([^,]+),/) {
$num_nonlinearities += 1;
my $this_saturation = 1.0 - ($1 / 0.25);
$total_saturation += $this_saturation;
} else {
$ok = 0;
}
}
foreach my $tanh_name ( ("c_t", "m_t") ) {
if (m/${tanh_name}_tanh=[{][^}]+deriv-avg=[^}]+mean=([^,]+),/) {
$num_nonlinearities += 1;
my $this_saturation = 1.0 - ($1 / 1.0);
$total_saturation += $this_saturation;
} else {
$ok = 0;
}
}
if (! $ok) {
print STDERR "Could not parse at least one of the avg-deriv values in the following info line: $_";
}
}
}
if ($num_nonlinearities == 0) {
print "0.0\n";
exit(0);
} else {
my $saturation = $total_saturation / $num_nonlinearities;
if ($saturation < 0.0 || $saturation > 1.0) {
print STDERR "Bad saturation value: $saturation\n";
exit(1);
} else {
print "$saturation\n";
}
}
# example line with LstmNonlinearityComponent that we parse:
# component name=lstm2.lstm_nonlin type=LstmNonlinearityComponent, input-dim=2560, output-dim=1024, learning-rate=0.002, max-change=0.75, cell-dim=512, w_ic-rms=0.9941, w_fc-rms=0.8901, w_oc-rms=0.9794, count=3.53e+05, i_t_sigmoid={ self-repair-lower-threshold=0.05, self-repair-scale=1e-05, self-repaired-proportion=0.0722299, value-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(0.04,0.08,0.09,0.12 0.17,0.25,0.46,0.76,0.87 0.91,0.96,0.96,1.0), mean=0.494, stddev=0.253], deriv-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(0.0007,0.03,0.04,0.06 0.09,0.12,0.19,0.23,0.24 0.25,0.25,0.25,0.25), mean=0.179, stddev=0.0595] }, f_t_sigmoid={ self-repair-lower-threshold=0.05, self-repair-scale=1e-05, self-repaired-proportion=0.0688061, value-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(0.06,0.11,0.13,0.17 0.22,0.30,0.51,0.70,0.82 0.90,0.96,0.98,1.0), mean=0.509, stddev=0.219], deriv-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(0.001,0.01,0.03,0.07 0.11,0.15,0.21,0.24,0.25 0.25,0.25,0.25,0.25), mean=0.194, stddev=0.0561] }, c_t_tanh={ self-repair-lower-threshold=0.2, self-repair-scale=1e-05, self-repaired-proportion=0.178459, value-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(-1.0,-0.98,-0.97,-0.92 -0.82,-0.65,-0.01,0.66,0.87 0.94,0.95,0.97,0.99), mean=0.00447, stddev=0.612], deriv-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(0.003,0.02,0.04,0.10 0.14,0.25,0.65,0.84,0.90 0.94,0.97,0.97,0.98), mean=0.58, stddev=0.281] }, o_t_sigmoid={ self-repair-lower-threshold=0.05, self-repair-scale=1e-05, self-repaired-proportion=0.0608838, value-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(0.02,0.07,0.09,0.12 0.17,0.25,0.52,0.77,0.86 0.90,0.94,0.96,0.99), mean=0.514, stddev=0.256], deriv-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(0.007,0.04,0.04,0.07 0.09,0.12,0.19,0.23,0.24 0.25,0.25,0.25,0.25), mean=0.175, stddev=0.0579] }, m_t_tanh={ self-repair-lower-threshold=0.2, self-repair-scale=1e-05, self-repaired-proportion=0.134653, value-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(-0.99,-0.95,-0.92,-0.85 -0.73,-0.51,0.02,0.48,0.73 0.86,0.96,0.98,1.0), mean=0.00581, stddev=0.522], deriv-avg=[percentiles(0,1,2,5 10,20,50,80,90 95,98,99,100)=(0.002,0.03,0.04,0.13 0.26,0.41,0.75,0.93,0.97 0.99,1.0,1.0,1.0), mean=0.672, stddev=0.272] }
| 57.909091 | 2,330 | 0.64748 |
ed162b0a87380bcb5374963d5b162b9f202835c8 | 21,760 | pl | Perl | perl/lib/unicore/To/Scx.pl | ifleeyo180/VspriteMoodleWebsite | 38baa924829c83808d2c87d44740ff365927a646 | [
"Apache-2.0"
]
| null | null | null | perl/lib/unicore/To/Scx.pl | ifleeyo180/VspriteMoodleWebsite | 38baa924829c83808d2c87d44740ff365927a646 | [
"Apache-2.0"
]
| null | null | null | perl/lib/unicore/To/Scx.pl | ifleeyo180/VspriteMoodleWebsite | 38baa924829c83808d2c87d44740ff365927a646 | [
"Apache-2.0"
]
| null | null | null | # !!!!!!! DO NOT EDIT THIS FILE !!!!!!!
# This file is machine-generated by ..\lib\unicore\mktables from the Unicode
# database, Version 13.0.0. Any changes made here will be lost!
# !!!!!!! INTERNAL PERL USE ONLY !!!!!!!
# This file is for internal use by core Perl only. The format and even the
# name or existence of this file are subject to change without notice. Don't
# use it directly. Use Unicode::UCD to access the Unicode character data
# base.
# The name this table is to be known by, with the format of the mappings in
# the main body of the table, and what all code points missing from this file
# map to.
$Unicode::UCD::SwashInfo{'ToScx'}{'format'} = 'sw'; # string, but some elements are interpreted as a list; white space occurs only as list item separators
$Unicode::UCD::SwashInfo{'ToScx'}{'missing'} = 'Unknown';
return <<'END';
0 40 Common
41 5A Latin
5B 60 Common
61 7A Latin
7B A9 Common
AA Latin
AB B9 Common
BA Latin
BB BF Common
C0 D6 Latin
D7 Common
D8 F6 Latin
F7 Common
F8 2B8 Latin
2B9 2DF Common
2E0 2E4 Latin
2E5 2E9 Common
2EA 2EB Bopomofo
2EC 2FF Common
300 341 Inherited
342 Greek
343 344 Inherited
345 Greek
346 362 Inherited
363 36F Latin
370 373 Greek
374 Common
375 377 Greek
37A 37D Greek
37E Common
37F Greek
384 Greek
385 Common
386 Greek
387 Common
388 38A Greek
38C Greek
38E 3A1 Greek
3A3 3E1 Greek
3E2 3EF Coptic
3F0 3FF Greek
400 482 Cyrillic
483 Cyrillic Old_Permic
484 Cyrillic Glagolitic
485 486 Cyrillic Latin
487 Cyrillic Glagolitic
488 52F Cyrillic
531 556 Armenian
559 58A Armenian
58D 58F Armenian
591 5C7 Hebrew
5D0 5EA Hebrew
5EF 5F4 Hebrew
600 604 Arabic
605 Common
606 60B Arabic
60C Arabic Hanifi_Rohingya Syriac Thaana Yezidi
60D 61A Arabic
61B Arabic Hanifi_Rohingya Syriac Thaana Yezidi
61C Arabic Syriac Thaana
61E Arabic
61F Arabic Hanifi_Rohingya Syriac Thaana Yezidi
620 63F Arabic
640 Adlam Arabic Mandaic Manichaean Psalter_Pahlavi Hanifi_Rohingya Sogdian Syriac
641 64A Arabic
64B 655 Arabic Syriac
656 65F Arabic
660 669 Arabic Thaana Yezidi
66A 66F Arabic
670 Arabic Syriac
671 6D3 Arabic
6D4 Arabic Hanifi_Rohingya
6D5 6DC Arabic
6DD Common
6DE 6FF Arabic
700 70D Syriac
70F 74A Syriac
74D 74F Syriac
750 77F Arabic
780 7B1 Thaana
7C0 7FA Nko
7FD 7FF Nko
800 82D Samaritan
830 83E Samaritan
840 85B Mandaic
85E Mandaic
860 86A Syriac
8A0 8B4 Arabic
8B6 8C7 Arabic
8D3 8E1 Arabic
8E2 Common
8E3 8FF Arabic
900 950 Devanagari
951 Bengali Devanagari Grantha Gujarati Gurmukhi Kannada Latin Malayalam Oriya Sharada Tamil Telugu Tirhuta
952 Bengali Devanagari Grantha Gujarati Gurmukhi Kannada Latin Malayalam Oriya Tamil Telugu Tirhuta
953 954 Inherited
955 963 Devanagari
964 Bengali Devanagari Dogra Gunjala_Gondi Masaram_Gondi Grantha Gujarati Gurmukhi Kannada Mahajani Malayalam Nandinagari Oriya Khudawadi Sinhala Syloti_Nagri Takri Tamil Telugu Tirhuta
965 Bengali Devanagari Dogra Gunjala_Gondi Masaram_Gondi Grantha Gujarati Gurmukhi Kannada Limbu Mahajani Malayalam Nandinagari Oriya Khudawadi Sinhala Syloti_Nagri Takri Tamil Telugu Tirhuta
966 96F Devanagari Dogra Kaithi Mahajani
970 97F Devanagari
980 983 Bengali
985 98C Bengali
98F 990 Bengali
993 9A8 Bengali
9AA 9B0 Bengali
9B2 Bengali
9B6 9B9 Bengali
9BC 9C4 Bengali
9C7 9C8 Bengali
9CB 9CE Bengali
9D7 Bengali
9DC 9DD Bengali
9DF 9E3 Bengali
9E6 9EF Bengali Chakma Syloti_Nagri
9F0 9FE Bengali
A01 A03 Gurmukhi
A05 A0A Gurmukhi
A0F A10 Gurmukhi
A13 A28 Gurmukhi
A2A A30 Gurmukhi
A32 A33 Gurmukhi
A35 A36 Gurmukhi
A38 A39 Gurmukhi
A3C Gurmukhi
A3E A42 Gurmukhi
A47 A48 Gurmukhi
A4B A4D Gurmukhi
A51 Gurmukhi
A59 A5C Gurmukhi
A5E Gurmukhi
A66 A6F Gurmukhi Multani
A70 A76 Gurmukhi
A81 A83 Gujarati
A85 A8D Gujarati
A8F A91 Gujarati
A93 AA8 Gujarati
AAA AB0 Gujarati
AB2 AB3 Gujarati
AB5 AB9 Gujarati
ABC AC5 Gujarati
AC7 AC9 Gujarati
ACB ACD Gujarati
AD0 Gujarati
AE0 AE3 Gujarati
AE6 AEF Gujarati Khojki
AF0 AF1 Gujarati
AF9 AFF Gujarati
B01 B03 Oriya
B05 B0C Oriya
B0F B10 Oriya
B13 B28 Oriya
B2A B30 Oriya
B32 B33 Oriya
B35 B39 Oriya
B3C B44 Oriya
B47 B48 Oriya
B4B B4D Oriya
B55 B57 Oriya
B5C B5D Oriya
B5F B63 Oriya
B66 B77 Oriya
B82 B83 Tamil
B85 B8A Tamil
B8E B90 Tamil
B92 B95 Tamil
B99 B9A Tamil
B9C Tamil
B9E B9F Tamil
BA3 BA4 Tamil
BA8 BAA Tamil
BAE BB9 Tamil
BBE BC2 Tamil
BC6 BC8 Tamil
BCA BCD Tamil
BD0 Tamil
BD7 Tamil
BE6 BF3 Grantha Tamil
BF4 BFA Tamil
C00 C0C Telugu
C0E C10 Telugu
C12 C28 Telugu
C2A C39 Telugu
C3D C44 Telugu
C46 C48 Telugu
C4A C4D Telugu
C55 C56 Telugu
C58 C5A Telugu
C60 C63 Telugu
C66 C6F Telugu
C77 C7F Telugu
C80 C8C Kannada
C8E C90 Kannada
C92 CA8 Kannada
CAA CB3 Kannada
CB5 CB9 Kannada
CBC CC4 Kannada
CC6 CC8 Kannada
CCA CCD Kannada
CD5 CD6 Kannada
CDE Kannada
CE0 CE3 Kannada
CE6 CEF Kannada Nandinagari
CF1 CF2 Kannada
D00 D0C Malayalam
D0E D10 Malayalam
D12 D44 Malayalam
D46 D48 Malayalam
D4A D4F Malayalam
D54 D63 Malayalam
D66 D7F Malayalam
D81 D83 Sinhala
D85 D96 Sinhala
D9A DB1 Sinhala
DB3 DBB Sinhala
DBD Sinhala
DC0 DC6 Sinhala
DCA Sinhala
DCF DD4 Sinhala
DD6 Sinhala
DD8 DDF Sinhala
DE6 DEF Sinhala
DF2 DF4 Sinhala
E01 E3A Thai
E3F Common
E40 E5B Thai
E81 E82 Lao
E84 Lao
E86 E8A Lao
E8C EA3 Lao
EA5 Lao
EA7 EBD Lao
EC0 EC4 Lao
EC6 Lao
EC8 ECD Lao
ED0 ED9 Lao
EDC EDF Lao
F00 F47 Tibetan
F49 F6C Tibetan
F71 F97 Tibetan
F99 FBC Tibetan
FBE FCC Tibetan
FCE FD4 Tibetan
FD5 FD8 Common
FD9 FDA Tibetan
1000 103F Myanmar
1040 1049 Chakma Myanmar Tai_Le
104A 109F Myanmar
10A0 10C5 Georgian
10C7 Georgian
10CD Georgian
10D0 10FA Georgian
10FB Georgian Latin
10FC 10FF Georgian
1100 11FF Hangul
1200 1248 Ethiopic
124A 124D Ethiopic
1250 1256 Ethiopic
1258 Ethiopic
125A 125D Ethiopic
1260 1288 Ethiopic
128A 128D Ethiopic
1290 12B0 Ethiopic
12B2 12B5 Ethiopic
12B8 12BE Ethiopic
12C0 Ethiopic
12C2 12C5 Ethiopic
12C8 12D6 Ethiopic
12D8 1310 Ethiopic
1312 1315 Ethiopic
1318 135A Ethiopic
135D 137C Ethiopic
1380 1399 Ethiopic
13A0 13F5 Cherokee
13F8 13FD Cherokee
1400 167F Canadian_Aboriginal
1680 169C Ogham
16A0 16EA Runic
16EB 16ED Common
16EE 16F8 Runic
1700 170C Tagalog
170E 1714 Tagalog
1720 1734 Hanunoo
1735 1736 Buhid Hanunoo Tagbanwa Tagalog
1740 1753 Buhid
1760 176C Tagbanwa
176E 1770 Tagbanwa
1772 1773 Tagbanwa
1780 17DD Khmer
17E0 17E9 Khmer
17F0 17F9 Khmer
1800 1801 Mongolian
1802 1803 Mongolian Phags_Pa
1804 Mongolian
1805 Mongolian Phags_Pa
1806 180E Mongolian
1810 1819 Mongolian
1820 1878 Mongolian
1880 18AA Mongolian
18B0 18F5 Canadian_Aboriginal
1900 191E Limbu
1920 192B Limbu
1930 193B Limbu
1940 Limbu
1944 194F Limbu
1950 196D Tai_Le
1970 1974 Tai_Le
1980 19AB New_Tai_Lue
19B0 19C9 New_Tai_Lue
19D0 19DA New_Tai_Lue
19DE 19DF New_Tai_Lue
19E0 19FF Khmer
1A00 1A1B Buginese
1A1E 1A1F Buginese
1A20 1A5E Tai_Tham
1A60 1A7C Tai_Tham
1A7F 1A89 Tai_Tham
1A90 1A99 Tai_Tham
1AA0 1AAD Tai_Tham
1AB0 1AC0 Inherited
1B00 1B4B Balinese
1B50 1B7C Balinese
1B80 1BBF Sundanese
1BC0 1BF3 Batak
1BFC 1BFF Batak
1C00 1C37 Lepcha
1C3B 1C49 Lepcha
1C4D 1C4F Lepcha
1C50 1C7F Ol_Chiki
1C80 1C88 Cyrillic
1C90 1CBA Georgian
1CBD 1CBF Georgian
1CC0 1CC7 Sundanese
1CD0 Bengali Devanagari Grantha Kannada
1CD1 Devanagari
1CD2 Bengali Devanagari Grantha Kannada
1CD3 Devanagari Grantha
1CD4 Devanagari
1CD5 1CD6 Bengali Devanagari
1CD7 Devanagari Sharada
1CD8 Bengali Devanagari
1CD9 Devanagari Sharada
1CDA Devanagari Kannada Malayalam Oriya Tamil Telugu
1CDB Devanagari
1CDC 1CDD Devanagari Sharada
1CDE 1CDF Devanagari
1CE0 Devanagari Sharada
1CE1 Bengali Devanagari
1CE2 1CE8 Devanagari
1CE9 Devanagari Nandinagari
1CEA Bengali Devanagari
1CEB 1CEC Devanagari
1CED Bengali Devanagari
1CEE 1CF1 Devanagari
1CF2 Bengali Devanagari Grantha Kannada Nandinagari Oriya Telugu Tirhuta
1CF3 Devanagari Grantha
1CF4 Devanagari Grantha Kannada
1CF5 1CF6 Bengali Devanagari
1CF7 Bengali
1CF8 1CF9 Devanagari Grantha
1CFA Nandinagari
1D00 1D25 Latin
1D26 1D2A Greek
1D2B Cyrillic
1D2C 1D5C Latin
1D5D 1D61 Greek
1D62 1D65 Latin
1D66 1D6A Greek
1D6B 1D77 Latin
1D78 Cyrillic
1D79 1DBE Latin
1DBF 1DC1 Greek
1DC2 1DF7 Inherited
1DF8 Cyrillic Syriac
1DF9 Inherited
1DFB 1DFF Inherited
1E00 1EFF Latin
1F00 1F15 Greek
1F18 1F1D Greek
1F20 1F45 Greek
1F48 1F4D Greek
1F50 1F57 Greek
1F59 Greek
1F5B Greek
1F5D Greek
1F5F 1F7D Greek
1F80 1FB4 Greek
1FB6 1FC4 Greek
1FC6 1FD3 Greek
1FD6 1FDB Greek
1FDD 1FEF Greek
1FF2 1FF4 Greek
1FF6 1FFE Greek
2000 200B Common
200C 200D Inherited
200E 202E Common
202F Latin Mongolian
2030 2064 Common
2066 2070 Common
2071 Latin
2074 207E Common
207F Latin
2080 208E Common
2090 209C Latin
20A0 20BF Common
20D0 20EF Inherited
20F0 Devanagari Grantha Latin
2100 2125 Common
2126 Greek
2127 2129 Common
212A 212B Latin
212C 2131 Common
2132 Latin
2133 214D Common
214E Latin
214F 215F Common
2160 2188 Latin
2189 218B Common
2190 2426 Common
2440 244A Common
2460 27FF Common
2800 28FF Braille
2900 2B73 Common
2B76 2B95 Common
2B97 2BFF Common
2C00 2C2E Glagolitic
2C30 2C5E Glagolitic
2C60 2C7F Latin
2C80 2CF3 Coptic
2CF9 2CFF Coptic
2D00 2D25 Georgian
2D27 Georgian
2D2D Georgian
2D30 2D67 Tifinagh
2D6F 2D70 Tifinagh
2D7F Tifinagh
2D80 2D96 Ethiopic
2DA0 2DA6 Ethiopic
2DA8 2DAE Ethiopic
2DB0 2DB6 Ethiopic
2DB8 2DBE Ethiopic
2DC0 2DC6 Ethiopic
2DC8 2DCE Ethiopic
2DD0 2DD6 Ethiopic
2DD8 2DDE Ethiopic
2DE0 2DFF Cyrillic
2E00 2E42 Common
2E43 Cyrillic Glagolitic
2E44 2E52 Common
2E80 2E99 Han
2E9B 2EF3 Han
2F00 2FD5 Han
2FF0 2FFB Common
3000 Common
3001 3002 Bopomofo Hangul Han Hiragana Katakana Yi
3003 Bopomofo Hangul Han Hiragana Katakana
3004 Common
3005 3007 Han
3008 3011 Bopomofo Hangul Han Hiragana Katakana Yi
3012 Common
3013 Bopomofo Hangul Han Hiragana Katakana
3014 301B Bopomofo Hangul Han Hiragana Katakana Yi
301C 301F Bopomofo Hangul Han Hiragana Katakana
3020 Common
3021 3029 Han
302A 302D Bopomofo Han
302E 302F Hangul
3030 Bopomofo Hangul Han Hiragana Katakana
3031 3035 Hiragana Katakana
3036 Common
3037 Bopomofo Hangul Han Hiragana Katakana
3038 303B Han
303C 303D Han Hiragana Katakana
303E 303F Han
3041 3096 Hiragana
3099 309C Hiragana Katakana
309D 309F Hiragana
30A0 Hiragana Katakana
30A1 30FA Katakana
30FB Bopomofo Hangul Han Hiragana Katakana Yi
30FC Hiragana Katakana
30FD 30FF Katakana
3105 312F Bopomofo
3131 318E Hangul
3190 319F Han
31A0 31BF Bopomofo
31C0 31E3 Han
31F0 31FF Katakana
3200 321E Hangul
3220 3247 Han
3248 325F Common
3260 327E Hangul
327F Common
3280 32B0 Han
32B1 32BF Common
32C0 32CB Han
32CC 32CF Common
32D0 32FE Katakana
32FF Han
3300 3357 Katakana
3358 3370 Han
3371 337A Common
337B 337F Han
3380 33DF Common
33E0 33FE Han
33FF Common
3400 4DBF Han
4DC0 4DFF Common
4E00 9FFC Han
A000 A48C Yi
A490 A4C6 Yi
A4D0 A4FF Lisu
A500 A62B Vai
A640 A66E Cyrillic
A66F Cyrillic Glagolitic
A670 A69F Cyrillic
A6A0 A6F7 Bamum
A700 A707 Han Latin
A708 A721 Common
A722 A787 Latin
A788 A78A Common
A78B A7BF Latin
A7C2 A7CA Latin
A7F5 A7FF Latin
A800 A82C Syloti_Nagri
A830 A832 Devanagari Dogra Gujarati Gurmukhi Khojki Kannada Kaithi Mahajani Malayalam Modi Nandinagari Khudawadi Takri Tirhuta
A833 A835 Devanagari Dogra Gujarati Gurmukhi Khojki Kannada Kaithi Mahajani Modi Nandinagari Khudawadi Takri Tirhuta
A836 A839 Devanagari Dogra Gujarati Gurmukhi Khojki Kaithi Mahajani Modi Khudawadi Takri Tirhuta
A840 A877 Phags_Pa
A880 A8C5 Saurashtra
A8CE A8D9 Saurashtra
A8E0 A8F0 Devanagari
A8F1 Bengali Devanagari
A8F2 Devanagari
A8F3 Devanagari Tamil
A8F4 A8FF Devanagari
A900 A92D Kayah_Li
A92E Kayah_Li Latin Myanmar
A92F Kayah_Li
A930 A953 Rejang
A95F Rejang
A960 A97C Hangul
A980 A9CD Javanese
A9CF Buginese Javanese
A9D0 A9D9 Javanese
A9DE A9DF Javanese
A9E0 A9FE Myanmar
AA00 AA36 Cham
AA40 AA4D Cham
AA50 AA59 Cham
AA5C AA5F Cham
AA60 AA7F Myanmar
AA80 AAC2 Tai_Viet
AADB AADF Tai_Viet
AAE0 AAF6 Meetei_Mayek
AB01 AB06 Ethiopic
AB09 AB0E Ethiopic
AB11 AB16 Ethiopic
AB20 AB26 Ethiopic
AB28 AB2E Ethiopic
AB30 AB5A Latin
AB5B Common
AB5C AB64 Latin
AB65 Greek
AB66 AB69 Latin
AB6A AB6B Common
AB70 ABBF Cherokee
ABC0 ABED Meetei_Mayek
ABF0 ABF9 Meetei_Mayek
AC00 D7A3 Hangul
D7B0 D7C6 Hangul
D7CB D7FB Hangul
F900 FA6D Han
FA70 FAD9 Han
FB00 FB06 Latin
FB13 FB17 Armenian
FB1D FB36 Hebrew
FB38 FB3C Hebrew
FB3E Hebrew
FB40 FB41 Hebrew
FB43 FB44 Hebrew
FB46 FB4F Hebrew
FB50 FBC1 Arabic
FBD3 FD3D Arabic
FD3E FD3F Common
FD50 FD8F Arabic
FD92 FDC7 Arabic
FDF0 FDF1 Arabic
FDF2 Arabic Thaana
FDF3 FDFC Arabic
FDFD Arabic Thaana
FE00 FE0F Inherited
FE10 FE19 Common
FE20 FE2D Inherited
FE2E FE2F Cyrillic
FE30 FE44 Common
FE45 FE46 Bopomofo Hangul Han Hiragana Katakana
FE47 FE52 Common
FE54 FE66 Common
FE68 FE6B Common
FE70 FE74 Arabic
FE76 FEFC Arabic
FEFF Common
FF01 FF20 Common
FF21 FF3A Latin
FF3B FF40 Common
FF41 FF5A Latin
FF5B FF60 Common
FF61 FF65 Bopomofo Hangul Han Hiragana Katakana Yi
FF66 FF6F Katakana
FF70 Hiragana Katakana
FF71 FF9D Katakana
FF9E FF9F Hiragana Katakana
FFA0 FFBE Hangul
FFC2 FFC7 Hangul
FFCA FFCF Hangul
FFD2 FFD7 Hangul
FFDA FFDC Hangul
FFE0 FFE6 Common
FFE8 FFEE Common
FFF9 FFFD Common
10000 1000B Linear_B
1000D 10026 Linear_B
10028 1003A Linear_B
1003C 1003D Linear_B
1003F 1004D Linear_B
10050 1005D Linear_B
10080 100FA Linear_B
10100 10102 Cypriot Linear_B
10107 10133 Cypriot Linear_A Linear_B
10137 1013F Cypriot Linear_B
10140 1018E Greek
10190 1019C Common
101A0 Greek
101D0 101FC Common
101FD Inherited
10280 1029C Lycian
102A0 102D0 Carian
102E0 102FB Arabic Coptic
10300 10323 Old_Italic
1032D 1032F Old_Italic
10330 1034A Gothic
10350 1037A Old_Permic
10380 1039D Ugaritic
1039F Ugaritic
103A0 103C3 Old_Persian
103C8 103D5 Old_Persian
10400 1044F Deseret
10450 1047F Shavian
10480 1049D Osmanya
104A0 104A9 Osmanya
104B0 104D3 Osage
104D8 104FB Osage
10500 10527 Elbasan
10530 10563 Caucasian_Albanian
1056F Caucasian_Albanian
10600 10736 Linear_A
10740 10755 Linear_A
10760 10767 Linear_A
10800 10805 Cypriot
10808 Cypriot
1080A 10835 Cypriot
10837 10838 Cypriot
1083C Cypriot
1083F Cypriot
10840 10855 Imperial_Aramaic
10857 1085F Imperial_Aramaic
10860 1087F Palmyrene
10880 1089E Nabataean
108A7 108AF Nabataean
108E0 108F2 Hatran
108F4 108F5 Hatran
108FB 108FF Hatran
10900 1091B Phoenician
1091F Phoenician
10920 10939 Lydian
1093F Lydian
10980 1099F Meroitic_Hieroglyphs
109A0 109B7 Meroitic_Cursive
109BC 109CF Meroitic_Cursive
109D2 109FF Meroitic_Cursive
10A00 10A03 Kharoshthi
10A05 10A06 Kharoshthi
10A0C 10A13 Kharoshthi
10A15 10A17 Kharoshthi
10A19 10A35 Kharoshthi
10A38 10A3A Kharoshthi
10A3F 10A48 Kharoshthi
10A50 10A58 Kharoshthi
10A60 10A7F Old_South_Arabian
10A80 10A9F Old_North_Arabian
10AC0 10AE6 Manichaean
10AEB 10AF6 Manichaean
10B00 10B35 Avestan
10B39 10B3F Avestan
10B40 10B55 Inscriptional_Parthian
10B58 10B5F Inscriptional_Parthian
10B60 10B72 Inscriptional_Pahlavi
10B78 10B7F Inscriptional_Pahlavi
10B80 10B91 Psalter_Pahlavi
10B99 10B9C Psalter_Pahlavi
10BA9 10BAF Psalter_Pahlavi
10C00 10C48 Old_Turkic
10C80 10CB2 Old_Hungarian
10CC0 10CF2 Old_Hungarian
10CFA 10CFF Old_Hungarian
10D00 10D27 Hanifi_Rohingya
10D30 10D39 Hanifi_Rohingya
10E60 10E7E Arabic
10E80 10EA9 Yezidi
10EAB 10EAD Yezidi
10EB0 10EB1 Yezidi
10F00 10F27 Old_Sogdian
10F30 10F59 Sogdian
10FB0 10FCB Chorasmian
10FE0 10FF6 Elymaic
11000 1104D Brahmi
11052 1106F Brahmi
1107F Brahmi
11080 110C1 Kaithi
110CD Kaithi
110D0 110E8 Sora_Sompeng
110F0 110F9 Sora_Sompeng
11100 11134 Chakma
11136 11147 Chakma
11150 11176 Mahajani
11180 111DF Sharada
111E1 111F4 Sinhala
11200 11211 Khojki
11213 1123E Khojki
11280 11286 Multani
11288 Multani
1128A 1128D Multani
1128F 1129D Multani
1129F 112A9 Multani
112B0 112EA Khudawadi
112F0 112F9 Khudawadi
11300 Grantha
11301 Grantha Tamil
11302 Grantha
11303 Grantha Tamil
11305 1130C Grantha
1130F 11310 Grantha
11313 11328 Grantha
1132A 11330 Grantha
11332 11333 Grantha
11335 11339 Grantha
1133B 1133C Grantha Tamil
1133D 11344 Grantha
11347 11348 Grantha
1134B 1134D Grantha
11350 Grantha
11357 Grantha
1135D 11363 Grantha
11366 1136C Grantha
11370 11374 Grantha
11400 1145B Newa
1145D 11461 Newa
11480 114C7 Tirhuta
114D0 114D9 Tirhuta
11580 115B5 Siddham
115B8 115DD Siddham
11600 11644 Modi
11650 11659 Modi
11660 1166C Mongolian
11680 116B8 Takri
116C0 116C9 Takri
11700 1171A Ahom
1171D 1172B Ahom
11730 1173F Ahom
11800 1183B Dogra
118A0 118F2 Warang_Citi
118FF Warang_Citi
11900 11906 Dives_Akuru
11909 Dives_Akuru
1190C 11913 Dives_Akuru
11915 11916 Dives_Akuru
11918 11935 Dives_Akuru
11937 11938 Dives_Akuru
1193B 11946 Dives_Akuru
11950 11959 Dives_Akuru
119A0 119A7 Nandinagari
119AA 119D7 Nandinagari
119DA 119E4 Nandinagari
11A00 11A47 Zanabazar_Square
11A50 11AA2 Soyombo
11AC0 11AF8 Pau_Cin_Hau
11C00 11C08 Bhaiksuki
11C0A 11C36 Bhaiksuki
11C38 11C45 Bhaiksuki
11C50 11C6C Bhaiksuki
11C70 11C8F Marchen
11C92 11CA7 Marchen
11CA9 11CB6 Marchen
11D00 11D06 Masaram_Gondi
11D08 11D09 Masaram_Gondi
11D0B 11D36 Masaram_Gondi
11D3A Masaram_Gondi
11D3C 11D3D Masaram_Gondi
11D3F 11D47 Masaram_Gondi
11D50 11D59 Masaram_Gondi
11D60 11D65 Gunjala_Gondi
11D67 11D68 Gunjala_Gondi
11D6A 11D8E Gunjala_Gondi
11D90 11D91 Gunjala_Gondi
11D93 11D98 Gunjala_Gondi
11DA0 11DA9 Gunjala_Gondi
11EE0 11EF8 Makasar
11FB0 Lisu
11FC0 11FCF Tamil
11FD0 11FD1 Grantha Tamil
11FD2 Tamil
11FD3 Grantha Tamil
11FD4 11FF1 Tamil
11FFF Tamil
12000 12399 Cuneiform
12400 1246E Cuneiform
12470 12474 Cuneiform
12480 12543 Cuneiform
13000 1342E Egyptian_Hieroglyphs
13430 13438 Egyptian_Hieroglyphs
14400 14646 Anatolian_Hieroglyphs
16800 16A38 Bamum
16A40 16A5E Mro
16A60 16A69 Mro
16A6E 16A6F Mro
16AD0 16AED Bassa_Vah
16AF0 16AF5 Bassa_Vah
16B00 16B45 Pahawh_Hmong
16B50 16B59 Pahawh_Hmong
16B5B 16B61 Pahawh_Hmong
16B63 16B77 Pahawh_Hmong
16B7D 16B8F Pahawh_Hmong
16E40 16E9A Medefaidrin
16F00 16F4A Miao
16F4F 16F87 Miao
16F8F 16F9F Miao
16FE0 Tangut
16FE1 Nushu
16FE2 16FE3 Common
16FE4 Khitan_Small_Script
16FF0 16FF1 Han
17000 187F7 Tangut
18800 18AFF Tangut
18B00 18CD5 Khitan_Small_Script
18D00 18D08 Tangut
1B000 Katakana
1B001 1B11E Hiragana
1B150 1B152 Hiragana
1B164 1B167 Katakana
1B170 1B2FB Nushu
1BC00 1BC6A Duployan
1BC70 1BC7C Duployan
1BC80 1BC88 Duployan
1BC90 1BC99 Duployan
1BC9C 1BCA3 Duployan
1D000 1D0F5 Common
1D100 1D126 Common
1D129 1D166 Common
1D167 1D169 Inherited
1D16A 1D17A Common
1D17B 1D182 Inherited
1D183 1D184 Common
1D185 1D18B Inherited
1D18C 1D1A9 Common
1D1AA 1D1AD Inherited
1D1AE 1D1E8 Common
1D200 1D245 Greek
1D2E0 1D2F3 Common
1D300 1D356 Common
1D360 1D371 Han
1D372 1D378 Common
1D400 1D454 Common
1D456 1D49C Common
1D49E 1D49F Common
1D4A2 Common
1D4A5 1D4A6 Common
1D4A9 1D4AC Common
1D4AE 1D4B9 Common
1D4BB Common
1D4BD 1D4C3 Common
1D4C5 1D505 Common
1D507 1D50A Common
1D50D 1D514 Common
1D516 1D51C Common
1D51E 1D539 Common
1D53B 1D53E Common
1D540 1D544 Common
1D546 Common
1D54A 1D550 Common
1D552 1D6A5 Common
1D6A8 1D7CB Common
1D7CE 1D7FF Common
1D800 1DA8B SignWriting
1DA9B 1DA9F SignWriting
1DAA1 1DAAF SignWriting
1E000 1E006 Glagolitic
1E008 1E018 Glagolitic
1E01B 1E021 Glagolitic
1E023 1E024 Glagolitic
1E026 1E02A Glagolitic
1E100 1E12C Nyiakeng_Puachue_Hmong
1E130 1E13D Nyiakeng_Puachue_Hmong
1E140 1E149 Nyiakeng_Puachue_Hmong
1E14E 1E14F Nyiakeng_Puachue_Hmong
1E2C0 1E2F9 Wancho
1E2FF Wancho
1E800 1E8C4 Mende_Kikakui
1E8C7 1E8D6 Mende_Kikakui
1E900 1E94B Adlam
1E950 1E959 Adlam
1E95E 1E95F Adlam
1EC71 1ECB4 Common
1ED01 1ED3D Common
1EE00 1EE03 Arabic
1EE05 1EE1F Arabic
1EE21 1EE22 Arabic
1EE24 Arabic
1EE27 Arabic
1EE29 1EE32 Arabic
1EE34 1EE37 Arabic
1EE39 Arabic
1EE3B Arabic
1EE42 Arabic
1EE47 Arabic
1EE49 Arabic
1EE4B Arabic
1EE4D 1EE4F Arabic
1EE51 1EE52 Arabic
1EE54 Arabic
1EE57 Arabic
1EE59 Arabic
1EE5B Arabic
1EE5D Arabic
1EE5F Arabic
1EE61 1EE62 Arabic
1EE64 Arabic
1EE67 1EE6A Arabic
1EE6C 1EE72 Arabic
1EE74 1EE77 Arabic
1EE79 1EE7C Arabic
1EE7E Arabic
1EE80 1EE89 Arabic
1EE8B 1EE9B Arabic
1EEA1 1EEA3 Arabic
1EEA5 1EEA9 Arabic
1EEAB 1EEBB Arabic
1EEF0 1EEF1 Arabic
1F000 1F02B Common
1F030 1F093 Common
1F0A0 1F0AE Common
1F0B1 1F0BF Common
1F0C1 1F0CF Common
1F0D1 1F0F5 Common
1F100 1F1AD Common
1F1E6 1F1FF Common
1F200 Hiragana
1F201 1F202 Common
1F210 1F23B Common
1F240 1F248 Common
1F250 1F251 Han
1F260 1F265 Common
1F300 1F6D7 Common
1F6E0 1F6EC Common
1F6F0 1F6FC Common
1F700 1F773 Common
1F780 1F7D8 Common
1F7E0 1F7EB Common
1F800 1F80B Common
1F810 1F847 Common
1F850 1F859 Common
1F860 1F887 Common
1F890 1F8AD Common
1F8B0 1F8B1 Common
1F900 1F978 Common
1F97A 1F9CB Common
1F9CD 1FA53 Common
1FA60 1FA6D Common
1FA70 1FA74 Common
1FA78 1FA7A Common
1FA80 1FA86 Common
1FA90 1FAA8 Common
1FAB0 1FAB6 Common
1FAC0 1FAC2 Common
1FAD0 1FAD6 Common
1FB00 1FB92 Common
1FB94 1FBCA Common
1FBF0 1FBF9 Common
20000 2A6DD Han
2A700 2B734 Han
2B740 2B81D Han
2B820 2CEA1 Han
2CEB0 2EBE0 Han
2F800 2FA1D Han
30000 3134A Han
E0001 Common
E0020 E007F Common
E0100 E01EF Inherited
END
| 21.354269 | 193 | 0.791636 |
73d4b221eac34805fa6ef963d5526d0d5861009c | 2,706 | pm | Perl | lib/Sisimai/Reason/HasMoved.pm | makovskyy/p5-Sisimai | e810531be5b67fa95e0381efff31c40ae3778651 | [
"BSD-2-Clause"
]
| null | null | null | lib/Sisimai/Reason/HasMoved.pm | makovskyy/p5-Sisimai | e810531be5b67fa95e0381efff31c40ae3778651 | [
"BSD-2-Clause"
]
| null | null | null | lib/Sisimai/Reason/HasMoved.pm | makovskyy/p5-Sisimai | e810531be5b67fa95e0381efff31c40ae3778651 | [
"BSD-2-Clause"
]
| null | null | null | package Sisimai::Reason::HasMoved;
use feature ':5.10';
use strict;
use warnings;
sub text { 'hasmoved' }
sub description { "Email rejected due to user's mailbox has moved and is not forwarded automatically" }
sub match {
# Try to match that the given text and regular expressions
# @param [String] argv1 String to be matched with regular expressions
# @return [Integer] 0: Did not match
# 1: Matched
# @since v4.1.25
my $class = shift;
my $argv1 = shift // return undef;
state $index = [' has been replaced by '];
return 1 if grep { rindex($argv1, $_) > -1 } @$index;
return 0;
}
sub true {
# Whether the address has moved or not
# @param [Sisimai::Data] argvs Object to be detected the reason
# @return [Integer] 1: The address has moved
# 0: Has not moved
# @since v4.1.25
# @see http://www.ietf.org/rfc/rfc2822.txt
my $class = shift;
my $argvs = shift // return undef;
return 1 if $argvs->reason eq 'hasmoved';
return 1 if __PACKAGE__->match(lc $argvs->diagnosticcode);
return 0;
}
1;
__END__
=encoding utf-8
=head1 NAME
Sisimai::Reason::HasMoved - Bounce reason is C<hasmoved> or not.
=head1 SYNOPSIS
use Sisimai::Reason::HasMoved;
print Sisimai::Reason::HasMoved->match('address neko@example.jp has been replaced by ...'); # 1
=head1 DESCRIPTION
Sisimai::Reason::HasMoved checks the bounce reason is C<hasmoved> or not. This
class is called only Sisimai::Reason class.
This is the error that a user's mailbox has moved (and is not forwarded
automatically). Sisimai will set C<hasmoved> to the reason of email bounce if
the value of Status: field in a bounce email is C<5.1.6>.
<kijitora@example.go.jp>: host mx1.example.go.jp[192.0.2.127] said: 550 5.1.6 recipient
no longer on server: kijitora@example.go.jp (in reply to RCPT TO command)
=head1 CLASS METHODS
=head2 C<B<text()>>
C<text()> returns string: C<hasmoved>.
print Sisimai::Reason::HasMoved->text; # hasmoved
=head2 C<B<match(I<string>)>>
C<match()> returns 1 if the argument matched with patterns defined in this class.
print Sisimai::Reason::HasMoved->match('address cat@example.jp has been replaced by '); # 1
=head2 C<B<true(I<Sisimai::Data>)>>
C<true()> returns 1 if the bounce reason is C<hasmoved>. The argument must be
Sisimai::Data object and this method is called only from Sisimai::Reason class.
=head1 AUTHOR
azumakuniyuki
=head1 COPYRIGHT
Copyright (C) 2015-2016,2018 azumakuniyuki, All rights reserved.
=head1 LICENSE
This software is distributed under The BSD 2-Clause License.
=cut
| 28.484211 | 103 | 0.67221 |
73fb15b4d2adf6528c15d14237f164f7063118ed | 84,141 | pm | Perl | lib/O2/Util/ExternalModule/lib/Syntax/Highlight/Perl.pm | haakonsk/O2-Framework | 50f2f2def517b90dec647b914128ad8f949f51d9 | [
"MIT"
]
| 1 | 2016-05-24T08:13:09.000Z | 2016-05-24T08:13:09.000Z | lib/O2/Util/ExternalModule/lib/Syntax/Highlight/Perl.pm | haakonsk/O2-Framework | 50f2f2def517b90dec647b914128ad8f949f51d9 | [
"MIT"
]
| null | null | null | lib/O2/Util/ExternalModule/lib/Syntax/Highlight/Perl.pm | haakonsk/O2-Framework | 50f2f2def517b90dec647b914128ad8f949f51d9 | [
"MIT"
]
| null | null | null | package Syntax::Highlight::Perl;
#
# Syntax::Highlight::Perl
#
# Created 01-23-2001 by Cory Johns
# Last Modified 04-04-2001 by Cory Johns
#
# (See end of file (or POD) for revision history.)
#
# Freely distributable under the same conditions as Perl itself.
#
($VERSION) = '1.00' =~ /([.,\d]+)/;
=head1 NAME
Syntax::Highlight::Perl - Highlighting of Perl Syntactical Structures
=head1 VERSION
This file documents Syntax::Highlight::Perl version B<1.0>.
=head1 SYNOPSIS
# simple procedural
use Syntax::Highlight::Perl ':BASIC'; # or ':FULL'
print format_string($my_string);
# OO
use Syntax::Highlight::Perl;
my $formatter = new Syntax::Highlight::Perl;
print $formatter->format_string($my_string);
=head1 DESCRIPTION
This module provides syntax highlighting for Perl code. The design bias is roughly line-oriented
and streamed (ie, processing a file line-by-line in a single pass). Provisions I<may> be made
in the future for tasks related to "back-tracking" (ie, re-doing a single line in the middle of
a stream) such as speeding up state copying.
=over 4
=head2 Constructors
The only constructor provided is C<new()>. When called on an existing object, C<new()> will
create a new I<B<copy>> of that object. Otherwise, C<new()> creates a new copy of the (internal)
I<Default Object>. Note that the use of the procedural syntax modifies the I<Default Object>
and that those changes I<will> be reflected in any subsequent C<new()> calls.
=head2 Formatting
Formatting is done using the C<format_string()> method. Call C<format_string()> with one or more
strings to format, or it will default to using C<$_>.
=head2 Setting and Getting Formats
You can set the text used for formatting a syntax element using C<set_format()> (or set
the start and end format individually using C<set_start_format()> and C<set_end_format()>,
respectively).
You can also retrieve the text used for formatting for an element via C<get_start_format()>
or C<get_end_format>. Bulk retrieval of the names or values of defined formats is possible
via C<get_format_names_list()> (names), C<get_start_format_values_list()> and C<get_end_format_values_list()>.
See L<"FORMAT TYPES"> later in this document for information on what format elements can be used.
=head2 Checking and Setting the State
You can check certain aspects of the state of the formatter via the methods: C<in_heredoc()>,
C<in_string()>, C<in_pod()>, C<was_pod()>, C<in_data()>, and C<line_count()>.
You can reset all of the above states (and a few other internal ones) using C<reset()>.
=head2 Stable and Unstable Formatting Modes
You can set or check the stability of formatting via C<unstable()>.
In unstable (TRUE) mode, formatting is not considered to be persistent with nested formats.
Or, put another way, when unstable, the formatter can only "remember" one format at a time
and must reinstate formatting for each token. An example of unstable formatting is using
ANSI color escape sequences in a terminal.
In stable (FALSE) mode (the default), formatting is considered persistent within arbitrarily
nested formats. Even in stable mode, however, formatting is never allowed to span multiple lines;
it is always fully closed at the end of the line and reinstated at the beginning of a new line,
if necessary. This is to ensure properly balanced tags when only formatting a partial code snippet.
An example of stable formatting is HTML.
=head2 Substitutions
Using C<define_substitution()>, you can have the formatter substitute certain strings with others,
after the original string has been parsed (but before formatting is applied). This is useful
for escaping characters special to the output mode (eg, E<gt> and E<lt> in HTML) without them
affecting the way the code is parsed.
You can retrieve the current substitutions (as a hash-ref) via C<substitutions()>.
=back
=head1 FORMAT TYPES
The Syntax::Highlight::Perl formatter recognizes and differentiates between many Perl syntactical
elements. Each type of syntactical element has a Format Type associated with it. There is also a
'DEFAULT' type that is applied to any element who's Format Type does not have a value.
Several of the Format Types have underscores in their name. This underscore is special, and
indicates that the Format Type can be "generalized." This means that you can assign a value to
just the first part of the Format Type name (the part before the underscore) and that value will
be applied to all Format Types with the same first part. For example, the Format Types for all
types of variables begin with "Variable_". Thus, if you assign a value to the Format Type "Variable",
it will be applied to any type of variable. Generalized Format Types take precedence over
non-generalized Format Types. So the value assigned to "Variable" would be applied to
"Variable_Scalar", even if "Variable_Scalar" had a value explicitly assigned to it.
You can also define a "short-cut" name for each Format Type that can be generalized. The short-cut
name would be the part of the Format Type name after the underscore. For example, the short-cut
for "Variable_Scalar" would be "Scalar". Short-cut names have the least precedence and are only
assigned if neither the generalized Type name, nor the full Type name have values.
Following is a list of all the syntactical elements that Syntax::Highlight::Perl currently
recognizes, along with a short description of what each would be applied to.
=over 4
=item Comment_Normal
A normal Perl comment. Starts with '#' and goes until the end of the line.
=item Comment_POD
Inline documentation. Starts with a line beginning with an equal sign ('=') followed by
a word (eg: '=pod') and continuing until a line beginning with '=cut'.
=item Directive
Either the "she-bang" line at the beginning of the file, or a line directive altering what
the compiler thinks the current line and file is.
=item Label
A loop or statement label (to be the target of a goto, next, last or redo).
=item Quote
Any string or character that begins or ends a String. Including, but not necessarily limited to:
quote-like regular expression operators (C<m//>, C<s///>, C<tr///>, etc), a Here-Document terminating
line, the lone period terminating a format, and, of course, normal quotes (C<'>, C<">, C<`>, C<q{}>,
C<qq{}>, C<qr{}>, C<qx{}>).
=item String
Any text within quotes, C<format>s, Here-Documents, Regular Expressions, and the like.
=item Subroutine
The identifier used to define, identify, or call a subroutine (or method). Note that
Syntax::Highlight::Perl cannot recognize a subroutine if it is called without using parentheses
or an ampersand, or methods called using the indirect object syntax. It formats those as barewords.
=item Variable_Scalar
A scalar variable.
Note that (theoretically) this format is not applied to non-scalar variables that are
being used as scalars (ie: array or hash lookups, nor references to anything other than scalars).
Syntax::Highlight::Perl figures out (or at least tries to) the actual I<type> of the variable
being used (by looking at how you're subscripting it) and formats it accordingly. The first
character of the variable (ie, the C<$>, C<@>, C<%>, or C<*>) tells you the type of value being
used, and the color (hopefully) tells you the type of variable being used to get that value.
(See L<"KNOWN ISSUES"> for information about when this doesn't work quite right.)
=item Variable_Array
An array variable (but not usually a slice; see above).
=item Variable_Hash
A hash variable.
=item Variable_Typeglob
A typeglob. Note that typeglobs not beginning with an asterisk (*) (eg: filehandles) are formatted
as barewords. This is because, well, they are.
=item Whitespace
Whitespace. Not usually formatted but it can be.
=item Character
A special, or backslash-escaped, character. For example: C<\n> (newline), or C<\d> (digits).
Only occurs within strings or regular expressions.
=item Keyword
A Perl keyword. Some examples include: my, local, sub, next.
Note that Perl does not make any distinction between keywords and built-in functions (at least
not in the documentation). Thus I had to make a subjective call as to what would be considered
keywords and what would be built-in functions.
The list of keywords can be found (and overloaded) in the variable
C<$Syntax::Highlight::Perl::keyword_list_re> as a pre-compiled regular expression.
=item Builtin_Function
A Perl built-in function, called as a function (ie, using parentheses).
The list of built-in functions can be found (and overloaded) in the variable
C<$Syntax::Highlight::Perl::builtin_list_re> as a pre-compiled regular expression.
=item Builtin_Operator
A Perl built-in function, called as a list or unary operator (ie, without using parentheses).
The list of built-in functions can be found (and overloaded) in the variable
C<$Syntax::Highlight::Perl::builtin_list_re> as a pre-compiled regular expression.
=item Operator
A Perl operator.
The list of operators can be found (and overloaded) in the variable
C<$Syntax::Highlight::Perl::operator_list_re> as a pre-compiled regular expression.
=item Bareword
A bareword. This can be user-defined subroutine called without parentheses, a typeglob used
without an asterisk (*), or just a plain old bareword.
=item Package
The name of a package or pragmatic module.
Note that this does not apply to the package portion of a fully qualified variable name.
=item Number
A numeric literal.
=item Symbol
A symbol (ie, non-operator punctuation).
=item CodeTerm
The special tokens that signal the end of executable code and the begining of the
DATA section. Specifically, 'C<__END__>' and 'C<__DATA__>'.
=item DATA
Anything in the DATA section (see C<CodeTerm>).
=back
=head1 PROCEDURAL vs. OBJECT ORIENTED
Syntax::Highlight::Perl uses OO method-calls internally (and actually defines a Default Object
that is used when the functions are invoked procedurally) so you will not gain anything
(efficiency-wise) by using the procedural interface. It is just a matter of style.
It is actually recommended that you use the OO interface, as this allows you to instantiate
multiple, concurrent-yet-separate formatters. Though I cannot think of I<why> you would I<need>
multiple formatters instantiated. :-)
One point to note: the C<new()> method uses the Default Object to initialize new objects. This
means that any changes to the state of the Default Object (including Format definitions) made by
using the procedural interface will be reflected in any subsequently created objects. This can
be useful in some cases (eg, call C<set_format()> procedurally just before creating a batch of new
objects to define default Formats for them all) but will most likely lead to trouble.
=cut
use strict;
#===================================================================================================
# Yay constants!
#===================================================================================================
use constant FALSE => 0;
use constant TRUE => not FALSE;
#===================================================================================================
# Setup package exportation.
#===================================================================================================
use base 'Exporter';
use vars qw(@EXPORT_OK %EXPORT_TAGS);
@EXPORT_OK = qw(
reset
unstable
in_heredoc
in_string
in_pod
was_pod
in_data
line_count
substitutions
define_substitution
set_start_format
set_end_format
set_format
get_start_format
get_end_format
get_format_names_list
get_start_format_values_list
get_end_format_values_list
format_string
format_token
);
%EXPORT_TAGS = (
BASIC => [ qw(
set_format
format_string
) ],
FULL => [ @EXPORT_OK ],
);
#===================================================================================================
# Define package globals.
#===================================================================================================
#
# This is the (overloadable) name of the current object.
# Used to bless new objects.
#
use vars qw($THIS_CLASS);
$THIS_CLASS = __PACKAGE__;
#
# These regular expressions do much of the work for this package. They recognize and separate
# the lines into small, meaningful (and usefull) tokens.
#
use vars qw($quotes_re $heredoc_re $identifier_re $builtin_vars_re $number_re);
use vars qw($keyword_list_re $builtin_list_re $operator_list_re);
#
# Quotes and quote-like constructs.
#
# Note: This regex primarily matches quote _instigators_ (as opposed to terminators)
# (when it can tell the difference). For example, given:
#
# qw (blah blah blah)
#
# it will match 'qw ('. It matches up to the open parenthesis so that we will
# be able to tell later on what we should look for to close the quote (ie ')').
#
$quotes_re = qr/(?: q[qxwr]? | m | s | tr | y ) (?: \s+ [^\s\#] | [^\w\s] ) | [\'\"\`] /x;
#
# Here-document instigators.
#
$heredoc_re = qr/<<(?:\s*['"`]\w+['"`]|\w+)?/;
#
# Identifiers (variables, subroutines, and packages).
#
$identifier_re = qr/(?:(?:[A-Za-z_]|::)(?:\w|::)*)/;
#
# Variable class specifiers.
#
my $varchars = qr/(?:(?:[\@\%\*]|\$\#?)\$*)/;
#
# Perl builtin variables.
#
$builtin_vars_re =
qr/ \$\#?_
| \$(?:\^[LAECDFHIMOPRSTWX]|[0-9&`'+*.\/|,\\";#%=\-~^:?!@\$<>()\[\]])
| \$\#?ARGV(?:\s*\[)?
| \$\#?INC\s*\[
| \$(?:ENV|SIG|INC)\s*\{
| \@(?:_|ARGV|INC)
| \%(?:INC|ENV|SIG)
/x;
#
# Numbers.
#
$number_re = qr/0x[\da-fA-F]+|[_.\d]+([eE][-+]?\d+)?/;
#
# The list of keywords. Okay, so it's ugly.
#
$keyword_list_re =
qr/ continue
| foreach
| require
| package
| scalar
| format
| unless
| local
| until
| while
| elsif
| next
| last
| goto
| else
| redo
| sub
| for
| use
| no
| if
| my
/x;
#
# The list of builtin functions. Damn, that's ugly.
#
$builtin_list_re =
qr/ getprotobynumber
| getprotobyname
| getservbyname
| gethostbyaddr
| gethostbyname
| getservbyport
| getnetbyaddr
| getnetbyname
| getsockname
| getpeername
| setpriority
| getprotoent
| setprotoent
| getpriority
| endprotoent
| getservent
| setservent
| endservent
| sethostent
| socketpair
| getsockopt
| gethostent
| endhostent
| setsockopt
| setnetent
| quotemeta
| localtime
| prototype
| getnetent
| endnetent
| rewinddir
| wantarray
| getpwuid
| closedir
| getlogin
| readlink
| endgrent
| getgrgid
| getgrnam
| shmwrite
| shutdown
| readline
| endpwent
| setgrent
| readpipe
| formline
| truncate
| dbmclose
| syswrite
| setpwent
| getpwnam
| getgrent
| getpwent
| ucfirst
| sysread
| setpgrp
| shmread
| sysseek
| sysopen
| telldir
| defined
| opendir
| connect
| lcfirst
| getppid
| binmode
| syscall
| sprintf
| getpgrp
| readdir
| seekdir
| waitpid
| reverse
| unshift
| symlink
| dbmopen
| semget
| msgrcv
| rename
| listen
| chroot
| msgsnd
| shmctl
| accept
| unpack
| exists
| fileno
| shmget
| system
| unlink
| printf
| gmtime
| msgctl
| semctl
| values
| rindex
| substr
| splice
| length
| msgget
| select
| socket
| return
| caller
| delete
| alarm
| ioctl
| index
| undef
| lstat
| times
| srand
| chown
| fcntl
| close
| write
| umask
| rmdir
| study
| sleep
| chomp
| untie
| print
| utime
| mkdir
| atan2
| split
| crypt
| flock
| chmod
| BEGIN
| bless
| chdir
| semop
| shift
| reset
| link
| stat
| chop
| grep
| fork
| dump
| join
| open
| tell
| pipe
| exit
| glob
| warn
| each
| bind
| sort
| pack
| eval
| push
| keys
| getc
| kill
| seek
| sqrt
| send
| wait
| rand
| tied
| read
| time
| exec
| recv
| eof
| chr
| int
| ord
| exp
| pos
| pop
| sin
| log
| abs
| oct
| hex
| tie
| cos
| vec
| END
| ref
| map
| die
| \-C
| \-b
| \-S
| \-u
| \-t
| \-p
| \-l
| \-d
| \-f
| \-g
| \-s
| \-z
| uc
| \-k
| \-e
| \-O
| \-T
| \-B
| \-M
| do
| \-A
| \-X
| \-W
| \-c
| \-R
| \-o
| \-x
| lc
| \-w
| \-r
/x;
#
# The list of operators. Also pretty ugly.
#
$operator_list_re =
qr/ xor
| \.\.\.
| and
| not
| \|\|\=
| cmp
| \>\>\=
| \<\<\=
| \<\=\>
| \&\&\=
| or
| \=\>
| \!\~
| \^\=
| \&\=
| \|\=
| \.\=
| x\=
| \%\=
| \/\=
| \*\=
| \-\=
| \+\=
| \=\~
| \*\*
| \-\-
| \.\.
| \|\|
| \&\&
| \+\+
| \-\>
| ne
| eq
| \!\=
| \=\=
| ge
| le
| gt
| lt
| \>\=
| \<\=
| \>\>
| \<\<
| \,
| \=
| \:
| \?
| \^
| \|
| x
| \%
| \/
| \*
| \<
| \&
| \\
| \~
| \!
| \>
| \.
| \-
| \+
/x;
#===================================================================================================
# Package-private variables.
#
# Basically, just defaults.
#===================================================================================================
#
# The default object variable.
#
# Note that all of these values (including Formats) will be *COPIED* (recursively)
# into any newly created object.
#
# Also note that any changes made to this object (via procedural-style calls to almost
# any of the exported functions) _will be reflected in any objects created after those
# changes are made_. In other words, you probably don't want to mix OO-style and
# Procedural-style unless you really know what you're doing.
#
# Further note that this object is blessed when this package is 'use'd (or 'require'd)
# (ie, before you have a chance to overload the $THIS_CLASS package-global variable).
# If you're inheriting from this package, you'll probably want to re-bless this object.
# Although it is perhaps not totally necessary as long as you overload the $THIS_CLASS
# package-global since new() re-blesses any copies of this object using that class.
#
use vars qw($Default_Object);
$Default_Object = bless {
#
# State variables.
#
'in_string' => FALSE, # Boolean.
'awaiting_multi' => FALSE, # Boolean. Waiting for second part of Multipart construct.
'found_multi' => FALSE, # Boolean.
'awaiting_options' => FALSE, # Boolean. Waiting for options for a Optioned construct.
'quote_instigator' => '',
'quote_terminator' => '',
'quote_type' => '', # Any in (Interpolated, Multipart, Optioned)
'nested_quote' => 0, # Anything >= 0.
'awaiting_variable' => FALSE, # Boolean. Indicates we're awaiting a variable identifier.
'awaiting_class' => '', # Any in (Scalar, Array, Hash). Class of the variable we're waiting on.
'in_heredoc' => 0, # Anything >= 0 (boolean count).
'here_terminator' => [], # List of Here-Doc terminators that we're waiting for.
'in_pod' => FALSE, # Boolean. Indicates that we're inside a POD.
'was_pod' => FALSE, # Boolean. Indicates that we _were_ inside a POD. (For in_pod() method.)
'in_data' => FALSE, # Boolean. We don't format __DATA__.
'in_comment' => FALSE, # Boolean. Indicates we're inside a normal comment.
'last_token' => '', # The last (non-whitespace, non-comment) token processed.
'last_token_type' => '', # Type of the last token.
'reentrant' => FALSE, # Boolean. Indicates we're formatting a sub-token.
'line_count' => 0, # The number of lines that have been processed.
'unstable' => FALSE, # Boolean. Indicates formats are not persistent (eg. terminal colors).
#
# Option tables.
#
'Substitution Table'=> {}, # Table of characters to replace before formatting.
'Formats' => {
'DEFAULT' => ['', ''],
},
}, $THIS_CLASS;
#===================================================================================================
# Public Methods
#
# The stuff.
#===================================================================================================
=head1 METHODS
=over 4
=item new PACKAGE
=item new OBJECT
Creates a new object. If called on an existing object, creates a new copy of that
object (which is thenceforth totally separate from the original).
=cut
sub new {
my $class = shift;
my $true_class = ref($class) || $class; # We don't want our class being the string version of a reference.
my $source = ref($class) ? $class : $Default_Object; # If called as method of exisiting object, copy.
#
# Hrm. Maybe I'll eventually take a look inside Data::Dumper and see how
# it goes about descending the complex structures and write a non-eval
# deep-copy routine. :-)
#
# Seems kinda silly to put that much work onto the perl parser when we could
# just copy it in-memory.
#
use Data::Dumper; # For deep-copy.
use Carp; # For croak().
local $SIG{__WARN__} = sub { chomp($@ = $_[0]) }; # eval() sometimes doesn't put all it's errors in $@
local $Data::Dumper::Deepcopy = 1; # Descend into nested (complex) structures.
local $Data::Dumper::Terse = 1; # Don't print variable names and assignments.
local $Data::Dumper::Purity = 1; # Ensure nested references are correctly recreated.
my $code = Dumper($source); # Save in case of errors.
my $self = eval($code) or
croak "Deepcopy failed in $true_class\::new() with the error:\n $@\non the code:\n$code";
return bless($self, $true_class);
}
=item reset
Resets the object's internal state. This breaks out of strings and here-docs, ends PODs,
resets the line-count, and otherwise gets the object back into a "normal" state to begin
processing a new stream.
Note that this does B<I<not>> reset any user options (including formats and format stability).
=cut
sub reset {
my $self = ref($_[0]) ? shift : $Default_Object;
$self->{'in_string'} = FALSE;
$self->{'awaiting_multi'} = FALSE;
$self->{'found_multi'} = FALSE;
$self->{'awaiting_options'} = FALSE;
$self->{'quote_instigator'} = '';
$self->{'quote_terminator'} = '';
$self->{'quote_type'} = '';
$self->{'awaiting_variable'} = FALSE;
$self->{'awaiting_class'} = '';
$self->{'in_heredoc'} = 0;
@{$self->{'here_terminator'}} = (); # No need for a whole new anon. array. Just empty this one.
$self->{'in_pod'} = FALSE;
$self->{'was_pod'} = FALSE;
$self->{'in_data'} = FALSE;
$self->{'in_comment'} = FALSE;
$self->{'last_token'} = '';
$self->{'last_token_type'} = '';
$self->{'reentrant'} = FALSE;
$self->{'line_count'} = 0;
}
=item unstable EXPR
=item unstable
Returns true if the formatter is in unstable mode.
If called with a non-zero number, puts the formatter into unstable formatting mode.
In unstable mode, it is assumed that formatting is not persistent one token to the
next and that each token must be explicitly formatted.
=cut
sub unstable {
my $self = ref($_[0]) ? shift : $Default_Object;
return @_ ? $self->{'unstable'} = shift : $self->{'unstable'};
}
=item in_heredoc
Returns true if the next string to be formatted will be inside a Here-Document.
=cut
sub in_heredoc {
my $self = ref($_[0]) ? shift : $Default_Object;
return $self->{'in_heredoc'};
}
=item in_string
Returns true if the next string to be formatted will be inside a multi-line string.
=cut
sub in_string {
my $self = ref($_[0]) ? shift : $Default_Object;
return $self->{'in_string'};
}
=item in_pod
Returns true if the formatter would consider the next string passed to it as begin within
a POD structure. This is false immediately before any POD instigators
(C<=pod>, C<=head1>, C<=item>, etc), true immediately after an instigator, throughout the POD and
immediately before the POD terminator (C<=cut>), and false immediately after the POD terminator.
=cut
sub in_pod {
my $self = ref($_[0]) ? shift : $Default_Object;
return $self->{'in_pod'};
}
=item was_pod
Returns true if the last line of the string just formatted was part of a POD structure.
This includes the C</^=\w+/> POD instigators and terminators.
=cut
sub was_pod {
my $self = ref($_[0]) ? shift : $Default_Object;
return $self->{'was_pod'};
}
=item in_data
Returns true if the next string to be formatted will be inside
the DATA section (ie, follows a C<__DATA__> or C<__END__> tag).
=cut
sub in_data {
my $self = ref($_[0]) ? shift : $Default_Object;
return $self->{'in_data'};
}
=item line_count
Returns the number of lines processed by the formatter.
=cut
sub line_count {
my $self = ref($_[0]) ? shift : $Default_Object;
return $self->{'line_count'};
}
=item substitutions
Returns a reference to the substitution table used. The substitution
table is a hash whose keys are the strings to be replaced, and whose values
are what to replace them with.
=cut
sub substitutions {
my $self = ref($_[0]) ? shift : $Default_Object;
return $self->{'Substitution Table'};
}
=item define_substitution HASH_REF
=item define_substitution LIST
Allows user to define certain characters that will be substituted
before formatting is done (but after they have been processed for
meaning).
If the first parameter is a reference to a hash, the formatter
will replace it's own hash with the given one, and subsequent
changes to the hash outside the formatter will be reflected.
Otherwise, it will copy the arguments passed into it's own
hash, and any substitutions already defined (but not in the
parameter list) will be preserved. (ie, the new substitutions
will be added, without destroying what was there already.)
=cut
sub define_substitution {
my $self = ref($_[0]) ? shift : $Default_Object;
if(ref($_[0]) eq 'HASH') {
$self->{'Substitution Table'} = $_[0];
} else {
my %tmphash = @_;
@{$self->{'Substitution Table'}}{keys %tmphash} = values %tmphash;
}
}
=item set_start_format HASH_REF
=item set_start_format LIST
Given either a list of keys/values, or a reference to a hash of keys/values,
copy them into the object's Formats list.
=cut
sub set_start_format {
my $self = ref($_[0]) ? shift : $Default_Object;
my %tmphash = ref($_[0]) ? %{$_[0]} : @_;
$self->{'Formats'}{$_}[0] = $tmphash{$_} foreach(keys %tmphash);
}
=item set_end_format HASH_REF
=item set_end_format LIST
Given either a list of keys/values, or a reference to a hash of keys/values,
copy them into the object's Formats list.
=cut
sub set_end_format {
my $self = ref($_[0]) ? shift : $Default_Object;
my %tmphash = ref($_[0]) ? %{$_[0]} : @_;
$self->{'Formats'}{$_}[1] = $tmphash{$_} foreach(keys %tmphash);
}
=item set_format LIST
Sets the formatting string for one or more formats.
You should pass a list of keys/values where the keys are the format names and the values
are references to arrays containing the starting and ending formatting strings (in that order)
for that format.
=cut
sub set_format {
my $self = ref($_[0]) ? shift : $Default_Object;
my %tmphash = ref($_[0]) ? %{$_[0]} : @_;
foreach(keys %tmphash) {
@{$self->{'Formats'}{$_}}[0 .. $#{$tmphash{$_}}] = @{$tmphash{$_}}[0 .. $#{$tmphash{$_}}];
}
}
=item get_start_format LIST
Retrieve the string that is inserted to begin a given format type (starting format string).
The names are looked for in the following order:
B<First:> Prefer the names joined by underscore, from most general to least. For example, given
("Variable", "Scalar"): "Variable" then "Variable_Scalar".
B<Second:> Then try each name singly, in reverse order. For example,
"Scalar" then "Variable".
See L<"FORMAT TYPES"> for more information.
=cut
sub get_start_format {
my $self = (@_ && ref($_[0]) ? shift : $Default_Object);
#
# Prefer the names joined by an underscore from most general to least.
# For example, the parameters:
# 'Identifier', 'Variable', 'Scalar'
# tries 'Identifier' first, then 'Identifier_Variable', and finally 'Identifier_Variable_Scalar'.
#
my $format_id = '';
foreach my $format (@_) {
$format_id .= '_' if($format_id ne '');
$format_id .= $format;
return $self->{'Formats'}{$format_id}[0] if(exists $self->{'Formats'}{$format_id});
}
#
# Otherwise, look for each name singly, in reverse order.
# In other words, if they say:
# 'Variable', 'Scalar'
# look for 'Scalar' first, then 'Variable'.
#
foreach my $i (-$#_ .. 0) {
return $self->{'Formats'}{$_[$i]}[0] if(exists $self->{'Formats'}{$_[$i]});
}
#
# Otherwise, return the DEFAULT.
#
return $self->{'Formats'}{'DEFAULT'}[0];
}
=item get_end_format LIST
Retrieve the string that is inserted to end a given format type (ending format string).
=cut
sub get_end_format {
my $self = (@_ && ref($_[0]) ? shift : $Default_Object);
#
# Prefer the names joined by an underscore from most general to least.
# For example, the parameters:
# 'Identifier', 'Variable', 'Scalar'
# tries 'Identifier' first, then 'Identifier_Variable', and finally 'Identifier_Variable_Scalar'.
#
my $format_id = '';
foreach my $format (@_) {
$format_id .= '_' if($format_id ne '');
$format_id .= $format;
return $self->{'Formats'}{$format_id}[1] if(exists $self->{'Formats'}{$format_id});
}
#
# Otherwise, look for each name in reverse order.
# In other words, if they say:
# 'Variable', 'Scalar'
# look for 'Scalar' first, then 'Variable'.
#
for my $i (-$#_ .. 0) {
return $self->{'Formats'}{$_[$i]}[1] if(exists $self->{'Formats'}{$_[$i]});
}
#
# Otherwise, return the DEFAULT.
#
return $self->{'Formats'}{'DEFAULT'}[1];
}
=item get_format_names_list
Returns a list of the I<names> of all the Formats defined.
=cut
sub get_format_names_list {
my $self = (@_ && ref $_[0] ? shift : $Default_Object);
return keys %{$self->{'Formats'}};
}
=item get_start_format_values_list
Returns a list of the I<values> of all the start Formats defined (in the same order
as the names returned by C<get_format_names_list()>).
=cut
sub get_start_format_values_list {
my $self = (@_ && ref $_[0] ? shift : $Default_Object);
return map $$_[0], values %{$self->{'Formats'}};
}
=item get_end_format_values_list
Returns a list of the I<values> of all the end Formats defined (in the same order
as the names returned by C<get_format_names_list()>).
=cut
sub get_end_format_values_list {
my $self = (@_ && ref $_[0] ? shift : $Default_Object);
return map $$_[1], values %{$self->{'Formats'}};
}
=item format_string LIST
Formats one or more strings of Perl code. If no strings are specified, defaults to C<$_>.
Returns the list of formatted strings (or the first string formatted if called in scalar context).
B<Note:> The end of the string is considered to be the end of a line, regardless of whether
or not there is a trailing line-break (but trailing line-breaks will I<not> cause an extra, empty
line).
B<Another Note:> The function actually uses C<$/> to determine line-breaks, unless C<$/> is
set to C<\n> (newline). If C<$/> I<is> C<\n>, then it looks for the first match
of C<m/\r?\n|\n?\r/> in the string and uses that to determine line-breaks. This is to make
it easy to handle non-unix text. Whatever characters it ends up using as line-breaks are
preserved.
=cut
sub format_string {
my $self = (@_ && ref($_[0]) ? shift : $Default_Object);
@_ or push @_, $_; # Default to $_ if no strings passed.
splice(@_, 1) unless(wantarray); # Ignore all but the first string passed if called in scalar context.
my @results = ();
foreach (@_) {
my $string = $_; # Have to do this to avoid "Modification of a read-only value..." errors.
#
# We support any funky kind of line terminator but it must be
# consistant throughout the string (though not between strings).
#
# Unless $/ is custom. Then we use it.
#
my $line_sep = ($/ eq "\n" and $string =~ /(\r\n?|\n\r?)/) ? $1 : $/;
#
# Don't treat trailing $line_sep's as an extra, blank line.
# But do save it, because we'll re-add it later.
#
my $chomped = ($string =~ s/\Q$line_sep\E$//s) ? $line_sep : '';
my @lines = split quotemeta($line_sep), $string, -1; # Split on $line_sep...
#
# Compensate for a "problem" w/ split. Specifically:
#
# $str = <any non-empty string>;
# split('-', $str, -1); # returns ($str)
#
# $str = '';
# split('-', $str, -1) # does _not_ return ($str); returns () instead!
#
@lines = ('') unless(@lines); # Replace empty list with list of 1 empty string.
$_ = $self->_format_line($_) foreach(@lines); # Format. Note that this modifies @lines!
push @results, join($line_sep, @lines) . $chomped; # And recombine.
}
#
# If we're called in scalar context and not given anything to work with,
# avoid "uninitialized value" warnings by returning an empty string.
#
return (wantarray ? @results : (@results ? $results[0] : ''));
}
=item format_token TOKEN, LIST
Returns TOKEN wrapped in the start and end Formats corresponding to LIST
(as would be returned by C<get_start_format( LIST )> and C<get_end_format( LIST )>,
respectively).
No syntax checking is done on TOKEN but substitutions defined with C<define_substitution()>
are performed.
=cut
sub format_token {
my $self = (@_ && ref($_[0]) ? shift : $Default_Object);
my $token = shift;
return '' if(not(defined $token) or $token eq '');
#
# Do any substitutions that are defined.
#
my %tmp_table = %{$self->{'Substitution Table'}};
my $keys = join('|', map qr/\Q$_\E/, keys %tmp_table);
$token =~ s/($keys)/$tmp_table{$1}/eg if(defined $keys and $keys ne '');
#
# Pointer to the array containing the formats, so we don't have to look them up twice.
#
my $ra_formats = undef;
#
# Prefer the names joined by an underscore from most general to least.
# For example, the parameters:
# 'Identifier', 'Variable', 'Scalar'
# tries 'Identifier' first, then 'Identifier_Variable', and finally 'Identifier_Variable_Scalar'.
#
my $format_id = '';
foreach my $format (@_) {
$format_id .= '_' if($format_id ne '');
$format_id .= $format;
if(exists $self->{'Formats'}{$format_id}) {
$ra_formats = $self->{'Formats'}{$format_id};
last;
}
}
#
# Otherwise, look for each name singly, in reverse order.
# In other words, if they say:
# 'Variable', 'Scalar'
# look for 'Scalar' first, then 'Variable'.
#
unless(defined $ra_formats) {
foreach my $i (-$#_ .. 0) {
if(exists $self->{'Formats'}{$_[$i]}) {
$ra_formats = $self->{'Formats'}{$_[$i]};
last;
}
}
}
#
# Otherwise, if nothing found, use the DEFAULT.
#
unless(defined $ra_formats) {
$ra_formats = $self->{'Formats'}{'DEFAULT'};
}
return $ra_formats->[0] . $token . $ra_formats->[1];
}
#===================================================================================================
# Private Methods
#
# Don't call these, please (unless you really want to).
#===================================================================================================
#
# Define typeglob aliases for internal use (to save typing).
#
{
no strict 'refs';
my $pkg = __PACKAGE__;
*{ "$pkg\::_start" } = \&{ "$pkg\::get_start_format" };
*{ "$pkg\::_end" } = \&{ "$pkg\::get_end_format" };
*{ "$pkg\::_wrap" } = \&{ "$pkg\::format_token" };
}
#
# *The* method. :-)
#
# Formats a line of Perl code.
#
# Note:
#
# When I say "line", I mean that the whole string will be treated
# as a *single line*. Regardless of embedded newlines. In fact,
# embedded newlines will be treated as whitespace and will not affect
# the parsing of anything, *EVEN COMMENTS*! Yes, I do realize that
# this is wrong from Perl's point of view. Deal. I might fix that
# later. Who knows. You should be using format_string() anyway.
#
# Another Note:
#
# This method only processes a *single* line (scalar variable) at a time.
# Any aditional parameters will be ignored/lost. Defaults to $_ if no
# parameters are given.
#
sub _format_line {
my $self = (@_ && ref($_[0]) ? shift : $Default_Object);
my $line = (@_ ? shift : $_); # Default to $_.
my $new_line = ''; # Buffer variable for holding the processed part of the line.
#
# Check for special case of recursive call indicating an incorrectly tokenized line-piece.
# (ie, don't do start-of-line stuff)
#
unless($self->{'reentrant'}) {
#
# Increase the line-count.
#
++$self->{'line_count'};
#
# After parsing __END__ or __DATA__, we do no more formatting.
#
# Note: I just figured out that Here-Documents actually "override"
# __END__ and __DATA__. By "override", I mean that, though you
# can specify __END__ or __DATA__ on the same line as another
# statement (and it affects anything on the following lines),
# if the statements before the __(END|DATA)__ cause perl to expect
# a Here-Document, it will process the Here-Document lines before
# instating the DATA section. Consider the following code as an
# example (it will print the string "This will be printed\n"):
#
# print << "HEREDOC"; __END__ This is not processed as code but cannot be read from DATA.
# This will be printed
# HEREDOC
# This is data and can be read from DATA.
#
# The formatter will handle such insanity correctly.
#
return $self->_wrap($line, 'DATA') if($self->{'in_data'} and not $self->{'in_heredoc'});
#
# Do POD stuff.
#
if(not $self->{'in_string'} and not $self->{'in_heredoc'} and
($line =~ /^=\w+/ and $self->{'last_token'} =~ /^[;\}]?$/)) {
$self->{'was_pod'} = $self->{'in_pod'} = TRUE;
}
if($self->{'in_pod'}) {
#
# Check for end of POD (if we're in one).
#
$self->{'in_pod'} = FALSE if($line =~ /^=cut/);
#
# Format as a comment.
# Note that even the instigator and terminator get formatted as comment.
#
return $self->_wrap($line, 'Comment', 'POD');
} else {
$self->{'was_pod'} = FALSE;
}
#
# Check for "here-doc" terminator. It must be the ONLY thing on the line.
#
if($self->{'in_heredoc'} and $line =~ /^$self->{'here_terminator'}[0]$/) {
#
# We found one. Decrement the here-doc level and remove the terminator from the list.
#
--$self->{'in_heredoc'};
shift @{$self->{'here_terminator'}};
$self->{'last_token'} = $line;
$self->{'last_token_type'} = 'Quote';
return $self->_wrap($line, 'Quote'); # Mark here-doc terminators as quotes.
}
#
# Check for "she-bang" line (#!/usr/bin/perl). Note that it *must* be the first line.
#
if($self->{'line_count'} == 1 and $line =~ /^#!/) {
return $self->_wrap($line, 'Directive');
}
#
# Check for line directives.
#
if($line =~ /^(#\s*line\s+\d+(?:\s+(?:"[^"]*"|\S+))?)(.*)$/) {
return $self->_wrap($1, 'Directive') . $self->_wrap($2, 'Comment', 'Normal');
}
#
# String formatting can continue for multiple lines.
#
if(not $self->{'unstable'} and ($self->{'in_string'} or $self->{'in_heredoc'})) {
$new_line = $self->_start('String');
}
} # End of unless($reentrant) (line-based stuff) block.
else {
if($self->{'reentrant'} > 20) {
my $sr = (caller(1))[3]; # Get the subroutine that called us (caller(0) returns us).
my $ln = (caller(0))[2]; # Get the line that _we_ were called from.
die "$0: deep recursion ( > 20 levels) caught in "
. __PACKAGE__ . "::_format_line() called from $sr at line $ln\n";
}
}
#
# "Optimization" to prevent doing more work on empty strings than we have to.
#
# Note: this _must_ be done _after_ the line-based construct
# checks (the unless($reentrant) stuff).
#
return '' if(not(defined $line) or $line eq '');
#
# Tokenize the line.
#
my @tokens = _tokenize($line);
#
# Main loop for processing the tokenized line.
#
foreach my $token (@tokens) {
#
# Skip empty tokens as a special case.
#
next if($token eq '');
$new_line .= $self->_process_token($token);
}
#
# End of line processing.
#
# EOL processing doesn't occur if we're reentrant because that means that
# we're not actually processing a line (rather a piece of a line).
#
if(not $self->{'reentrant'}) {
#
# Comments always end at the end of the line.
#
if($self->{'in_comment'}) {
$self->{'in_comment'} = FALSE;
$new_line .= $self->_end('Comment', 'Normal') unless($self->{'unstable'});
}
#
# Strings run to the end of line but the formats should never run *off* the end of line.
# Instablility of formatting makes it pointless to start and end a line-wide format.
#
if(not $self->{'unstable'} and ($self->{'in_string'} or $self->{'in_heredoc'})) {
$new_line .= $self->_end('String');
}
#
# Setting $self->{'in_heredoc'} is postponed until end of line because the here-doc doesn't
# actually start until the next line. Due to the possibility of "nested" here-doc's,
# we set $self->{'in_heredoc'} to the number of terminators we've gotten.
#
# For example, the code:
#
# print << "END1", "****\n", << "END2";
#
# Creates two terminators ('END1' and 'END2').
#
$self->{'in_heredoc'} = @{$self->{'here_terminator'}};
}
#
# Return the formatted line.
#
return $new_line;
} # End of _format_line()
#
# This _private_ function takes a line passed to it and breaks it into usefull pieces.
# I was using a single regex to do this but it didn't handle precedence properly.
#
sub _tokenize {
my @tokens = ();
local $_ = shift; # Line to tokenize.
#
# Loop through the line, breaking off tokens as we go. The tokens we look for
# (in order of precedence) are:
#
# Comments
# Quotes and quote-like constructs
# Here-Doc initiators
# Subroutine calls
# Variable identifiers
# Whitespace
# Special (backslashed, escaped) characters
# Keywords and builtin functions
# Operators
# Barewords
# Everything else (symbols)
#
LOOP: {
if(m/\G($quotes_re)/gc or # Quote Instigator
m/\G($heredoc_re)/gc or # Here-Doc Instigator
m/\G(__END__|__DATA__)/gc or # Code Terminators
m/\G($keyword_list_re)(?!\w|::)/gc or # Keywords
m/\G($builtin_list_re(?!\w|::)(\s*\()?)/gc or # Built-in Functions
m/\G((?:\\\&|\&)$varchars?\s*(?:$identifier_re|\{))/gc or # Subroutine: &ident
m/\G((?!$operator_list_re\s*\()$identifier_re\s*\()/gc or # Subroutine: ident(
m/\G(\\?$varchars(?:$identifier_re(?:\s*[\[\{])?|\s*\{))/gc or # Variable
m/\G(\\?(?:$varchars(?![@%]))?$builtin_vars_re(?:\s*[\[\{])?)/gc or # Built-in Variables
m/\G(\s+)/gc or # Whitespace
m/\G(\\.)/gc or # Character
m/\G($identifier_re(\s*(=>|:(?!:)))?)/gc or # Bareword / Label
m/\G($number_re)/gc or # Numbers
m/\G($operator_list_re)/gc or # Operator
m/\G(.)/gc # Symbol
) {
push @tokens, $1;
redo LOOP;
};
};
return @tokens;
}
#
# This _private_ function tests a token against any or all of the available Formats,
# and formats it accordingly. It also handles initiating and terminating quoted constructs.
#
sub _process_token {
my $self = (ref($_[0]) ? shift : $Default_Object);
my $token = shift;
#**********************************************************
# Preemptive tests.
#**********************************************************
#
# After parsing __END__ or __DATA__, we no longer format tokens
# (er, rather, we format them as DATA). Even ones on the same
# line as the __END__ or __DATA__.
#
# This block only handles tokens on the same line as the __END/DATA__.
# See _format_line() for the code that handles the lines following the __END/DATA__ line.
#
if($self->{'in_data'} and not $self->{'in_heredoc'}) {
return $self->_wrap($token, 'DATA');
}
#
# The only things we will allow between a class specifier and it's identifier are:
# A comment
# Whitespace
#
if($self->{'awaiting_variable'}) {
unless($token =~ /^$identifier_re/ or $self->{'in_comment'} or $token eq '#' or $token =~ /^\s+$/) {
$self->{'awaiting_variable'} = FALSE;
}
}
#**********************************************************
# Normal token tests.
#**********************************************************
#
# Test for special character.
#
if($token =~ /^(\\.)(.+)?$/) {
my $preamble = $1;
my $postamble = defined($2) ? $2 : '';
#
# We only do special characters when we're inside an
# interpolated string or a here-doc, or the character
# is super-special (meaning either a double back-slash,
# or a back-slash escaped quote-terminator).
#
unless(
(
$self->{'in_string'} and (
$self->{'quote_type'} =~ /Interpolated/
or $token eq "\\\\"
or $token =~ /\\\Q$self->{'quote_terminator'}\E/
)
)
or $self->{'in_heredoc'}
) {
$postamble = substr($preamble, 1, 1) . $postamble; # The character (plus other stuff)
$preamble = substr($preamble, 0, 1); # The backslash
++$self->{'reentrant'};
$preamble = $self->_format_line($preamble);
$postamble = $self->_format_line($postamble);
--$self->{'reentrant'};
return $preamble . $postamble;
}
$self->{'last_token'} = $preamble;
$self->{'last_token_type'} = 'Character';
if(defined $postamble) {
++$self->{'reentrant'};
$postamble = $self->_format_line($postamble);
--$self->{'reentrant'};
}
return $self->_wrap($preamble, 'Character') . $postamble;
}
#
# Test for comment.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and ($token eq '#' or $self->{'in_comment'})) {
#
# Start a new comment.
#
if($token eq '#' and not $self->{'in_comment'}) {
$self->{'in_comment'} = TRUE;
if($self->{'unstable'}) {
return $self->_wrap($token, 'Comment', 'Normal')
} else {
return $self->_start('Comment', 'Normal') . $self->_wrap($token, '')
}
return (
$self->{'unstable'}
?
$self->_wrap($token, 'Comment', 'Normal')
:
$self->_start('Comment', 'Normal') . $self->_wrap($token, '')
);
}
return (
$self->{'unstable'}
?
$self->_wrap($token, 'Comment', 'Normal')
:
$self->_wrap($token, '')
);
}
#
# Test for (DATA Instigators) special tokens that signal the end of executable code.
# We will format nothing after we encounter one of these.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and ($token eq '__END__' or $token eq '__DATA__')) {
$self->{'in_data'} = TRUE;
return $self->_wrap($token, 'CodeTerm');
}
#
# Quote-related tests.
#
#
# Check for nested quotes.
#
# If our quotes are bracketing and we encounter another Instigator inside
# the string, we require a matching terminator before we end the string.
#
# For example:
#
# qq{ Because of this -> { the string does not end here -> }, it ends here -> }
#
if($self->{'in_string'} and
$token !~ /\Q$self->{'quote_terminator'}\E/ and
$token =~ /\Q$self->{'quote_instigator'}\E/
) {
#
# Token matches the quote instigator but not the terminator so it must be
# a bracketing type of quote. We need to increase the count of nested
# quotes. We do not do anything else w/ the token, just let it be processed
# by subsequent code.
#
++$self->{'nested_quote'};
}
#
# Check for second part of Multipart quoted construct (if we're waiting for one).
#
# Comments (handled above) and whitespace are ignored between parts of a Multipart construct.
#
if($self->{'awaiting_multi'} and $token =~ /\S/) {
#
# Anything other than a comment or whitespace causes us to stop waiting
# for the second part. (It's technically an error.)
#
$self->{'awaiting_multi'} = FALSE;
if($token =~ /\Q$self->{'quote_instigator'}\E/) {
#
# We have found the second part!
#
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Quote';
$self->{'found_multi'} = TRUE;
$self->{'in_string'} = TRUE;
return
$self->_wrap($token, 'Quote')
. ($self->{'unstable'} ? '' : $self->_start('String'));
}
}
#
# Check for options to an optioned quoted construct.
#
if($self->{'awaiting_options'}) {
$self->{'awaiting_options'} = FALSE;
if($token =~ /^([cgimosexd]+|s.*)$/) {
my $postamble = '';
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Quote';
#
# Check for lone `s' option incorrectly tokenized as a s/// instigator
# and recursively re-process it if necessary.
#
if($token =~ /^(s)([^cgimoxed]*)$/) {
$token = $1;
$self->{'last_token'} = $token;
++$self->{'reentrant'};
$postamble = $self->_format_line($2);
--$self->{'reentrant'};
}
return $self->_wrap($token, 'Quote') . $postamble;
}
}
#
# Test for quote instigator (string-start).
#
# Note: The forward-slash and question mark characters (/ and ?) as quote instigators are
# pretty difficult to disambiguate and if it becomes a problem, I may just leave them
# out. Though I'd rather not.
#
# The strategy we use here is to only make them operators (division or ternary conditional,
# respectively) if they immediately follow a closing bracket-type-thingy ([\)\]\}]),
# quote, variable, literal number, bareword, or a builtin or user function other than
# print, split, grep, or map.
#
# Note that the function/subroutine situation is still ambiguous: some functions should
# cause them to start a quote and some should cause them to be operators, depending on
# the effective prototype of the function (eg: sin vs. time).
#
# There are also some other ambiguities, as well. Such as when they follow certain types
# of symbols or operators.
#
# See http://perlmonks.org/index.pl?node=On+Parsing+Perl for more information.
#
if((not $self->{'in_string'}) and (not $self->{'in_heredoc'}) and ($token =~ /^$quotes_re/ or
($token =~ m{^[/?]} and
$self->{'last_token'} !~ /[\)\]\}]$/ and # Closing bracket-type-thingy. Might add > later.
$self->{'last_token_type'} ne 'Quote' and
$self->{'last_token_type'} ne 'Variable' and
$self->{'last_token_type'} ne 'Number' and
$self->{'last_token_type'} ne 'Bareword' and
$self->{'last_token_type'} ne 'Subroutine' and
($self->{'last_token_type'} ne 'Builtin' or
$self->{'last_token'} eq 'print' or
$self->{'last_token'} eq 'split' or
$self->{'last_token'} eq 'grep' or
$self->{'last_token'} eq 'map')))) {
#
# Create a copy of $token so we can modify it with impunity.
# (Specifically for splitting up of '/='-like constructs (see below).)
#
my $quote = $token;
#
# In certain contexts (see above), the token '/=' or similar will be considered
# the start of a pattern-match quote. We have to split off the extra and process
# it as part of the string so we store it in $postamble and re-process it later
# (see the return at the bottom of this block).
#
my $postamble = '';
if($quote =~ m{^([/?])(.+)$}) {
#
# Store the split-off quote instigator (/) and the postamble.
#
$quote = $1;
$postamble = $2;
}
#
# The quote-instigator is the last character of the token.
#
$self->{'quote_instigator'} = substr $quote, -1;
#
# Define special terminators for bracketing characters.
# Otherwise, use the same character as the instigator.
#
$self->{'quote_terminator'} =
{ '{' => '}',
'(' => ')',
'[' => ']',
'<' => '>',
}->{$self->{'quote_instigator'}} || $self->{'quote_instigator'};
#
# The type will be matched later on like so:
#
# if($self->{'quote_type'} =~ /Interpolated/) { # Is it interpolated?
#
# Note: Some of the quoted constructs are interpolated or non-interpolated
# depending on the instigator/terminator character used. Specifically,
# if a single quote is used as the delimter for qx, m, qr, and s, they
# are *not* interpolated. Otherwise, they *are* interpolated.
#
$self->{'quote_type'} = (
($quote =~ /'|q[^qxwr]/ && 'Literal') or
($quote =~ /"|qq/ && 'Literal, Interpolated') or
($quote =~ /`|qx/ && 'Command' .
($self->{'quote_instigator'} eq q(') ? '' : ', Interpolated'))
or
($quote =~ /qw/ && 'Word list') or
($quote =~ /m|^[\/?]/ && 'Pattern, Matching, Optioned' .
($self->{'quote_instigator'} eq q(') ? '' : ', Interpolated'))
or
($quote =~ /qr/ && 'Pattern, Optioned' .
($self->{'quote_instigator'} eq q(') ? '' : ', Interpolated'))
or
($quote =~ /s/ && 'Pattern, Substitution, Optioned, Multipart' .
($self->{'quote_instigator'} eq q(') ? '' : ', Interpolated'))
or
($quote =~ /tr|y/ && 'Transliteration, Optioned, Multipart') or
'Error: Quote-Type Not Found'
);
$self->{'in_string'} = TRUE;
$self->{'last_token'} = $quote;
$self->{'last_token_type'} = 'Quote';
#
# Post-process the $postamble if necessary.
#
if($postamble ne '') {
++$self->{'reentrant'};
$postamble = $self->_format_line($postamble);
--$self->{'reentrant'};
}
return
$self->_wrap($quote, 'Quote')
. $self->_start('String')
. $postamble
. ($self->{'unstable'} ? $self->_end('String') : '');
} # End test for Quote Instigator
#
# Check for Quote Terminator. Here-doc terminators are line-based
# constructs, and thus are checked in _format_line().
#
if($self->{'in_string'} and
$token =~ /^(.*?)(?<!\\)(\Q$self->{'quote_terminator'}\E)(.*)$/
) {{ # Note double braces. That's so we can use last (just below) to exit the if.
#
# If our quotes are bracketing and we've encountered another Instigator inside
# the string, we require a matching terminator before we end the string.
#
# For example:
#
# qq{ Because of this -> { the string does not end here -> }, it ends here -> }
#
if($self->{'nested_quote'} > 0) {
--$self->{'nested_quote'};
last; # Exit enclosing if block (with double braces, not if nested_quote)
}
#
# This block terminates (possibly just the first part of) a quoted structure.
#
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Quote';
#
# Note on $preamble and $postamble:
#
# There might be extra "stuff" attached to the beginning or end of
# our quote terminator that should be formatted separately. This
# is due to the fact that the tokenizer doesn't know when it's tokenizing
# that it should be breaking things up based on quote teriminators.
#
# For example, the string '"$"' tokenizes as:
#
# '"' (quote-start), '$"' (built-in variable)
#
# It should actually be parsed:
#
# '"' (quote-start), '$' (error in Perl), '"' (quote-end)
#
# Another example; the string 's sjsjs' tokenizes as:
#
# 's s' (substitution-start), 'jsjs' (bareword)
#
# Instead of:
#
# 's s' (sub.-start), 'j' (string), 's' (sub.-end 1), 'j' (string), 's' (sub.-end)
#
my $preamble = $1;
my $terminator = $2;
my $new_string = ''; # May or may not be set; depends on if we find the second part of a multi-part.
my $postamble = $3;
++$self->{'reentrant'};
$preamble = $self->_format_line($preamble); # Must process preamble before doing multi-part logic.
--$self->{'reentrant'}; # Otherwise, we wouldn't know if it should be in_string.
#
# Handle multipart quotes.
#
if($self->{'found_multi'}) {
#
# If we've already found Multipart, we shouldn't look for it.
#
$self->{'found_multi'} = FALSE;
$self->{'in_string'} = FALSE;
$self->{'awaiting_options'} = TRUE if($self->{'quote_type'} =~ /Optioned/);
} elsif($self->{'quote_type'} =~ /Multipart/) {
#
# If we haven't already found the Multipart, we should check for it immediately.
#
if($self->{'quote_instigator'} eq $self->{'quote_terminator'}) {
#
# We found it.
#
$self->{'found_multi'} = TRUE;
$self->{'in_string'} = TRUE;
$new_string = $self->_start('String'); # Unstable logic done below (when this is used).
} else {
#
# We didn't find it so we start waiting.
#
$self->{'awaiting_multi'} = TRUE;
$self->{'in_string'} = FALSE;
}
} else {
#
# This quoted construct isn't Multiparted so we just end it.
#
$self->{'in_string'} = FALSE;
$self->{'awaiting_options'} = TRUE if($self->{'quote_type'} =~ /Optioned/);
}
#
# Do the formatting and re-processing.
#
my $formatted_token;
$formatted_token .= $preamble;
$formatted_token .= $self->_end('String') unless($self->{'unstable'});
$formatted_token .= $self->_wrap($terminator, 'Quote');
$formatted_token .= $new_string unless($self->{'unstable'});
#
# Reprocess $postamble now that multi-part logic has been done.
#
++$self->{'reentrant'};
$formatted_token .= $self->_format_line($postamble);
--$self->{'reentrant'};
return $formatted_token;
}} # End check for Quote Terminator. Note double braces.
#
# Test for Here-Doc (type of quote).
#
# Note: This maybe should be combined with the test
# for Quote Instigator or possibly Operator. Maybe.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and $token =~ /^$heredoc_re$/) {
#
# Here-Document instigators are ambiguous in some situations. The
# rule used here is that it's considered a Here-Document instigator
# unless it follows a Variable, Bareword, or Quote (string). If it
# does follow one of those, then it's probably a binary left shift
# operator and the token should be reprocessed.
#
# This rule doesn't cover every situation (functions with certain
# prototypes should also cause it to be considered a shift operator,
# and there's probably other situtations) but it should cover the
# most common ones.
#
if($self->{'last_token_type'} =~ /Quote|Bareword|Variable/) {
my ($preamble, $postamble) = $token =~ /^(<<)(.*)$/;
$preamble = $self->_wrap($preamble, 'Operator');
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Quote';
++$self->{'reentrant'};
$postamble = $self->_format_line($postamble);
--$self->{'reentrant'};
return $preamble . $postamble;
}
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Quote';
#
# Push only the word part of the here-doc terminator (not any optional quotes) onto the list.
# Note that this word part *can* be an empty string.
#
my ($term) = $token =~ /(\w+)/;
$term = '' unless(defined $term);
push @{$self->{'here_terminator'}}, $term;
$self->{'quote_type'} = 'Here-Document, Interpolated';
return $self->_wrap($token, 'Quote');
}
#
# End of quote-related tests.
#
#
# Test for keyword.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and $token =~ /^(?:$keyword_list_re)$/) {
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Keyword';
#
# Test for formats. Treat them like here-docs (they terminate w/ line =~ /^.$/).
#
if($token eq 'format') {
push @{$self->{'here_terminator'}}, '.';
}
return $self->_wrap($token, 'Keyword');
}
#
# Test for builtin functions.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and $token =~ /^($builtin_list_re)(\s*)(\(?)$/ and
$self->{'last_token'} ne 'sub' and $self->{'last_token'} ne '->') {
$self->{'last_token'} = $token;
if($3) {
$self->{'last_token_type'} = 'Symbol';
} else {
$self->{'last_token_type'} = 'Builtin';
}
return
$self->_wrap($1, 'Builtin', ($3 ? 'Function' : 'Operator')) .
$self->_wrap($2, 'Whitespace') .
$self->_wrap($3, 'Symbol');
}
#
# Test for subroutine.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and
($token =~ /^(\&$varchars?)(\s*)($identifier_re)?()((?(4)|\{))$/ or
$token =~ /^()()($identifier_re)(\s*)(\()$/ or
($token =~ /^()()($identifier_re)()()$/ and
($self->{'last_token'} eq 'sub' or $self->{'last_token'} eq '->')))) {
my $ampersand = $1 || '';
my $whitespace1 = $2 || '';
my $identifier = $3 || '';
my $whitespace2 = $4 || '';
my $parenthesis = $5 || '';
#
# Check for package imports with parameters (they accidentally get tokenized
# as subroutine calls.
#
if($self->{'last_token'} =~ /^(require|use|no)$/ and $ampersand eq '') {
$self->{'last_token'} = $token;
if($parenthesis) {
$self->{'last_token_type'} = 'Symbol';
} else {
$self->{'last_token_type'} = 'Subroutine';
}
return
$self->_wrap($identifier, 'Package')
. $self->_wrap($whitespace2, 'Whitespace')
. $self->_wrap($parenthesis, 'Symbol');
}
$self->{'last_token'} = $token;
if($parenthesis) {
$self->{'last_token_type'} = 'Symbol';
} else {
$self->{'last_token_type'} = 'Subroutine';
}
return (
(
$self->{'unstable'}
?
$self->_wrap($ampersand, 'Subroutine')
. $self->_wrap($whitespace1, 'Whitespace')
. $self->_wrap($identifier, 'Subroutine')
:
$self->_wrap($ampersand
. $self->_wrap($whitespace1, 'Whitespace')
. $identifier, 'Subroutine') # _wrap($amp . _wrap($white1, 'WS') . $ident, 'SR')
)
. $self->_wrap($whitespace2, 'Whitespace')
. $self->_wrap($parenthesis, 'Symbol')
);
} # End tests for subroutine.
#
# Test for variable.
#
# Note in the conditional for built-in variables (1st line):
# First we test for match, then, still in the conditional, we split it into the needed
# positional variables ($[1-6]) with the next match (3rd line). Once the token matches
# the first pattern (1st line), it should *always* match the second (2nd line) as well.
#
if(($token =~ /^$varchars?$builtin_vars_re$/ and
$token =~ /^($varchars)()(.+?)()([\[\{]?)$/) or # Split after match built-in variables.
$token =~ /^($varchars)(\s*)($identifier_re)(\s*)([\[\{]?)$/ or
$token =~ /^($varchars)(\s*)(\{)$/ or
$token =~ /^([\$\@\%\*])$/ or # Extra leading empty parens in regex to shift positional variables
($self->{'awaiting_variable'} and $token =~ /^()()($identifier_re)$/) ) {{ # Note double braces.
#
# The braces for this if() statement are doubled so that we can use the 'last'
# loop control statement to break out of the entire conditional block in the
# first conditional block below (the test for partial variables within Patterns).
#
my $class = '';
my $class_specifier = $1 || '';
my $whitespace1 = $2 || '';
my $identifier = (defined $3 ? $3 : ''); # Special case. ident. might be 0 ($0)
my $whitespace2 = $4 || '';
my $subscript = $5 || '';
my $postamble = '';
#
# Don't format variables inside of non-interpolated strings.
# Remember to do this _after_ using the positional variables!
#
last if($self->{'in_string'} and $self->{'quote_type'} !~ /Interpolated/);
#
# We don't format partial variables (ie, ones without identifiers) inside
# of Regex (Pattern) strings.
#
if($identifier eq '' and $self->{'in_string'} and $self->{'quote_type'} =~ /Pattern/) {
#
# This 'last' only works because of the doubled braces around the larger conditional
# block (if($token =~ ...) (see above). This trick is explained in the Perl syntax
# documentation (perlsyn). See `man perlsyn` under the Loop Control section for
# more information.
#
last;
}
#
# Hashes and typeglobs are not interpolated into strings
# or here-documents, so we need to strip any leading hash
# hash symbols (%) or typeglob symbols (*) and not consider
# the token a variable.
#
if(($self->{'in_string'} or $self->{'in_heredoc'}) and $class_specifier =~ /^([\%\*]+)/) {
my $preamble = $1;
#
# If the only thing there is the hash/typeglob character, just return.
#
if(length $token == length $preamble) {
return (
$self->{'unstable'}
?
$self->_wrap($token, 'String') # Reinstate string formatting if unstable.
:
$self->_wrap($token, '') # Format as '' to ensure substitutions.
);
}
#
# Reinstate string formatting if we're unstable.
#
$preamble = $self->_wrap($preamble, $self->{'unstable'} ? 'String' : '');
#
# Otherwise, strip off the leading symbol and reprocess the rest (via recursive call).
#
++$self->{'reentrant'};
my $result = $preamble . $self->_format_line(substr($token,1));
--$self->{'reentrant'};
return $result;
}
if($self->{'awaiting_variable'}) {
$self->{'awaiting_variable'} = FALSE;
# Adjust the class for a subscript or use the class determined before.
$class = (
$subscript
?
{'[' => 'Array', '{' => 'Hash'}->{$subscript}
:
$self->{'awaiting_class'}
);
++$self->{'reentrant'};
my $return_val =
$self->_wrap($whitespace1, 'Whitespace')
. $self->_wrap($class_specifier . $identifier, 'Variable', $class)
. $self->_wrap($whitespace2, 'Whitespace')
. $self->_format_line($subscript); # Reprocess it, in case we're in a string.
--$self->{'reentrant'};
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Variable';
return $return_val;
} elsif($class_specifier) {
# Adjust the class for a subscript or use the class specifier.
$class = (
$subscript ?
{'[' => 'Array', '{' => 'Hash'}->{$subscript}
:
{'$' => 'Scalar',
'@' => 'Array',
'%' => 'Hash',
'*' => 'Typeglob',
}->{substr($class_specifier,0,1)}
);
$class = 'INVALID CLASS' unless(defined $class);
#
# The special case of $identifier eq '{' (as in $token eq '${' for '${foo}')
# has to be handled. In case we're inside a string (we want symbols formatted
# consistantly, even if it's consistantly wrong), we need to recursively
# re-process the identifier.
#
# The other special case of $identifier eq '' means that we should start waiting
# for an identifier on a following line.
#
if($identifier eq '{') {
++$self->{'reentrant'};
$postamble = $self->_format_line($identifier);
--$self->{'reentrant'};
$identifier = '';
} elsif($identifier eq '') {
$self->{'awaiting_variable'} = TRUE;
$self->{'awaiting_class'} = $class;
}
++$self->{'reentrant'};
my $return_val =
$self->_wrap($whitespace1, 'Whitespace')
. $self->_wrap($class_specifier . $identifier, 'Variable', $class)
. $self->_wrap($whitespace2, 'Whitespace')
. $self->_format_line($subscript) # Reprocess in case we're in a string.
. $postamble;
--$self->{'reentrant'};
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Variable';
return $return_val;
}
#
# If we're not awaiting a variable identifier and there's no class specifier
# ($, @, or %), then it's probably actually a bareword or keyword or something.
#
# So we just let this if() statement fall through.
#
}} # End test for Variable. Note double braces.
#
# Test for whitespace.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and $token =~ /^\s+$/) {
return $self->_wrap($token, 'Whitespace');
}
#
# Test for operator.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and $token =~ /^(?:$operator_list_re)$/) {
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Operator';
return $self->_wrap($token, 'Operator');
}
#
# Test for number.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and $token =~ /^$number_re$/) {
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Number';
return $self->_wrap($token, 'Number');
}
#
# Test for bareword (or package name, which is a type of bareword).
#
if(not($self->{'in_string'} or $self->{'in_heredoc'}) and
$token =~ /^($identifier_re)((\s*)(=>|:(?!:)))?$/) {
#
# If $token =~ /BAREWORD\s*=>/, then BAREWORD should be formatted as a string.
#
# If $token =~ /BAREWORD\s*:/, then it's actually a label (elsif block).
#
if(defined $2 and substr($2, -1) ne ':') { # It's a string.
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'String';
++$self->{'reentrant'};
my $result = $self->_wrap($1, 'String') . $self->_format_line($2);
--$self->{'reentrant'};
return $result;
} elsif(defined $2) { # It's a label.
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'String';
return $self->_wrap($1, 'Label') . $self->_wrap($3, 'Whitespace') . $self->_wrap($4, 'Label');
}
if($self->{'last_token'} =~ /^(require|package|use|no)$/) {
#
# This bareword is actually a package name.
#
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Package';
return $self->_wrap($token, 'Package');
} elsif(substr($self->{'last_token'}, -1) eq '{' and $self->{'last_token_type'} eq 'Variable') {
#
# This bareword is the subscript to a hash and should be formatted as a string.
#
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'String';
return $self->_wrap($token, 'String');
} else {
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Bareword';
return $self->_wrap($token, 'Bareword');
}
}
#
# Test for symbol.
#
if(not($self->{'in_string'} or $self->{'in_heredoc'})) {
#
# The pound symbol (#) is special in that it starts a normal comment.
#
if($token eq '#') {
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Comment';
$self->{'in_comment'} = TRUE;
return (
$self->{'unstable'}
?
$self->_wrap($token, 'Comment', 'Normal')
:
$self->_start('Comment', 'Normal') . $self->_wrap($token, '')
);
}
$self->{'last_token'} = $token;
$self->{'last_token_type'} = 'Symbol';
return $self->_wrap($token, 'Symbol');
}
#
# No matches were made so we just return the token (reinstating
# string formatting if formatting is unstable).
#
return (
(($self->{'in_string'} or $self->{'in_heredoc'}) and $self->{'unstable'})
?
$self->_wrap($token, 'String') # If we're unstable, we need to reinstate string formatting.
:
$self->_wrap($token, '') # Format as '' to ensure substitutions; this causes no markup.
);
} # End _process_token()
TRUE; # Return true to indicate success.
=pod
=back
=head1 KNOWN ISSUES or LIMITATIONS
=over 4
=item *
Barewords used as keys to a hash are formatted as strings. This is Good. They should
not be, however, if they are not the only thing within the curly braces. That can be
fixed.
=item *
This version does not handle formats (see L<perlform(1)|perlform/1>) very well. It treats them as
Here-Documents and ignores the rules for comment lines, as well as the fact that picture
lines are not supposed to be interpolated. Thus, your picture lines will look strange
with the '@'s being formatted as array variables (albeit, invalid ones).
Ideally, it would also treat value lines as normal Perl code and format accordingly.
I think I'll get to the comment lines and non-interpolating picture lines first.
If/When I do get this fixed, I will most likely add a format type of 'Format' or something,
so that they can be formatted differently, if so desired.
=item *
This version does not handle Regular Expression significant characters. It simply treats
Regular Expressions as interpolated strings.
=item *
User-defined subroutines, called without parentheses, are formatted as barewords.
This is because there is no way to tell them apart from barewords without parsing
the code, and would require us to go as far as perl does when doing the C<-c> check
(ie, executing BEGIN and END blocks and the like). That's not going to happen.
=item *
If you are indexing (subscripting) an array or hash, the formatter tries to figure
out the "real" variable class by looking at how you index the variable. However, if
you do something funky (but legal in Perl) and put line-breaks or comments between
the variable class character ($) and your identifier, the formatter will get confused
and treat your variable as a scalar. Until it finds the index character. Then it
will format the scalar class character ($) as a scalar and your identifier as
the "correct" class.
=item *
If you put a line-break between your variable identifier and it's indexing character (see
above), which is also legal in Perl, the formatter will never find it and treat your
variable as a scalar.
=item *
If you put a line-break between a bareword hash-subscript and the hash variable, or between
a bareword and its associated C<=E<gt>> operator, the bareword will not be formatted correctly
(as a string). I<(Noticing a pattern here?)>
=back
=head1 AUTHOR
Cory Johns B<darkness@yossman.net>
Copyright (c) 2001 Cory Johns. This library is free software; you can
redistribute and/or modify it under the same conditions as Perl itself.
=head1 TO DO
=over 4
=item 1
Improve handling of regular expressions. Add support for regexp-special characters.
Recognize the /e option to the substitution operator (maybe).
=item 2
Improve handling of formats. Don't treat format definitions as interpolating. Handle
format-comments. Possibly format value lines as normal Perl code.
=item 3
Create in-memory deep-copy routine to replace C<eval(Data::Dumper)> deep-copy.
=item 4
Generalize state transitions (C<reset()> and, in the future, C<copy_state()>) to use
non-hard-coded keys and values for state variables. Probably will extrapolate them into an
overloadable hash, and use the aforementioned deep-copy to assign them.
=item 5
Create a method to save or copy states between objects (C<copy_state()>). Would be useful for
using this module in an editor.
=item 6
Add support for greater-than-one length special characters. Specifically, octal,
hexidecimal, and control character codes. For example, C<\644>, C<\x1a4> or C<\c[>.
=back
=head1 REVISIONS
=head2 04-04-2001 Cory Johns
=over 4
=item *
Fixed problem with special characters not formatting inside of Here-Documents.
=item *
Fixed bug causing hash variables to format inside of Here-Documents.
=back
=head2 03-30-2001 Cory Johns
=over 4
=item *
Fixed bug where quote-terminators were checked for inside of Here-Documents.
=back
=head2 03-29-2001 Cory Johns
=over 4
=item *
Moved token processing tests from _format_line() into _process_token()
(where they should've been all along), generally making _format_line()
more logical. Contemplating extrapolating the tokenizing and token
loop into its own subroutine to avoid all the recursive calls.
=item *
Fixed bug that caused special characters to be recognized outside of
strings.
=item *
Added $VERSION variable.
=item *
Added support for different types of literal numbers: floating point,
exponential notation (eg: 1.3e10), hexidecimal, and underscore-separated.
=item *
Added the C<CodeTerm> and C<DATA> Formats.
=back
=head2 03-27-2001 Cory Johns
=over 4
=item *
Added was_pod() and updated the documentation for in_pod().
=back
=head2 03-20-2001 Cory Johns
=over 4
=item *
Added support for Perl formats (ie, `C<format = ...>').
=back
| 28.854938 | 110 | 0.564695 |
ed2b804ac75305acb7c17d845f7c7ec124fc73bf | 1,092 | pl | Perl | EXAMPLES/policy3a.pl | PHANTOM-Platform/Security-Server | 91af12468b0fca341592058f28b8a718007020f1 | [
"Apache-2.0"
]
| null | null | null | EXAMPLES/policy3a.pl | PHANTOM-Platform/Security-Server | 91af12468b0fca341592058f28b8a718007020f1 | [
"Apache-2.0"
]
| null | null | null | EXAMPLES/policy3a.pl | PHANTOM-Platform/Security-Server | 91af12468b0fca341592058f28b8a718007020f1 | [
"Apache-2.0"
]
| null | null | null | policy('Policy3','rbac', [
user('jones'),
user('smith'),
user_attribute('Doctor'),
user_attribute('Intern'),
object('mrec1'), % this will generate a placeholder for the host and path
%object('mrec1','File',no,musial,'/PM/Examples/MedRecords/mrec1.rtf',object_attribute,'Medical Records'),
object_attribute('Medical Records'),
policy_class('rbac'),
operation(read, 'File'),
operation(write, 'File'),
connector('PM'),
assign('jones','Intern'),
assign('smith','Doctor'),
assign('Doctor','Intern'),
assign('mrec1','Medical Records'),
assign('Intern','rbac'),
assign('Medical Records','rbac'),
assign('rbac','PM'),
associate('Doctor',[write],'Medical Records'),
associate('Intern',[read],'Medical Records')
]).
% TESTS
% access('Policy3',(jones,read,mrec1)),
% \+ access('Policy3',(jones,write,mrec1)),
% access('Policy3',(smith,read,mrec1)),
% access('Policy3',(smith,write,mrec1)),
% \+ access('Policy3',(smith,read,'Medical Records'))
| 28 | 112 | 0.596154 |
ed26312c5078dc51a7412e73ded77fb4c029589f | 48,539 | pm | Perl | cygwin/perl5.14/lib/perl5/DateTime/TimeZone/America/Goose_Bay.pm | rwhitworth/precompiled-perl-mods | bbcfaa3e1663eaac8d770548ca275c50c5eead97 | [
"Artistic-2.0"
]
| null | null | null | cygwin/perl5.14/lib/perl5/DateTime/TimeZone/America/Goose_Bay.pm | rwhitworth/precompiled-perl-mods | bbcfaa3e1663eaac8d770548ca275c50c5eead97 | [
"Artistic-2.0"
]
| null | null | null | cygwin/perl5.14/lib/perl5/DateTime/TimeZone/America/Goose_Bay.pm | rwhitworth/precompiled-perl-mods | bbcfaa3e1663eaac8d770548ca275c50c5eead97 | [
"Artistic-2.0"
]
| null | null | null | # This file is auto-generated by the Perl DateTime Suite time zone
# code generator (0.07) This code generator comes with the
# DateTime::TimeZone module distribution in the tools/ directory
#
# Generated from /tmp/fQcgigXnA8/northamerica. Olson data version 2015e
#
# Do not edit this file directly.
#
package DateTime::TimeZone::America::Goose_Bay;
$DateTime::TimeZone::America::Goose_Bay::VERSION = '1.92';
use strict;
use Class::Singleton 1.03;
use DateTime::TimeZone;
use DateTime::TimeZone::OlsonDB;
@DateTime::TimeZone::America::Goose_Bay::ISA = ( 'Class::Singleton', 'DateTime::TimeZone' );
my $spans =
[
[
DateTime::TimeZone::NEG_INFINITY, # utc_start
59421787300, # utc_end 1884-01-01 04:01:40 (Tue)
DateTime::TimeZone::NEG_INFINITY, # local_start
59421772800, # local_end 1884-01-01 00:00:00 (Tue)
-14500,
0,
'LMT',
],
[
59421787300, # utc_start 1884-01-01 04:01:40 (Tue)
60494700652, # utc_end 1918-01-01 03:30:52 (Tue)
59421774648, # local_start 1884-01-01 00:30:48 (Tue)
60494688000, # local_end 1918-01-01 00:00:00 (Tue)
-12652,
0,
'NST',
],
[
60494700652, # utc_start 1918-01-01 03:30:52 (Tue)
60503607052, # utc_end 1918-04-14 05:30:52 (Sun)
60494688000, # local_start 1918-01-01 00:00:00 (Tue)
60503594400, # local_end 1918-04-14 02:00:00 (Sun)
-12652,
0,
'NST',
],
[
60503607052, # utc_start 1918-04-14 05:30:52 (Sun)
60520537852, # utc_end 1918-10-27 04:30:52 (Sun)
60503598000, # local_start 1918-04-14 03:00:00 (Sun)
60520528800, # local_end 1918-10-27 02:00:00 (Sun)
-9052,
1,
'NDT',
],
[
60520537852, # utc_start 1918-10-27 04:30:52 (Sun)
60526236652, # utc_end 1919-01-01 03:30:52 (Wed)
60520525200, # local_start 1918-10-27 01:00:00 (Sun)
60526224000, # local_end 1919-01-01 00:00:00 (Wed)
-12652,
0,
'NST',
],
[
60526236652, # utc_start 1919-01-01 03:30:52 (Wed)
61038761452, # utc_end 1935-03-30 03:30:52 (Sat)
60526224000, # local_start 1919-01-01 00:00:00 (Wed)
61038748800, # local_end 1935-03-30 00:00:00 (Sat)
-12652,
0,
'NST',
],
[
61038761452, # utc_start 1935-03-30 03:30:52 (Sat)
61062694200, # utc_end 1936-01-01 03:30:00 (Wed)
61038748852, # local_start 1935-03-30 00:00:52 (Sat)
61062681600, # local_end 1936-01-01 00:00:00 (Wed)
-12600,
0,
'NST',
],
[
61062694200, # utc_start 1936-01-01 03:30:00 (Wed)
61074012600, # utc_end 1936-05-11 03:30:00 (Mon)
61062681600, # local_start 1936-01-01 00:00:00 (Wed)
61074000000, # local_end 1936-05-11 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61074012600, # utc_start 1936-05-11 03:30:00 (Mon)
61086709800, # utc_end 1936-10-05 02:30:00 (Mon)
61074003600, # local_start 1936-05-11 01:00:00 (Mon)
61086700800, # local_end 1936-10-05 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61086709800, # utc_start 1936-10-05 02:30:00 (Mon)
61105462200, # utc_end 1937-05-10 03:30:00 (Mon)
61086697200, # local_start 1936-10-04 23:00:00 (Sun)
61105449600, # local_end 1937-05-10 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61105462200, # utc_start 1937-05-10 03:30:00 (Mon)
61118159400, # utc_end 1937-10-04 02:30:00 (Mon)
61105453200, # local_start 1937-05-10 01:00:00 (Mon)
61118150400, # local_end 1937-10-04 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61118159400, # utc_start 1937-10-04 02:30:00 (Mon)
61136911800, # utc_end 1938-05-09 03:30:00 (Mon)
61118146800, # local_start 1937-10-03 23:00:00 (Sun)
61136899200, # local_end 1938-05-09 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61136911800, # utc_start 1938-05-09 03:30:00 (Mon)
61149609000, # utc_end 1938-10-03 02:30:00 (Mon)
61136902800, # local_start 1938-05-09 01:00:00 (Mon)
61149600000, # local_end 1938-10-03 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61149609000, # utc_start 1938-10-03 02:30:00 (Mon)
61168966200, # utc_end 1939-05-15 03:30:00 (Mon)
61149596400, # local_start 1938-10-02 23:00:00 (Sun)
61168953600, # local_end 1939-05-15 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61168966200, # utc_start 1939-05-15 03:30:00 (Mon)
61181058600, # utc_end 1939-10-02 02:30:00 (Mon)
61168957200, # local_start 1939-05-15 01:00:00 (Mon)
61181049600, # local_end 1939-10-02 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61181058600, # utc_start 1939-10-02 02:30:00 (Mon)
61200415800, # utc_end 1940-05-13 03:30:00 (Mon)
61181046000, # local_start 1939-10-01 23:00:00 (Sun)
61200403200, # local_end 1940-05-13 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61200415800, # utc_start 1940-05-13 03:30:00 (Mon)
61213113000, # utc_end 1940-10-07 02:30:00 (Mon)
61200406800, # local_start 1940-05-13 01:00:00 (Mon)
61213104000, # local_end 1940-10-07 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61213113000, # utc_start 1940-10-07 02:30:00 (Mon)
61231865400, # utc_end 1941-05-12 03:30:00 (Mon)
61213100400, # local_start 1940-10-06 23:00:00 (Sun)
61231852800, # local_end 1941-05-12 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61231865400, # utc_start 1941-05-12 03:30:00 (Mon)
61244562600, # utc_end 1941-10-06 02:30:00 (Mon)
61231856400, # local_start 1941-05-12 01:00:00 (Mon)
61244553600, # local_end 1941-10-06 00:00:00 (Mon)
-9000,
1,
'NDT',
],
[
61244562600, # utc_start 1941-10-06 02:30:00 (Mon)
61263315000, # utc_end 1942-05-11 03:30:00 (Mon)
61244550000, # local_start 1941-10-05 23:00:00 (Sun)
61263302400, # local_end 1942-05-11 00:00:00 (Mon)
-12600,
0,
'NST',
],
[
61263315000, # utc_start 1942-05-11 03:30:00 (Mon)
61366287600, # utc_end 1945-08-14 23:00:00 (Tue)
61263306000, # local_start 1942-05-11 01:00:00 (Mon)
61366278600, # local_end 1945-08-14 20:30:00 (Tue)
-9000,
1,
'NWT',
],
[
61366287600, # utc_start 1945-08-14 23:00:00 (Tue)
61370281800, # utc_end 1945-09-30 04:30:00 (Sun)
61366278600, # local_start 1945-08-14 20:30:00 (Tue)
61370272800, # local_end 1945-09-30 02:00:00 (Sun)
-9000,
1,
'NPT',
],
[
61370281800, # utc_start 1945-09-30 04:30:00 (Sun)
61378313400, # utc_end 1946-01-01 03:30:00 (Tue)
61370269200, # local_start 1945-09-30 01:00:00 (Sun)
61378300800, # local_end 1946-01-01 00:00:00 (Tue)
-12600,
0,
'NST',
],
[
61378313400, # utc_start 1946-01-01 03:30:00 (Tue)
61389639000, # utc_end 1946-05-12 05:30:00 (Sun)
61378300800, # local_start 1946-01-01 00:00:00 (Tue)
61389626400, # local_end 1946-05-12 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61389639000, # utc_start 1946-05-12 05:30:00 (Sun)
61402336200, # utc_end 1946-10-06 04:30:00 (Sun)
61389630000, # local_start 1946-05-12 03:00:00 (Sun)
61402327200, # local_end 1946-10-06 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61402336200, # utc_start 1946-10-06 04:30:00 (Sun)
61421088600, # utc_end 1947-05-11 05:30:00 (Sun)
61402323600, # local_start 1946-10-06 01:00:00 (Sun)
61421076000, # local_end 1947-05-11 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61421088600, # utc_start 1947-05-11 05:30:00 (Sun)
61433785800, # utc_end 1947-10-05 04:30:00 (Sun)
61421079600, # local_start 1947-05-11 03:00:00 (Sun)
61433776800, # local_end 1947-10-05 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61433785800, # utc_start 1947-10-05 04:30:00 (Sun)
61452538200, # utc_end 1948-05-09 05:30:00 (Sun)
61433773200, # local_start 1947-10-05 01:00:00 (Sun)
61452525600, # local_end 1948-05-09 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61452538200, # utc_start 1948-05-09 05:30:00 (Sun)
61465235400, # utc_end 1948-10-03 04:30:00 (Sun)
61452529200, # local_start 1948-05-09 03:00:00 (Sun)
61465226400, # local_end 1948-10-03 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61465235400, # utc_start 1948-10-03 04:30:00 (Sun)
61483987800, # utc_end 1949-05-08 05:30:00 (Sun)
61465222800, # local_start 1948-10-03 01:00:00 (Sun)
61483975200, # local_end 1949-05-08 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61483987800, # utc_start 1949-05-08 05:30:00 (Sun)
61496685000, # utc_end 1949-10-02 04:30:00 (Sun)
61483978800, # local_start 1949-05-08 03:00:00 (Sun)
61496676000, # local_end 1949-10-02 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61496685000, # utc_start 1949-10-02 04:30:00 (Sun)
61516042200, # utc_end 1950-05-14 05:30:00 (Sun)
61496672400, # local_start 1949-10-02 01:00:00 (Sun)
61516029600, # local_end 1950-05-14 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61516042200, # utc_start 1950-05-14 05:30:00 (Sun)
61528739400, # utc_end 1950-10-08 04:30:00 (Sun)
61516033200, # local_start 1950-05-14 03:00:00 (Sun)
61528730400, # local_end 1950-10-08 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61528739400, # utc_start 1950-10-08 04:30:00 (Sun)
61546282200, # utc_end 1951-04-29 05:30:00 (Sun)
61528726800, # local_start 1950-10-08 01:00:00 (Sun)
61546269600, # local_end 1951-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61546282200, # utc_start 1951-04-29 05:30:00 (Sun)
61559584200, # utc_end 1951-09-30 04:30:00 (Sun)
61546273200, # local_start 1951-04-29 03:00:00 (Sun)
61559575200, # local_end 1951-09-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61559584200, # utc_start 1951-09-30 04:30:00 (Sun)
61577731800, # utc_end 1952-04-27 05:30:00 (Sun)
61559571600, # local_start 1951-09-30 01:00:00 (Sun)
61577719200, # local_end 1952-04-27 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61577731800, # utc_start 1952-04-27 05:30:00 (Sun)
61591033800, # utc_end 1952-09-28 04:30:00 (Sun)
61577722800, # local_start 1952-04-27 03:00:00 (Sun)
61591024800, # local_end 1952-09-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61591033800, # utc_start 1952-09-28 04:30:00 (Sun)
61609181400, # utc_end 1953-04-26 05:30:00 (Sun)
61591021200, # local_start 1952-09-28 01:00:00 (Sun)
61609168800, # local_end 1953-04-26 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61609181400, # utc_start 1953-04-26 05:30:00 (Sun)
61622483400, # utc_end 1953-09-27 04:30:00 (Sun)
61609172400, # local_start 1953-04-26 03:00:00 (Sun)
61622474400, # local_end 1953-09-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61622483400, # utc_start 1953-09-27 04:30:00 (Sun)
61640631000, # utc_end 1954-04-25 05:30:00 (Sun)
61622470800, # local_start 1953-09-27 01:00:00 (Sun)
61640618400, # local_end 1954-04-25 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61640631000, # utc_start 1954-04-25 05:30:00 (Sun)
61653933000, # utc_end 1954-09-26 04:30:00 (Sun)
61640622000, # local_start 1954-04-25 03:00:00 (Sun)
61653924000, # local_end 1954-09-26 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61653933000, # utc_start 1954-09-26 04:30:00 (Sun)
61672080600, # utc_end 1955-04-24 05:30:00 (Sun)
61653920400, # local_start 1954-09-26 01:00:00 (Sun)
61672068000, # local_end 1955-04-24 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61672080600, # utc_start 1955-04-24 05:30:00 (Sun)
61685382600, # utc_end 1955-09-25 04:30:00 (Sun)
61672071600, # local_start 1955-04-24 03:00:00 (Sun)
61685373600, # local_end 1955-09-25 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61685382600, # utc_start 1955-09-25 04:30:00 (Sun)
61704135000, # utc_end 1956-04-29 05:30:00 (Sun)
61685370000, # local_start 1955-09-25 01:00:00 (Sun)
61704122400, # local_end 1956-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61704135000, # utc_start 1956-04-29 05:30:00 (Sun)
61717437000, # utc_end 1956-09-30 04:30:00 (Sun)
61704126000, # local_start 1956-04-29 03:00:00 (Sun)
61717428000, # local_end 1956-09-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61717437000, # utc_start 1956-09-30 04:30:00 (Sun)
61735584600, # utc_end 1957-04-28 05:30:00 (Sun)
61717424400, # local_start 1956-09-30 01:00:00 (Sun)
61735572000, # local_end 1957-04-28 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61735584600, # utc_start 1957-04-28 05:30:00 (Sun)
61748886600, # utc_end 1957-09-29 04:30:00 (Sun)
61735575600, # local_start 1957-04-28 03:00:00 (Sun)
61748877600, # local_end 1957-09-29 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61748886600, # utc_start 1957-09-29 04:30:00 (Sun)
61767034200, # utc_end 1958-04-27 05:30:00 (Sun)
61748874000, # local_start 1957-09-29 01:00:00 (Sun)
61767021600, # local_end 1958-04-27 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61767034200, # utc_start 1958-04-27 05:30:00 (Sun)
61780336200, # utc_end 1958-09-28 04:30:00 (Sun)
61767025200, # local_start 1958-04-27 03:00:00 (Sun)
61780327200, # local_end 1958-09-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61780336200, # utc_start 1958-09-28 04:30:00 (Sun)
61798483800, # utc_end 1959-04-26 05:30:00 (Sun)
61780323600, # local_start 1958-09-28 01:00:00 (Sun)
61798471200, # local_end 1959-04-26 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61798483800, # utc_start 1959-04-26 05:30:00 (Sun)
61811785800, # utc_end 1959-09-27 04:30:00 (Sun)
61798474800, # local_start 1959-04-26 03:00:00 (Sun)
61811776800, # local_end 1959-09-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61811785800, # utc_start 1959-09-27 04:30:00 (Sun)
61829933400, # utc_end 1960-04-24 05:30:00 (Sun)
61811773200, # local_start 1959-09-27 01:00:00 (Sun)
61829920800, # local_end 1960-04-24 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61829933400, # utc_start 1960-04-24 05:30:00 (Sun)
61846259400, # utc_end 1960-10-30 04:30:00 (Sun)
61829924400, # local_start 1960-04-24 03:00:00 (Sun)
61846250400, # local_end 1960-10-30 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61846259400, # utc_start 1960-10-30 04:30:00 (Sun)
61861987800, # utc_end 1961-04-30 05:30:00 (Sun)
61846246800, # local_start 1960-10-30 01:00:00 (Sun)
61861975200, # local_end 1961-04-30 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61861987800, # utc_start 1961-04-30 05:30:00 (Sun)
61877709000, # utc_end 1961-10-29 04:30:00 (Sun)
61861978800, # local_start 1961-04-30 03:00:00 (Sun)
61877700000, # local_end 1961-10-29 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61877709000, # utc_start 1961-10-29 04:30:00 (Sun)
61893437400, # utc_end 1962-04-29 05:30:00 (Sun)
61877696400, # local_start 1961-10-29 01:00:00 (Sun)
61893424800, # local_end 1962-04-29 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61893437400, # utc_start 1962-04-29 05:30:00 (Sun)
61909158600, # utc_end 1962-10-28 04:30:00 (Sun)
61893428400, # local_start 1962-04-29 03:00:00 (Sun)
61909149600, # local_end 1962-10-28 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61909158600, # utc_start 1962-10-28 04:30:00 (Sun)
61924887000, # utc_end 1963-04-28 05:30:00 (Sun)
61909146000, # local_start 1962-10-28 01:00:00 (Sun)
61924874400, # local_end 1963-04-28 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61924887000, # utc_start 1963-04-28 05:30:00 (Sun)
61940608200, # utc_end 1963-10-27 04:30:00 (Sun)
61924878000, # local_start 1963-04-28 03:00:00 (Sun)
61940599200, # local_end 1963-10-27 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61940608200, # utc_start 1963-10-27 04:30:00 (Sun)
61956336600, # utc_end 1964-04-26 05:30:00 (Sun)
61940595600, # local_start 1963-10-27 01:00:00 (Sun)
61956324000, # local_end 1964-04-26 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61956336600, # utc_start 1964-04-26 05:30:00 (Sun)
61972057800, # utc_end 1964-10-25 04:30:00 (Sun)
61956327600, # local_start 1964-04-26 03:00:00 (Sun)
61972048800, # local_end 1964-10-25 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
61972057800, # utc_start 1964-10-25 04:30:00 (Sun)
61987786200, # utc_end 1965-04-25 05:30:00 (Sun)
61972045200, # local_start 1964-10-25 01:00:00 (Sun)
61987773600, # local_end 1965-04-25 02:00:00 (Sun)
-12600,
0,
'NST',
],
[
61987786200, # utc_start 1965-04-25 05:30:00 (Sun)
62004112200, # utc_end 1965-10-31 04:30:00 (Sun)
61987777200, # local_start 1965-04-25 03:00:00 (Sun)
62004103200, # local_end 1965-10-31 02:00:00 (Sun)
-9000,
1,
'NDT',
],
[
62004112200, # utc_start 1965-10-31 04:30:00 (Sun)
62015779800, # utc_end 1966-03-15 05:30:00 (Tue)
62004099600, # local_start 1965-10-31 01:00:00 (Sun)
62015767200, # local_end 1966-03-15 02:00:00 (Tue)
-12600,
0,
'NST',
],
[
62015779800, # utc_start 1966-03-15 05:30:00 (Tue)
62019237600, # utc_end 1966-04-24 06:00:00 (Sun)
62015765400, # local_start 1966-03-15 01:30:00 (Tue)
62019223200, # local_end 1966-04-24 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62019237600, # utc_start 1966-04-24 06:00:00 (Sun)
62035563600, # utc_end 1966-10-30 05:00:00 (Sun)
62019226800, # local_start 1966-04-24 03:00:00 (Sun)
62035552800, # local_end 1966-10-30 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62035563600, # utc_start 1966-10-30 05:00:00 (Sun)
62051292000, # utc_end 1967-04-30 06:00:00 (Sun)
62035549200, # local_start 1966-10-30 01:00:00 (Sun)
62051277600, # local_end 1967-04-30 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62051292000, # utc_start 1967-04-30 06:00:00 (Sun)
62067013200, # utc_end 1967-10-29 05:00:00 (Sun)
62051281200, # local_start 1967-04-30 03:00:00 (Sun)
62067002400, # local_end 1967-10-29 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62067013200, # utc_start 1967-10-29 05:00:00 (Sun)
62082741600, # utc_end 1968-04-28 06:00:00 (Sun)
62066998800, # local_start 1967-10-29 01:00:00 (Sun)
62082727200, # local_end 1968-04-28 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62082741600, # utc_start 1968-04-28 06:00:00 (Sun)
62098462800, # utc_end 1968-10-27 05:00:00 (Sun)
62082730800, # local_start 1968-04-28 03:00:00 (Sun)
62098452000, # local_end 1968-10-27 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62098462800, # utc_start 1968-10-27 05:00:00 (Sun)
62114191200, # utc_end 1969-04-27 06:00:00 (Sun)
62098448400, # local_start 1968-10-27 01:00:00 (Sun)
62114176800, # local_end 1969-04-27 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62114191200, # utc_start 1969-04-27 06:00:00 (Sun)
62129912400, # utc_end 1969-10-26 05:00:00 (Sun)
62114180400, # local_start 1969-04-27 03:00:00 (Sun)
62129901600, # local_end 1969-10-26 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62129912400, # utc_start 1969-10-26 05:00:00 (Sun)
62145640800, # utc_end 1970-04-26 06:00:00 (Sun)
62129898000, # local_start 1969-10-26 01:00:00 (Sun)
62145626400, # local_end 1970-04-26 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62145640800, # utc_start 1970-04-26 06:00:00 (Sun)
62161362000, # utc_end 1970-10-25 05:00:00 (Sun)
62145630000, # local_start 1970-04-26 03:00:00 (Sun)
62161351200, # local_end 1970-10-25 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62161362000, # utc_start 1970-10-25 05:00:00 (Sun)
62177090400, # utc_end 1971-04-25 06:00:00 (Sun)
62161347600, # local_start 1970-10-25 01:00:00 (Sun)
62177076000, # local_end 1971-04-25 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62177090400, # utc_start 1971-04-25 06:00:00 (Sun)
62193416400, # utc_end 1971-10-31 05:00:00 (Sun)
62177079600, # local_start 1971-04-25 03:00:00 (Sun)
62193405600, # local_end 1971-10-31 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62193416400, # utc_start 1971-10-31 05:00:00 (Sun)
62209144800, # utc_end 1972-04-30 06:00:00 (Sun)
62193402000, # local_start 1971-10-31 01:00:00 (Sun)
62209130400, # local_end 1972-04-30 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62209144800, # utc_start 1972-04-30 06:00:00 (Sun)
62224866000, # utc_end 1972-10-29 05:00:00 (Sun)
62209134000, # local_start 1972-04-30 03:00:00 (Sun)
62224855200, # local_end 1972-10-29 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62224866000, # utc_start 1972-10-29 05:00:00 (Sun)
62240594400, # utc_end 1973-04-29 06:00:00 (Sun)
62224851600, # local_start 1972-10-29 01:00:00 (Sun)
62240580000, # local_end 1973-04-29 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62240594400, # utc_start 1973-04-29 06:00:00 (Sun)
62256315600, # utc_end 1973-10-28 05:00:00 (Sun)
62240583600, # local_start 1973-04-29 03:00:00 (Sun)
62256304800, # local_end 1973-10-28 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62256315600, # utc_start 1973-10-28 05:00:00 (Sun)
62272044000, # utc_end 1974-04-28 06:00:00 (Sun)
62256301200, # local_start 1973-10-28 01:00:00 (Sun)
62272029600, # local_end 1974-04-28 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62272044000, # utc_start 1974-04-28 06:00:00 (Sun)
62287765200, # utc_end 1974-10-27 05:00:00 (Sun)
62272033200, # local_start 1974-04-28 03:00:00 (Sun)
62287754400, # local_end 1974-10-27 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62287765200, # utc_start 1974-10-27 05:00:00 (Sun)
62303493600, # utc_end 1975-04-27 06:00:00 (Sun)
62287750800, # local_start 1974-10-27 01:00:00 (Sun)
62303479200, # local_end 1975-04-27 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62303493600, # utc_start 1975-04-27 06:00:00 (Sun)
62319214800, # utc_end 1975-10-26 05:00:00 (Sun)
62303482800, # local_start 1975-04-27 03:00:00 (Sun)
62319204000, # local_end 1975-10-26 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62319214800, # utc_start 1975-10-26 05:00:00 (Sun)
62334943200, # utc_end 1976-04-25 06:00:00 (Sun)
62319200400, # local_start 1975-10-26 01:00:00 (Sun)
62334928800, # local_end 1976-04-25 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62334943200, # utc_start 1976-04-25 06:00:00 (Sun)
62351269200, # utc_end 1976-10-31 05:00:00 (Sun)
62334932400, # local_start 1976-04-25 03:00:00 (Sun)
62351258400, # local_end 1976-10-31 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62351269200, # utc_start 1976-10-31 05:00:00 (Sun)
62366392800, # utc_end 1977-04-24 06:00:00 (Sun)
62351254800, # local_start 1976-10-31 01:00:00 (Sun)
62366378400, # local_end 1977-04-24 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62366392800, # utc_start 1977-04-24 06:00:00 (Sun)
62382718800, # utc_end 1977-10-30 05:00:00 (Sun)
62366382000, # local_start 1977-04-24 03:00:00 (Sun)
62382708000, # local_end 1977-10-30 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62382718800, # utc_start 1977-10-30 05:00:00 (Sun)
62398447200, # utc_end 1978-04-30 06:00:00 (Sun)
62382704400, # local_start 1977-10-30 01:00:00 (Sun)
62398432800, # local_end 1978-04-30 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62398447200, # utc_start 1978-04-30 06:00:00 (Sun)
62414168400, # utc_end 1978-10-29 05:00:00 (Sun)
62398436400, # local_start 1978-04-30 03:00:00 (Sun)
62414157600, # local_end 1978-10-29 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62414168400, # utc_start 1978-10-29 05:00:00 (Sun)
62429896800, # utc_end 1979-04-29 06:00:00 (Sun)
62414154000, # local_start 1978-10-29 01:00:00 (Sun)
62429882400, # local_end 1979-04-29 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62429896800, # utc_start 1979-04-29 06:00:00 (Sun)
62445618000, # utc_end 1979-10-28 05:00:00 (Sun)
62429886000, # local_start 1979-04-29 03:00:00 (Sun)
62445607200, # local_end 1979-10-28 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62445618000, # utc_start 1979-10-28 05:00:00 (Sun)
62461346400, # utc_end 1980-04-27 06:00:00 (Sun)
62445603600, # local_start 1979-10-28 01:00:00 (Sun)
62461332000, # local_end 1980-04-27 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62461346400, # utc_start 1980-04-27 06:00:00 (Sun)
62477067600, # utc_end 1980-10-26 05:00:00 (Sun)
62461335600, # local_start 1980-04-27 03:00:00 (Sun)
62477056800, # local_end 1980-10-26 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62477067600, # utc_start 1980-10-26 05:00:00 (Sun)
62492796000, # utc_end 1981-04-26 06:00:00 (Sun)
62477053200, # local_start 1980-10-26 01:00:00 (Sun)
62492781600, # local_end 1981-04-26 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62492796000, # utc_start 1981-04-26 06:00:00 (Sun)
62508517200, # utc_end 1981-10-25 05:00:00 (Sun)
62492785200, # local_start 1981-04-26 03:00:00 (Sun)
62508506400, # local_end 1981-10-25 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62508517200, # utc_start 1981-10-25 05:00:00 (Sun)
62524245600, # utc_end 1982-04-25 06:00:00 (Sun)
62508502800, # local_start 1981-10-25 01:00:00 (Sun)
62524231200, # local_end 1982-04-25 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62524245600, # utc_start 1982-04-25 06:00:00 (Sun)
62540571600, # utc_end 1982-10-31 05:00:00 (Sun)
62524234800, # local_start 1982-04-25 03:00:00 (Sun)
62540560800, # local_end 1982-10-31 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62540571600, # utc_start 1982-10-31 05:00:00 (Sun)
62555695200, # utc_end 1983-04-24 06:00:00 (Sun)
62540557200, # local_start 1982-10-31 01:00:00 (Sun)
62555680800, # local_end 1983-04-24 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62555695200, # utc_start 1983-04-24 06:00:00 (Sun)
62572021200, # utc_end 1983-10-30 05:00:00 (Sun)
62555684400, # local_start 1983-04-24 03:00:00 (Sun)
62572010400, # local_end 1983-10-30 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62572021200, # utc_start 1983-10-30 05:00:00 (Sun)
62587749600, # utc_end 1984-04-29 06:00:00 (Sun)
62572006800, # local_start 1983-10-30 01:00:00 (Sun)
62587735200, # local_end 1984-04-29 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62587749600, # utc_start 1984-04-29 06:00:00 (Sun)
62603470800, # utc_end 1984-10-28 05:00:00 (Sun)
62587738800, # local_start 1984-04-29 03:00:00 (Sun)
62603460000, # local_end 1984-10-28 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62603470800, # utc_start 1984-10-28 05:00:00 (Sun)
62619199200, # utc_end 1985-04-28 06:00:00 (Sun)
62603456400, # local_start 1984-10-28 01:00:00 (Sun)
62619184800, # local_end 1985-04-28 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62619199200, # utc_start 1985-04-28 06:00:00 (Sun)
62634920400, # utc_end 1985-10-27 05:00:00 (Sun)
62619188400, # local_start 1985-04-28 03:00:00 (Sun)
62634909600, # local_end 1985-10-27 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62634920400, # utc_start 1985-10-27 05:00:00 (Sun)
62650648800, # utc_end 1986-04-27 06:00:00 (Sun)
62634906000, # local_start 1985-10-27 01:00:00 (Sun)
62650634400, # local_end 1986-04-27 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
62650648800, # utc_start 1986-04-27 06:00:00 (Sun)
62666370000, # utc_end 1986-10-26 05:00:00 (Sun)
62650638000, # local_start 1986-04-27 03:00:00 (Sun)
62666359200, # local_end 1986-10-26 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
62666370000, # utc_start 1986-10-26 05:00:00 (Sun)
62680276860, # utc_end 1987-04-05 04:01:00 (Sun)
62666355600, # local_start 1986-10-26 01:00:00 (Sun)
62680262460, # local_end 1987-04-05 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62680276860, # utc_start 1987-04-05 04:01:00 (Sun)
62697812460, # utc_end 1987-10-25 03:01:00 (Sun)
62680266060, # local_start 1987-04-05 01:01:00 (Sun)
62697801660, # local_end 1987-10-25 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62697812460, # utc_start 1987-10-25 03:01:00 (Sun)
62711726460, # utc_end 1988-04-03 04:01:00 (Sun)
62697798060, # local_start 1987-10-24 23:01:00 (Sat)
62711712060, # local_end 1988-04-03 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62711726460, # utc_start 1988-04-03 04:01:00 (Sun)
62729863260, # utc_end 1988-10-30 02:01:00 (Sun)
62711719260, # local_start 1988-04-03 02:01:00 (Sun)
62729856060, # local_end 1988-10-30 00:01:00 (Sun)
-7200,
1,
'ADDT',
],
[
62729863260, # utc_start 1988-10-30 02:01:00 (Sun)
62743176060, # utc_end 1989-04-02 04:01:00 (Sun)
62729848860, # local_start 1988-10-29 22:01:00 (Sat)
62743161660, # local_end 1989-04-02 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62743176060, # utc_start 1989-04-02 04:01:00 (Sun)
62761316460, # utc_end 1989-10-29 03:01:00 (Sun)
62743165260, # local_start 1989-04-02 01:01:00 (Sun)
62761305660, # local_end 1989-10-29 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62761316460, # utc_start 1989-10-29 03:01:00 (Sun)
62774625660, # utc_end 1990-04-01 04:01:00 (Sun)
62761302060, # local_start 1989-10-28 23:01:00 (Sat)
62774611260, # local_end 1990-04-01 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62774625660, # utc_start 1990-04-01 04:01:00 (Sun)
62792766060, # utc_end 1990-10-28 03:01:00 (Sun)
62774614860, # local_start 1990-04-01 01:01:00 (Sun)
62792755260, # local_end 1990-10-28 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62792766060, # utc_start 1990-10-28 03:01:00 (Sun)
62806680060, # utc_end 1991-04-07 04:01:00 (Sun)
62792751660, # local_start 1990-10-27 23:01:00 (Sat)
62806665660, # local_end 1991-04-07 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62806680060, # utc_start 1991-04-07 04:01:00 (Sun)
62824215660, # utc_end 1991-10-27 03:01:00 (Sun)
62806669260, # local_start 1991-04-07 01:01:00 (Sun)
62824204860, # local_end 1991-10-27 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62824215660, # utc_start 1991-10-27 03:01:00 (Sun)
62838129660, # utc_end 1992-04-05 04:01:00 (Sun)
62824201260, # local_start 1991-10-26 23:01:00 (Sat)
62838115260, # local_end 1992-04-05 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62838129660, # utc_start 1992-04-05 04:01:00 (Sun)
62855665260, # utc_end 1992-10-25 03:01:00 (Sun)
62838118860, # local_start 1992-04-05 01:01:00 (Sun)
62855654460, # local_end 1992-10-25 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62855665260, # utc_start 1992-10-25 03:01:00 (Sun)
62869579260, # utc_end 1993-04-04 04:01:00 (Sun)
62855650860, # local_start 1992-10-24 23:01:00 (Sat)
62869564860, # local_end 1993-04-04 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62869579260, # utc_start 1993-04-04 04:01:00 (Sun)
62887719660, # utc_end 1993-10-31 03:01:00 (Sun)
62869568460, # local_start 1993-04-04 01:01:00 (Sun)
62887708860, # local_end 1993-10-31 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62887719660, # utc_start 1993-10-31 03:01:00 (Sun)
62901028860, # utc_end 1994-04-03 04:01:00 (Sun)
62887705260, # local_start 1993-10-30 23:01:00 (Sat)
62901014460, # local_end 1994-04-03 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62901028860, # utc_start 1994-04-03 04:01:00 (Sun)
62919169260, # utc_end 1994-10-30 03:01:00 (Sun)
62901018060, # local_start 1994-04-03 01:01:00 (Sun)
62919158460, # local_end 1994-10-30 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62919169260, # utc_start 1994-10-30 03:01:00 (Sun)
62932478460, # utc_end 1995-04-02 04:01:00 (Sun)
62919154860, # local_start 1994-10-29 23:01:00 (Sat)
62932464060, # local_end 1995-04-02 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62932478460, # utc_start 1995-04-02 04:01:00 (Sun)
62950618860, # utc_end 1995-10-29 03:01:00 (Sun)
62932467660, # local_start 1995-04-02 01:01:00 (Sun)
62950608060, # local_end 1995-10-29 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62950618860, # utc_start 1995-10-29 03:01:00 (Sun)
62964532860, # utc_end 1996-04-07 04:01:00 (Sun)
62950604460, # local_start 1995-10-28 23:01:00 (Sat)
62964518460, # local_end 1996-04-07 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62964532860, # utc_start 1996-04-07 04:01:00 (Sun)
62982068460, # utc_end 1996-10-27 03:01:00 (Sun)
62964522060, # local_start 1996-04-07 01:01:00 (Sun)
62982057660, # local_end 1996-10-27 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
62982068460, # utc_start 1996-10-27 03:01:00 (Sun)
62995982460, # utc_end 1997-04-06 04:01:00 (Sun)
62982054060, # local_start 1996-10-26 23:01:00 (Sat)
62995968060, # local_end 1997-04-06 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
62995982460, # utc_start 1997-04-06 04:01:00 (Sun)
63013518060, # utc_end 1997-10-26 03:01:00 (Sun)
62995971660, # local_start 1997-04-06 01:01:00 (Sun)
63013507260, # local_end 1997-10-26 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63013518060, # utc_start 1997-10-26 03:01:00 (Sun)
63027432060, # utc_end 1998-04-05 04:01:00 (Sun)
63013503660, # local_start 1997-10-25 23:01:00 (Sat)
63027417660, # local_end 1998-04-05 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63027432060, # utc_start 1998-04-05 04:01:00 (Sun)
63044967660, # utc_end 1998-10-25 03:01:00 (Sun)
63027421260, # local_start 1998-04-05 01:01:00 (Sun)
63044956860, # local_end 1998-10-25 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63044967660, # utc_start 1998-10-25 03:01:00 (Sun)
63058881660, # utc_end 1999-04-04 04:01:00 (Sun)
63044953260, # local_start 1998-10-24 23:01:00 (Sat)
63058867260, # local_end 1999-04-04 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63058881660, # utc_start 1999-04-04 04:01:00 (Sun)
63077022060, # utc_end 1999-10-31 03:01:00 (Sun)
63058870860, # local_start 1999-04-04 01:01:00 (Sun)
63077011260, # local_end 1999-10-31 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63077022060, # utc_start 1999-10-31 03:01:00 (Sun)
63090331260, # utc_end 2000-04-02 04:01:00 (Sun)
63077007660, # local_start 1999-10-30 23:01:00 (Sat)
63090316860, # local_end 2000-04-02 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63090331260, # utc_start 2000-04-02 04:01:00 (Sun)
63108471660, # utc_end 2000-10-29 03:01:00 (Sun)
63090320460, # local_start 2000-04-02 01:01:00 (Sun)
63108460860, # local_end 2000-10-29 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63108471660, # utc_start 2000-10-29 03:01:00 (Sun)
63121780860, # utc_end 2001-04-01 04:01:00 (Sun)
63108457260, # local_start 2000-10-28 23:01:00 (Sat)
63121766460, # local_end 2001-04-01 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63121780860, # utc_start 2001-04-01 04:01:00 (Sun)
63139921260, # utc_end 2001-10-28 03:01:00 (Sun)
63121770060, # local_start 2001-04-01 01:01:00 (Sun)
63139910460, # local_end 2001-10-28 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63139921260, # utc_start 2001-10-28 03:01:00 (Sun)
63153835260, # utc_end 2002-04-07 04:01:00 (Sun)
63139906860, # local_start 2001-10-27 23:01:00 (Sat)
63153820860, # local_end 2002-04-07 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63153835260, # utc_start 2002-04-07 04:01:00 (Sun)
63171370860, # utc_end 2002-10-27 03:01:00 (Sun)
63153824460, # local_start 2002-04-07 01:01:00 (Sun)
63171360060, # local_end 2002-10-27 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63171370860, # utc_start 2002-10-27 03:01:00 (Sun)
63185284860, # utc_end 2003-04-06 04:01:00 (Sun)
63171356460, # local_start 2002-10-26 23:01:00 (Sat)
63185270460, # local_end 2003-04-06 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63185284860, # utc_start 2003-04-06 04:01:00 (Sun)
63202820460, # utc_end 2003-10-26 03:01:00 (Sun)
63185274060, # local_start 2003-04-06 01:01:00 (Sun)
63202809660, # local_end 2003-10-26 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63202820460, # utc_start 2003-10-26 03:01:00 (Sun)
63216734460, # utc_end 2004-04-04 04:01:00 (Sun)
63202806060, # local_start 2003-10-25 23:01:00 (Sat)
63216720060, # local_end 2004-04-04 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63216734460, # utc_start 2004-04-04 04:01:00 (Sun)
63234874860, # utc_end 2004-10-31 03:01:00 (Sun)
63216723660, # local_start 2004-04-04 01:01:00 (Sun)
63234864060, # local_end 2004-10-31 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63234874860, # utc_start 2004-10-31 03:01:00 (Sun)
63248184060, # utc_end 2005-04-03 04:01:00 (Sun)
63234860460, # local_start 2004-10-30 23:01:00 (Sat)
63248169660, # local_end 2005-04-03 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63248184060, # utc_start 2005-04-03 04:01:00 (Sun)
63266324460, # utc_end 2005-10-30 03:01:00 (Sun)
63248173260, # local_start 2005-04-03 01:01:00 (Sun)
63266313660, # local_end 2005-10-30 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63266324460, # utc_start 2005-10-30 03:01:00 (Sun)
63279633660, # utc_end 2006-04-02 04:01:00 (Sun)
63266310060, # local_start 2005-10-29 23:01:00 (Sat)
63279619260, # local_end 2006-04-02 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63279633660, # utc_start 2006-04-02 04:01:00 (Sun)
63297774060, # utc_end 2006-10-29 03:01:00 (Sun)
63279622860, # local_start 2006-04-02 01:01:00 (Sun)
63297763260, # local_end 2006-10-29 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63297774060, # utc_start 2006-10-29 03:01:00 (Sun)
63309268860, # utc_end 2007-03-11 04:01:00 (Sun)
63297759660, # local_start 2006-10-28 23:01:00 (Sat)
63309254460, # local_end 2007-03-11 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63309268860, # utc_start 2007-03-11 04:01:00 (Sun)
63329828460, # utc_end 2007-11-04 03:01:00 (Sun)
63309258060, # local_start 2007-03-11 01:01:00 (Sun)
63329817660, # local_end 2007-11-04 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63329828460, # utc_start 2007-11-04 03:01:00 (Sun)
63340718460, # utc_end 2008-03-09 04:01:00 (Sun)
63329814060, # local_start 2007-11-03 23:01:00 (Sat)
63340704060, # local_end 2008-03-09 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63340718460, # utc_start 2008-03-09 04:01:00 (Sun)
63361278060, # utc_end 2008-11-02 03:01:00 (Sun)
63340707660, # local_start 2008-03-09 01:01:00 (Sun)
63361267260, # local_end 2008-11-02 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63361278060, # utc_start 2008-11-02 03:01:00 (Sun)
63372168060, # utc_end 2009-03-08 04:01:00 (Sun)
63361263660, # local_start 2008-11-01 23:01:00 (Sat)
63372153660, # local_end 2009-03-08 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63372168060, # utc_start 2009-03-08 04:01:00 (Sun)
63392727660, # utc_end 2009-11-01 03:01:00 (Sun)
63372157260, # local_start 2009-03-08 01:01:00 (Sun)
63392716860, # local_end 2009-11-01 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63392727660, # utc_start 2009-11-01 03:01:00 (Sun)
63404222460, # utc_end 2010-03-14 04:01:00 (Sun)
63392713260, # local_start 2009-10-31 23:01:00 (Sat)
63404208060, # local_end 2010-03-14 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63404222460, # utc_start 2010-03-14 04:01:00 (Sun)
63424782060, # utc_end 2010-11-07 03:01:00 (Sun)
63404211660, # local_start 2010-03-14 01:01:00 (Sun)
63424771260, # local_end 2010-11-07 00:01:00 (Sun)
-10800,
1,
'ADT',
],
[
63424782060, # utc_start 2010-11-07 03:01:00 (Sun)
63435672060, # utc_end 2011-03-13 04:01:00 (Sun)
63424767660, # local_start 2010-11-06 23:01:00 (Sat)
63435657660, # local_end 2011-03-13 00:01:00 (Sun)
-14400,
0,
'AST',
],
[
63435672060, # utc_start 2011-03-13 04:01:00 (Sun)
63455799600, # utc_end 2011-11-01 03:00:00 (Tue)
63435661260, # local_start 2011-03-13 01:01:00 (Sun)
63455788800, # local_end 2011-11-01 00:00:00 (Tue)
-10800,
1,
'ADT',
],
[
63455799600, # utc_start 2011-11-01 03:00:00 (Tue)
63456238800, # utc_end 2011-11-06 05:00:00 (Sun)
63455788800, # local_start 2011-11-01 00:00:00 (Tue)
63456228000, # local_end 2011-11-06 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63456238800, # utc_start 2011-11-06 05:00:00 (Sun)
63467128800, # utc_end 2012-03-11 06:00:00 (Sun)
63456224400, # local_start 2011-11-06 01:00:00 (Sun)
63467114400, # local_end 2012-03-11 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63467128800, # utc_start 2012-03-11 06:00:00 (Sun)
63487688400, # utc_end 2012-11-04 05:00:00 (Sun)
63467118000, # local_start 2012-03-11 03:00:00 (Sun)
63487677600, # local_end 2012-11-04 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63487688400, # utc_start 2012-11-04 05:00:00 (Sun)
63498578400, # utc_end 2013-03-10 06:00:00 (Sun)
63487674000, # local_start 2012-11-04 01:00:00 (Sun)
63498564000, # local_end 2013-03-10 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63498578400, # utc_start 2013-03-10 06:00:00 (Sun)
63519138000, # utc_end 2013-11-03 05:00:00 (Sun)
63498567600, # local_start 2013-03-10 03:00:00 (Sun)
63519127200, # local_end 2013-11-03 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63519138000, # utc_start 2013-11-03 05:00:00 (Sun)
63530028000, # utc_end 2014-03-09 06:00:00 (Sun)
63519123600, # local_start 2013-11-03 01:00:00 (Sun)
63530013600, # local_end 2014-03-09 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63530028000, # utc_start 2014-03-09 06:00:00 (Sun)
63550587600, # utc_end 2014-11-02 05:00:00 (Sun)
63530017200, # local_start 2014-03-09 03:00:00 (Sun)
63550576800, # local_end 2014-11-02 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63550587600, # utc_start 2014-11-02 05:00:00 (Sun)
63561477600, # utc_end 2015-03-08 06:00:00 (Sun)
63550573200, # local_start 2014-11-02 01:00:00 (Sun)
63561463200, # local_end 2015-03-08 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63561477600, # utc_start 2015-03-08 06:00:00 (Sun)
63582037200, # utc_end 2015-11-01 05:00:00 (Sun)
63561466800, # local_start 2015-03-08 03:00:00 (Sun)
63582026400, # local_end 2015-11-01 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63582037200, # utc_start 2015-11-01 05:00:00 (Sun)
63593532000, # utc_end 2016-03-13 06:00:00 (Sun)
63582022800, # local_start 2015-11-01 01:00:00 (Sun)
63593517600, # local_end 2016-03-13 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63593532000, # utc_start 2016-03-13 06:00:00 (Sun)
63614091600, # utc_end 2016-11-06 05:00:00 (Sun)
63593521200, # local_start 2016-03-13 03:00:00 (Sun)
63614080800, # local_end 2016-11-06 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63614091600, # utc_start 2016-11-06 05:00:00 (Sun)
63624981600, # utc_end 2017-03-12 06:00:00 (Sun)
63614077200, # local_start 2016-11-06 01:00:00 (Sun)
63624967200, # local_end 2017-03-12 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63624981600, # utc_start 2017-03-12 06:00:00 (Sun)
63645541200, # utc_end 2017-11-05 05:00:00 (Sun)
63624970800, # local_start 2017-03-12 03:00:00 (Sun)
63645530400, # local_end 2017-11-05 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63645541200, # utc_start 2017-11-05 05:00:00 (Sun)
63656431200, # utc_end 2018-03-11 06:00:00 (Sun)
63645526800, # local_start 2017-11-05 01:00:00 (Sun)
63656416800, # local_end 2018-03-11 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63656431200, # utc_start 2018-03-11 06:00:00 (Sun)
63676990800, # utc_end 2018-11-04 05:00:00 (Sun)
63656420400, # local_start 2018-03-11 03:00:00 (Sun)
63676980000, # local_end 2018-11-04 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63676990800, # utc_start 2018-11-04 05:00:00 (Sun)
63687880800, # utc_end 2019-03-10 06:00:00 (Sun)
63676976400, # local_start 2018-11-04 01:00:00 (Sun)
63687866400, # local_end 2019-03-10 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63687880800, # utc_start 2019-03-10 06:00:00 (Sun)
63708440400, # utc_end 2019-11-03 05:00:00 (Sun)
63687870000, # local_start 2019-03-10 03:00:00 (Sun)
63708429600, # local_end 2019-11-03 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63708440400, # utc_start 2019-11-03 05:00:00 (Sun)
63719330400, # utc_end 2020-03-08 06:00:00 (Sun)
63708426000, # local_start 2019-11-03 01:00:00 (Sun)
63719316000, # local_end 2020-03-08 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63719330400, # utc_start 2020-03-08 06:00:00 (Sun)
63739890000, # utc_end 2020-11-01 05:00:00 (Sun)
63719319600, # local_start 2020-03-08 03:00:00 (Sun)
63739879200, # local_end 2020-11-01 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63739890000, # utc_start 2020-11-01 05:00:00 (Sun)
63751384800, # utc_end 2021-03-14 06:00:00 (Sun)
63739875600, # local_start 2020-11-01 01:00:00 (Sun)
63751370400, # local_end 2021-03-14 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63751384800, # utc_start 2021-03-14 06:00:00 (Sun)
63771944400, # utc_end 2021-11-07 05:00:00 (Sun)
63751374000, # local_start 2021-03-14 03:00:00 (Sun)
63771933600, # local_end 2021-11-07 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63771944400, # utc_start 2021-11-07 05:00:00 (Sun)
63782834400, # utc_end 2022-03-13 06:00:00 (Sun)
63771930000, # local_start 2021-11-07 01:00:00 (Sun)
63782820000, # local_end 2022-03-13 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63782834400, # utc_start 2022-03-13 06:00:00 (Sun)
63803394000, # utc_end 2022-11-06 05:00:00 (Sun)
63782823600, # local_start 2022-03-13 03:00:00 (Sun)
63803383200, # local_end 2022-11-06 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63803394000, # utc_start 2022-11-06 05:00:00 (Sun)
63814284000, # utc_end 2023-03-12 06:00:00 (Sun)
63803379600, # local_start 2022-11-06 01:00:00 (Sun)
63814269600, # local_end 2023-03-12 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63814284000, # utc_start 2023-03-12 06:00:00 (Sun)
63834843600, # utc_end 2023-11-05 05:00:00 (Sun)
63814273200, # local_start 2023-03-12 03:00:00 (Sun)
63834832800, # local_end 2023-11-05 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63834843600, # utc_start 2023-11-05 05:00:00 (Sun)
63845733600, # utc_end 2024-03-10 06:00:00 (Sun)
63834829200, # local_start 2023-11-05 01:00:00 (Sun)
63845719200, # local_end 2024-03-10 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63845733600, # utc_start 2024-03-10 06:00:00 (Sun)
63866293200, # utc_end 2024-11-03 05:00:00 (Sun)
63845722800, # local_start 2024-03-10 03:00:00 (Sun)
63866282400, # local_end 2024-11-03 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63866293200, # utc_start 2024-11-03 05:00:00 (Sun)
63877183200, # utc_end 2025-03-09 06:00:00 (Sun)
63866278800, # local_start 2024-11-03 01:00:00 (Sun)
63877168800, # local_end 2025-03-09 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63877183200, # utc_start 2025-03-09 06:00:00 (Sun)
63897742800, # utc_end 2025-11-02 05:00:00 (Sun)
63877172400, # local_start 2025-03-09 03:00:00 (Sun)
63897732000, # local_end 2025-11-02 02:00:00 (Sun)
-10800,
1,
'ADT',
],
[
63897742800, # utc_start 2025-11-02 05:00:00 (Sun)
63908632800, # utc_end 2026-03-08 06:00:00 (Sun)
63897728400, # local_start 2025-11-02 01:00:00 (Sun)
63908618400, # local_end 2026-03-08 02:00:00 (Sun)
-14400,
0,
'AST',
],
[
63908632800, # utc_start 2026-03-08 06:00:00 (Sun)
63929192400, # utc_end 2026-11-01 05:00:00 (Sun)
63908622000, # local_start 2026-03-08 03:00:00 (Sun)
63929181600, # local_end 2026-11-01 02:00:00 (Sun)
-10800,
1,
'ADT',
],
];
sub olson_version {'2015e'}
sub has_dst_changes {91}
sub _max_year {2025}
sub _new_instance {
return shift->_init( @_, spans => $spans );
}
sub _last_offset { -14400 }
my $last_observance = bless( {
'format' => 'A%sT',
'gmtoff' => '-4:00',
'local_start_datetime' => bless( {
'formatter' => undef,
'local_rd_days' => 734442,
'local_rd_secs' => 0,
'offset_modifier' => 0,
'rd_nanosecs' => 0,
'tz' => bless( {
'name' => 'floating',
'offset' => 0
}, 'DateTime::TimeZone::Floating' ),
'utc_rd_days' => 734442,
'utc_rd_secs' => 0,
'utc_year' => 2012
}, 'DateTime' ),
'offset_from_std' => 0,
'offset_from_utc' => -14400,
'until' => [],
'utc_start_datetime' => bless( {
'formatter' => undef,
'local_rd_days' => 734442,
'local_rd_secs' => 10800,
'offset_modifier' => 0,
'rd_nanosecs' => 0,
'tz' => bless( {
'name' => 'floating',
'offset' => 0
}, 'DateTime::TimeZone::Floating' ),
'utc_rd_days' => 734442,
'utc_rd_secs' => 10800,
'utc_year' => 2012
}, 'DateTime' )
}, 'DateTime::TimeZone::OlsonDB::Observance' )
;
sub _last_observance { $last_observance }
my $rules = [
bless( {
'at' => '2:00',
'from' => '2007',
'in' => 'Mar',
'letter' => 'D',
'name' => 'Canada',
'offset_from_std' => 3600,
'on' => 'Sun>=8',
'save' => '1:00',
'to' => 'max',
'type' => undef
}, 'DateTime::TimeZone::OlsonDB::Rule' ),
bless( {
'at' => '2:00',
'from' => '2007',
'in' => 'Nov',
'letter' => 'S',
'name' => 'Canada',
'offset_from_std' => 0,
'on' => 'Sun>=1',
'save' => '0',
'to' => 'max',
'type' => undef
}, 'DateTime::TimeZone::OlsonDB::Rule' )
]
;
sub _rules { $rules }
1;
| 27.131917 | 92 | 0.632625 |
73ed9885262899acf6bfe6324c965ca9ac6afac6 | 54,506 | pl | Perl | crypto/aes/asm/aes-mips.pl | blekke/openssl | 0e43960e88128bb86031a45c0fe9ca3e3a310c3b | [
"Apache-2.0"
]
| 5 | 2020-12-18T08:17:22.000Z | 2021-08-07T09:56:35.000Z | crypto/aes/asm/aes-mips.pl | blekke/openssl | 0e43960e88128bb86031a45c0fe9ca3e3a310c3b | [
"Apache-2.0"
]
| 4 | 2017-12-11T11:40:36.000Z | 2021-03-04T11:24:25.000Z | crypto/aes/asm/aes-mips.pl | blekke/openssl | 0e43960e88128bb86031a45c0fe9ca3e3a310c3b | [
"Apache-2.0"
]
| 4 | 2019-12-27T05:22:26.000Z | 2022-01-10T11:26:03.000Z | #! /usr/bin/env perl
# Copyright 2010-2019 The OpenSSL Project Authors. All Rights Reserved.
#
# Licensed under the Apache License 2.0 (the "License"). You may not use
# this file except in compliance with the License. You can obtain a copy
# in the file LICENSE in the source distribution or at
# https://www.openssl.org/source/license.html
# ====================================================================
# Written by Andy Polyakov <appro@openssl.org> for the OpenSSL
# project. The module is, however, dual licensed under OpenSSL and
# CRYPTOGAMS licenses depending on where you obtain it. For further
# details see http://www.openssl.org/~appro/cryptogams/.
# ====================================================================
# AES for MIPS
# October 2010
#
# Code uses 1K[+256B] S-box and on single-issue core [such as R5000]
# spends ~68 cycles per byte processed with 128-bit key. This is ~16%
# faster than gcc-generated code, which is not very impressive. But
# recall that compressed S-box requires extra processing, namely
# additional rotations. Rotations are implemented with lwl/lwr pairs,
# which is normally used for loading unaligned data. Another cool
# thing about this module is its endian neutrality, which means that
# it processes data without ever changing byte order...
# September 2012
#
# Add MIPS32R2 (~10% less instructions) and SmartMIPS ASE (further
# ~25% less instructions) code. Note that there is no run-time switch,
# instead, code path is chosen upon pre-process time, pass -mips32r2
# or/and -msmartmips.
# February 2019
#
# Normalize MIPS32R2 AES table address calculation by always using EXT
# instruction. This reduces the standard codebase by another 10%.
######################################################################
# There is a number of MIPS ABI in use, O32 and N32/64 are most
# widely used. Then there is a new contender: NUBI. It appears that if
# one picks the latter, it's possible to arrange code in ABI neutral
# manner. Therefore let's stick to NUBI register layout:
#
($zero,$at,$t0,$t1,$t2)=map("\$$_",(0..2,24,25));
($a0,$a1,$a2,$a3,$a4,$a5,$a6,$a7)=map("\$$_",(4..11));
($s0,$s1,$s2,$s3,$s4,$s5,$s6,$s7,$s8,$s9,$s10,$s11)=map("\$$_",(12..23));
($gp,$tp,$sp,$fp,$ra)=map("\$$_",(3,28..31));
#
# The return value is placed in $a0. Following coding rules facilitate
# interoperability:
#
# - never ever touch $tp, "thread pointer", former $gp;
# - copy return value to $t0, former $v0 [or to $a0 if you're adapting
# old code];
# - on O32 populate $a4-$a7 with 'lw $aN,4*N($sp)' if necessary;
#
# For reference here is register layout for N32/64 MIPS ABIs:
#
# ($zero,$at,$v0,$v1)=map("\$$_",(0..3));
# ($a0,$a1,$a2,$a3,$a4,$a5,$a6,$a7)=map("\$$_",(4..11));
# ($t0,$t1,$t2,$t3,$t8,$t9)=map("\$$_",(12..15,24,25));
# ($s0,$s1,$s2,$s3,$s4,$s5,$s6,$s7)=map("\$$_",(16..23));
# ($gp,$sp,$fp,$ra)=map("\$$_",(28..31));
# $output is the last argument if it looks like a file (it has an extension)
# $flavour is the first argument if it doesn't look like a file
$output = $#ARGV >= 0 && $ARGV[$#ARGV] =~ m|\.\w+$| ? pop : undef;
$flavour = $#ARGV >= 0 && $ARGV[0] !~ m|\.| ? shift : undef;
$flavour ||= "o32"; # supported flavours are o32,n32,64,nubi32,nubi64
if ($flavour =~ /64|n32/i) {
$PTR_LA="dla";
$PTR_ADD="daddu"; # incidentally works even on n32
$PTR_SUB="dsubu"; # incidentally works even on n32
$PTR_INS="dins";
$REG_S="sd";
$REG_L="ld";
$PTR_SLL="dsll"; # incidentally works even on n32
$SZREG=8;
} else {
$PTR_LA="la";
$PTR_ADD="addu";
$PTR_SUB="subu";
$PTR_INS="ins";
$REG_S="sw";
$REG_L="lw";
$PTR_SLL="sll";
$SZREG=4;
}
$pf = ($flavour =~ /nubi/i) ? $t0 : $t2;
#
# <appro@openssl.org>
#
######################################################################
$big_endian=(`echo MIPSEB | $ENV{CC} -E -`=~/MIPSEB/)?0:1 if ($ENV{CC});
if (!defined($big_endian))
{ $big_endian=(unpack('L',pack('N',1))==1); }
my ($MSB,$LSB)=(0,3); # automatically converted to little-endian
$output and open STDOUT,">$output";
$code.=<<___;
#include "mips_arch.h"
.text
#if !defined(__mips_eabi) && (!defined(__vxworks) || defined(__pic__))
.option pic2
#endif
.set noat
___
{{{
my $FRAMESIZE=16*$SZREG;
my $SAVED_REGS_MASK = ($flavour =~ /nubi/i) ? "0xc0fff008" : "0xc0ff0000";
my ($inp,$out,$key,$Tbl,$s0,$s1,$s2,$s3)=($a0,$a1,$a2,$a3,$a4,$a5,$a6,$a7);
my ($i0,$i1,$i2,$i3)=($at,$t0,$t1,$t2);
my ($t0,$t1,$t2,$t3,$t4,$t5,$t6,$t7,$t8,$t9,$t10,$t11) = map("\$$_",(12..23));
my ($key0,$cnt)=($gp,$fp);
# instruction ordering is "stolen" from output from MIPSpro assembler
# invoked with -mips3 -O3 arguments...
$code.=<<___;
.align 5
.ent _mips_AES_encrypt
_mips_AES_encrypt:
.frame $sp,0,$ra
.set reorder
lw $t0,0($key)
lw $t1,4($key)
lw $t2,8($key)
lw $t3,12($key)
lw $cnt,240($key)
$PTR_ADD $key0,$key,16
xor $s0,$t0
xor $s1,$t1
xor $s2,$t2
xor $s3,$t3
subu $cnt,1
#if defined(__mips_smartmips)
ext $i0,$s1,16,8
.Loop_enc:
ext $i1,$s2,16,8
ext $i2,$s3,16,8
ext $i3,$s0,16,8
lwxs $t0,$i0($Tbl) # Te1[s1>>16]
ext $i0,$s2,8,8
lwxs $t1,$i1($Tbl) # Te1[s2>>16]
ext $i1,$s3,8,8
lwxs $t2,$i2($Tbl) # Te1[s3>>16]
ext $i2,$s0,8,8
lwxs $t3,$i3($Tbl) # Te1[s0>>16]
ext $i3,$s1,8,8
lwxs $t4,$i0($Tbl) # Te2[s2>>8]
ext $i0,$s3,0,8
lwxs $t5,$i1($Tbl) # Te2[s3>>8]
ext $i1,$s0,0,8
lwxs $t6,$i2($Tbl) # Te2[s0>>8]
ext $i2,$s1,0,8
lwxs $t7,$i3($Tbl) # Te2[s1>>8]
ext $i3,$s2,0,8
lwxs $t8,$i0($Tbl) # Te3[s3]
ext $i0,$s0,24,8
lwxs $t9,$i1($Tbl) # Te3[s0]
ext $i1,$s1,24,8
lwxs $t10,$i2($Tbl) # Te3[s1]
ext $i2,$s2,24,8
lwxs $t11,$i3($Tbl) # Te3[s2]
ext $i3,$s3,24,8
rotr $t0,$t0,8
rotr $t1,$t1,8
rotr $t2,$t2,8
rotr $t3,$t3,8
rotr $t4,$t4,16
rotr $t5,$t5,16
rotr $t6,$t6,16
rotr $t7,$t7,16
xor $t0,$t4
lwxs $t4,$i0($Tbl) # Te0[s0>>24]
xor $t1,$t5
lwxs $t5,$i1($Tbl) # Te0[s1>>24]
xor $t2,$t6
lwxs $t6,$i2($Tbl) # Te0[s2>>24]
xor $t3,$t7
lwxs $t7,$i3($Tbl) # Te0[s3>>24]
rotr $t8,$t8,24
lw $s0,0($key0)
rotr $t9,$t9,24
lw $s1,4($key0)
rotr $t10,$t10,24
lw $s2,8($key0)
rotr $t11,$t11,24
lw $s3,12($key0)
xor $t0,$t8
xor $t1,$t9
xor $t2,$t10
xor $t3,$t11
xor $t0,$t4
xor $t1,$t5
xor $t2,$t6
xor $t3,$t7
subu $cnt,1
$PTR_ADD $key0,16
xor $s0,$t0
xor $s1,$t1
xor $s2,$t2
xor $s3,$t3
.set noreorder
bnez $cnt,.Loop_enc
ext $i0,$s1,16,8
_xtr $i0,$s1,16-2
#else
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
move $i0,$Tbl
move $i1,$Tbl
move $i2,$Tbl
move $i3,$Tbl
ext $t0,$s1,16,8
.Loop_enc:
ext $t1,$s2,16,8
ext $t2,$s3,16,8
ext $t3,$s0,16,8
$PTR_INS $i0,$t0,2,8
$PTR_INS $i1,$t1,2,8
$PTR_INS $i2,$t2,2,8
$PTR_INS $i3,$t3,2,8
lw $t0,0($i0) # Te1[s1>>16]
ext $t4,$s2,8,8
lw $t1,0($i1) # Te1[s2>>16]
ext $t5,$s3,8,8
lw $t2,0($i2) # Te1[s3>>16]
ext $t6,$s0,8,8
lw $t3,0($i3) # Te1[s0>>16]
ext $t7,$s1,8,8
$PTR_INS $i0,$t4,2,8
$PTR_INS $i1,$t5,2,8
$PTR_INS $i2,$t6,2,8
$PTR_INS $i3,$t7,2,8
#else
_xtr $i0,$s1,16-2
.Loop_enc:
_xtr $i1,$s2,16-2
_xtr $i2,$s3,16-2
_xtr $i3,$s0,16-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lwl $t0,3($i0) # Te1[s1>>16]
lwl $t1,3($i1) # Te1[s2>>16]
lwl $t2,3($i2) # Te1[s3>>16]
lwl $t3,3($i3) # Te1[s0>>16]
lwr $t0,2($i0) # Te1[s1>>16]
_xtr $i0,$s2,8-2
lwr $t1,2($i1) # Te1[s2>>16]
_xtr $i1,$s3,8-2
lwr $t2,2($i2) # Te1[s3>>16]
_xtr $i2,$s0,8-2
lwr $t3,2($i3) # Te1[s0>>16]
_xtr $i3,$s1,8-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
#endif
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
rotr $t0,$t0,8
rotr $t1,$t1,8
rotr $t2,$t2,8
rotr $t3,$t3,8
# if defined(_MIPSEL)
lw $t4,0($i0) # Te2[s2>>8]
ext $t8,$s3,0,8
lw $t5,0($i1) # Te2[s3>>8]
ext $t9,$s0,0,8
lw $t6,0($i2) # Te2[s0>>8]
ext $t10,$s1,0,8
lw $t7,0($i3) # Te2[s1>>8]
ext $t11,$s2,0,8
$PTR_INS $i0,$t8,2,8
$PTR_INS $i1,$t9,2,8
$PTR_INS $i2,$t10,2,8
$PTR_INS $i3,$t11,2,8
lw $t8,0($i0) # Te3[s3]
$PTR_INS $i0,$s0,2,8
lw $t9,0($i1) # Te3[s0]
$PTR_INS $i1,$s1,2,8
lw $t10,0($i2) # Te3[s1]
$PTR_INS $i2,$s2,2,8
lw $t11,0($i3) # Te3[s2]
$PTR_INS $i3,$s3,2,8
# else
lw $t4,0($i0) # Te2[s2>>8]
$PTR_INS $i0,$s3,2,8
lw $t5,0($i1) # Te2[s3>>8]
$PTR_INS $i1,$s0,2,8
lw $t6,0($i2) # Te2[s0>>8]
$PTR_INS $i2,$s1,2,8
lw $t7,0($i3) # Te2[s1>>8]
$PTR_INS $i3,$s2,2,8
lw $t8,0($i0) # Te3[s3]
_xtr $i0,$s0,24-2
lw $t9,0($i1) # Te3[s0]
_xtr $i1,$s1,24-2
lw $t10,0($i2) # Te3[s1]
_xtr $i2,$s2,24-2
lw $t11,0($i3) # Te3[s2]
_xtr $i3,$s3,24-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
# endif
rotr $t4,$t4,16
rotr $t5,$t5,16
rotr $t6,$t6,16
rotr $t7,$t7,16
rotr $t8,$t8,24
rotr $t9,$t9,24
rotr $t10,$t10,24
rotr $t11,$t11,24
#else
lwl $t4,2($i0) # Te2[s2>>8]
lwl $t5,2($i1) # Te2[s3>>8]
lwl $t6,2($i2) # Te2[s0>>8]
lwl $t7,2($i3) # Te2[s1>>8]
lwr $t4,1($i0) # Te2[s2>>8]
_xtr $i0,$s3,0-2
lwr $t5,1($i1) # Te2[s3>>8]
_xtr $i1,$s0,0-2
lwr $t6,1($i2) # Te2[s0>>8]
_xtr $i2,$s1,0-2
lwr $t7,1($i3) # Te2[s1>>8]
_xtr $i3,$s2,0-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lwl $t8,1($i0) # Te3[s3]
lwl $t9,1($i1) # Te3[s0]
lwl $t10,1($i2) # Te3[s1]
lwl $t11,1($i3) # Te3[s2]
lwr $t8,0($i0) # Te3[s3]
_xtr $i0,$s0,24-2
lwr $t9,0($i1) # Te3[s0]
_xtr $i1,$s1,24-2
lwr $t10,0($i2) # Te3[s1]
_xtr $i2,$s2,24-2
lwr $t11,0($i3) # Te3[s2]
_xtr $i3,$s3,24-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
#endif
xor $t0,$t4
lw $t4,0($i0) # Te0[s0>>24]
xor $t1,$t5
lw $t5,0($i1) # Te0[s1>>24]
xor $t2,$t6
lw $t6,0($i2) # Te0[s2>>24]
xor $t3,$t7
lw $t7,0($i3) # Te0[s3>>24]
xor $t0,$t8
lw $s0,0($key0)
xor $t1,$t9
lw $s1,4($key0)
xor $t2,$t10
lw $s2,8($key0)
xor $t3,$t11
lw $s3,12($key0)
xor $t0,$t4
xor $t1,$t5
xor $t2,$t6
xor $t3,$t7
subu $cnt,1
$PTR_ADD $key0,16
xor $s0,$t0
xor $s1,$t1
xor $s2,$t2
xor $s3,$t3
.set noreorder
bnez $cnt,.Loop_enc
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
ext $t0,$s1,16,8
#endif
_xtr $i0,$s1,16-2
#endif
.set reorder
_xtr $i1,$s2,16-2
_xtr $i2,$s3,16-2
_xtr $i3,$s0,16-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $t0,2($i0) # Te4[s1>>16]
_xtr $i0,$s2,8-2
lbu $t1,2($i1) # Te4[s2>>16]
_xtr $i1,$s3,8-2
lbu $t2,2($i2) # Te4[s3>>16]
_xtr $i2,$s0,8-2
lbu $t3,2($i3) # Te4[s0>>16]
_xtr $i3,$s1,8-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
# if defined(_MIPSEL)
lbu $t4,2($i0) # Te4[s2>>8]
$PTR_INS $i0,$s0,2,8
lbu $t5,2($i1) # Te4[s3>>8]
$PTR_INS $i1,$s1,2,8
lbu $t6,2($i2) # Te4[s0>>8]
$PTR_INS $i2,$s2,2,8
lbu $t7,2($i3) # Te4[s1>>8]
$PTR_INS $i3,$s3,2,8
lbu $t8,2($i0) # Te4[s0>>24]
_xtr $i0,$s3,0-2
lbu $t9,2($i1) # Te4[s1>>24]
_xtr $i1,$s0,0-2
lbu $t10,2($i2) # Te4[s2>>24]
_xtr $i2,$s1,0-2
lbu $t11,2($i3) # Te4[s3>>24]
_xtr $i3,$s2,0-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
# else
lbu $t4,2($i0) # Te4[s2>>8]
_xtr $i0,$s0,24-2
lbu $t5,2($i1) # Te4[s3>>8]
_xtr $i1,$s1,24-2
lbu $t6,2($i2) # Te4[s0>>8]
_xtr $i2,$s2,24-2
lbu $t7,2($i3) # Te4[s1>>8]
_xtr $i3,$s3,24-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $t8,2($i0) # Te4[s0>>24]
$PTR_INS $i0,$s3,2,8
lbu $t9,2($i1) # Te4[s1>>24]
$PTR_INS $i1,$s0,2,8
lbu $t10,2($i2) # Te4[s2>>24]
$PTR_INS $i2,$s1,2,8
lbu $t11,2($i3) # Te4[s3>>24]
$PTR_INS $i3,$s2,2,8
# endif
_ins $t0,16
_ins $t1,16
_ins $t2,16
_ins $t3,16
_ins2 $t0,$t4,8
lbu $t4,2($i0) # Te4[s3]
_ins2 $t1,$t5,8
lbu $t5,2($i1) # Te4[s0]
_ins2 $t2,$t6,8
lbu $t6,2($i2) # Te4[s1]
_ins2 $t3,$t7,8
lbu $t7,2($i3) # Te4[s2]
_ins2 $t0,$t8,24
lw $s0,0($key0)
_ins2 $t1,$t9,24
lw $s1,4($key0)
_ins2 $t2,$t10,24
lw $s2,8($key0)
_ins2 $t3,$t11,24
lw $s3,12($key0)
_ins2 $t0,$t4,0
_ins2 $t1,$t5,0
_ins2 $t2,$t6,0
_ins2 $t3,$t7,0
#else
lbu $t4,2($i0) # Te4[s2>>8]
_xtr $i0,$s0,24-2
lbu $t5,2($i1) # Te4[s3>>8]
_xtr $i1,$s1,24-2
lbu $t6,2($i2) # Te4[s0>>8]
_xtr $i2,$s2,24-2
lbu $t7,2($i3) # Te4[s1>>8]
_xtr $i3,$s3,24-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $t8,2($i0) # Te4[s0>>24]
_xtr $i0,$s3,0-2
lbu $t9,2($i1) # Te4[s1>>24]
_xtr $i1,$s0,0-2
lbu $t10,2($i2) # Te4[s2>>24]
_xtr $i2,$s1,0-2
lbu $t11,2($i3) # Te4[s3>>24]
_xtr $i3,$s2,0-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
_ins $t0,16
_ins $t1,16
_ins $t2,16
_ins $t3,16
_ins $t4,8
_ins $t5,8
_ins $t6,8
_ins $t7,8
xor $t0,$t4
lbu $t4,2($i0) # Te4[s3]
xor $t1,$t5
lbu $t5,2($i1) # Te4[s0]
xor $t2,$t6
lbu $t6,2($i2) # Te4[s1]
xor $t3,$t7
lbu $t7,2($i3) # Te4[s2]
_ins $t8,24
lw $s0,0($key0)
_ins $t9,24
lw $s1,4($key0)
_ins $t10,24
lw $s2,8($key0)
_ins $t11,24
lw $s3,12($key0)
xor $t0,$t8
xor $t1,$t9
xor $t2,$t10
xor $t3,$t11
_ins $t4,0
_ins $t5,0
_ins $t6,0
_ins $t7,0
xor $t0,$t4
xor $t1,$t5
xor $t2,$t6
xor $t3,$t7
#endif
xor $s0,$t0
xor $s1,$t1
xor $s2,$t2
xor $s3,$t3
jr $ra
.end _mips_AES_encrypt
.align 5
.globl AES_encrypt
.ent AES_encrypt
AES_encrypt:
.frame $sp,$FRAMESIZE,$ra
.mask $SAVED_REGS_MASK,-$SZREG
.set noreorder
___
$code.=<<___ if ($flavour =~ /o32/i); # o32 PIC-ification
.cpload $pf
___
$code.=<<___;
$PTR_SUB $sp,$FRAMESIZE
$REG_S $ra,$FRAMESIZE-1*$SZREG($sp)
$REG_S $fp,$FRAMESIZE-2*$SZREG($sp)
$REG_S $s11,$FRAMESIZE-3*$SZREG($sp)
$REG_S $s10,$FRAMESIZE-4*$SZREG($sp)
$REG_S $s9,$FRAMESIZE-5*$SZREG($sp)
$REG_S $s8,$FRAMESIZE-6*$SZREG($sp)
$REG_S $s7,$FRAMESIZE-7*$SZREG($sp)
$REG_S $s6,$FRAMESIZE-8*$SZREG($sp)
$REG_S $s5,$FRAMESIZE-9*$SZREG($sp)
$REG_S $s4,$FRAMESIZE-10*$SZREG($sp)
___
$code.=<<___ if ($flavour =~ /nubi/i); # optimize non-nubi prologue
$REG_S \$15,$FRAMESIZE-11*$SZREG($sp)
$REG_S \$14,$FRAMESIZE-12*$SZREG($sp)
$REG_S \$13,$FRAMESIZE-13*$SZREG($sp)
$REG_S \$12,$FRAMESIZE-14*$SZREG($sp)
$REG_S $gp,$FRAMESIZE-15*$SZREG($sp)
___
$code.=<<___ if ($flavour !~ /o32/i); # non-o32 PIC-ification
.cplocal $Tbl
.cpsetup $pf,$zero,AES_encrypt
___
$code.=<<___;
.set reorder
$PTR_LA $Tbl,AES_Te # PIC-ified 'load address'
#if defined(_MIPS_ARCH_MIPS32R6) || defined(_MIPS_ARCH_MIPS64R6)
lw $s0,0($inp)
lw $s1,4($inp)
lw $s2,8($inp)
lw $s3,12($inp)
#else
lwl $s0,0+$MSB($inp)
lwl $s1,4+$MSB($inp)
lwl $s2,8+$MSB($inp)
lwl $s3,12+$MSB($inp)
lwr $s0,0+$LSB($inp)
lwr $s1,4+$LSB($inp)
lwr $s2,8+$LSB($inp)
lwr $s3,12+$LSB($inp)
#endif
bal _mips_AES_encrypt
#if defined(_MIPS_ARCH_MIPS32R6) || defined(_MIPS_ARCH_MIPS64R6)
sw $s0,0($out)
sw $s1,4($out)
sw $s2,8($out)
sw $s3,12($out)
#else
swr $s0,0+$LSB($out)
swr $s1,4+$LSB($out)
swr $s2,8+$LSB($out)
swr $s3,12+$LSB($out)
swl $s0,0+$MSB($out)
swl $s1,4+$MSB($out)
swl $s2,8+$MSB($out)
swl $s3,12+$MSB($out)
#endif
.set noreorder
$REG_L $ra,$FRAMESIZE-1*$SZREG($sp)
$REG_L $fp,$FRAMESIZE-2*$SZREG($sp)
$REG_L $s11,$FRAMESIZE-3*$SZREG($sp)
$REG_L $s10,$FRAMESIZE-4*$SZREG($sp)
$REG_L $s9,$FRAMESIZE-5*$SZREG($sp)
$REG_L $s8,$FRAMESIZE-6*$SZREG($sp)
$REG_L $s7,$FRAMESIZE-7*$SZREG($sp)
$REG_L $s6,$FRAMESIZE-8*$SZREG($sp)
$REG_L $s5,$FRAMESIZE-9*$SZREG($sp)
$REG_L $s4,$FRAMESIZE-10*$SZREG($sp)
___
$code.=<<___ if ($flavour =~ /nubi/i);
$REG_L \$15,$FRAMESIZE-11*$SZREG($sp)
$REG_L \$14,$FRAMESIZE-12*$SZREG($sp)
$REG_L \$13,$FRAMESIZE-13*$SZREG($sp)
$REG_L \$12,$FRAMESIZE-14*$SZREG($sp)
$REG_L $gp,$FRAMESIZE-15*$SZREG($sp)
___
$code.=<<___;
jr $ra
$PTR_ADD $sp,$FRAMESIZE
.end AES_encrypt
___
$code.=<<___;
.align 5
.ent _mips_AES_decrypt
_mips_AES_decrypt:
.frame $sp,0,$ra
.set reorder
lw $t0,0($key)
lw $t1,4($key)
lw $t2,8($key)
lw $t3,12($key)
lw $cnt,240($key)
$PTR_ADD $key0,$key,16
xor $s0,$t0
xor $s1,$t1
xor $s2,$t2
xor $s3,$t3
subu $cnt,1
#if defined(__mips_smartmips)
ext $i0,$s3,16,8
.Loop_dec:
ext $i1,$s0,16,8
ext $i2,$s1,16,8
ext $i3,$s2,16,8
lwxs $t0,$i0($Tbl) # Td1[s3>>16]
ext $i0,$s2,8,8
lwxs $t1,$i1($Tbl) # Td1[s0>>16]
ext $i1,$s3,8,8
lwxs $t2,$i2($Tbl) # Td1[s1>>16]
ext $i2,$s0,8,8
lwxs $t3,$i3($Tbl) # Td1[s2>>16]
ext $i3,$s1,8,8
lwxs $t4,$i0($Tbl) # Td2[s2>>8]
ext $i0,$s1,0,8
lwxs $t5,$i1($Tbl) # Td2[s3>>8]
ext $i1,$s2,0,8
lwxs $t6,$i2($Tbl) # Td2[s0>>8]
ext $i2,$s3,0,8
lwxs $t7,$i3($Tbl) # Td2[s1>>8]
ext $i3,$s0,0,8
lwxs $t8,$i0($Tbl) # Td3[s1]
ext $i0,$s0,24,8
lwxs $t9,$i1($Tbl) # Td3[s2]
ext $i1,$s1,24,8
lwxs $t10,$i2($Tbl) # Td3[s3]
ext $i2,$s2,24,8
lwxs $t11,$i3($Tbl) # Td3[s0]
ext $i3,$s3,24,8
rotr $t0,$t0,8
rotr $t1,$t1,8
rotr $t2,$t2,8
rotr $t3,$t3,8
rotr $t4,$t4,16
rotr $t5,$t5,16
rotr $t6,$t6,16
rotr $t7,$t7,16
xor $t0,$t4
lwxs $t4,$i0($Tbl) # Td0[s0>>24]
xor $t1,$t5
lwxs $t5,$i1($Tbl) # Td0[s1>>24]
xor $t2,$t6
lwxs $t6,$i2($Tbl) # Td0[s2>>24]
xor $t3,$t7
lwxs $t7,$i3($Tbl) # Td0[s3>>24]
rotr $t8,$t8,24
lw $s0,0($key0)
rotr $t9,$t9,24
lw $s1,4($key0)
rotr $t10,$t10,24
lw $s2,8($key0)
rotr $t11,$t11,24
lw $s3,12($key0)
xor $t0,$t8
xor $t1,$t9
xor $t2,$t10
xor $t3,$t11
xor $t0,$t4
xor $t1,$t5
xor $t2,$t6
xor $t3,$t7
subu $cnt,1
$PTR_ADD $key0,16
xor $s0,$t0
xor $s1,$t1
xor $s2,$t2
xor $s3,$t3
.set noreorder
bnez $cnt,.Loop_dec
ext $i0,$s3,16,8
_xtr $i0,$s3,16-2
#else
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
move $i0,$Tbl
move $i1,$Tbl
move $i2,$Tbl
move $i3,$Tbl
ext $t0,$s3,16,8
.Loop_dec:
ext $t1,$s0,16,8
ext $t2,$s1,16,8
ext $t3,$s2,16,8
$PTR_INS $i0,$t0,2,8
$PTR_INS $i1,$t1,2,8
$PTR_INS $i2,$t2,2,8
$PTR_INS $i3,$t3,2,8
lw $t0,0($i0) # Td1[s3>>16]
ext $t4,$s2,8,8
lw $t1,0($i1) # Td1[s0>>16]
ext $t5,$s3,8,8
lw $t2,0($i2) # Td1[s1>>16]
ext $t6,$s0,8,8
lw $t3,0($i3) # Td1[s2>>16]
ext $t7,$s1,8,8
$PTR_INS $i0,$t4,2,8
$PTR_INS $i1,$t5,2,8
$PTR_INS $i2,$t6,2,8
$PTR_INS $i3,$t7,2,8
#else
_xtr $i0,$s3,16-2
.Loop_dec:
_xtr $i1,$s0,16-2
_xtr $i2,$s1,16-2
_xtr $i3,$s2,16-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lwl $t0,3($i0) # Td1[s3>>16]
lwl $t1,3($i1) # Td1[s0>>16]
lwl $t2,3($i2) # Td1[s1>>16]
lwl $t3,3($i3) # Td1[s2>>16]
lwr $t0,2($i0) # Td1[s3>>16]
_xtr $i0,$s2,8-2
lwr $t1,2($i1) # Td1[s0>>16]
_xtr $i1,$s3,8-2
lwr $t2,2($i2) # Td1[s1>>16]
_xtr $i2,$s0,8-2
lwr $t3,2($i3) # Td1[s2>>16]
_xtr $i3,$s1,8-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
#endif
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
rotr $t0,$t0,8
rotr $t1,$t1,8
rotr $t2,$t2,8
rotr $t3,$t3,8
# if defined(_MIPSEL)
lw $t4,0($i0) # Td2[s2>>8]
ext $t8,$s1,0,8
lw $t5,0($i1) # Td2[s3>>8]
ext $t9,$s2,0,8
lw $t6,0($i2) # Td2[s0>>8]
ext $t10,$s3,0,8
lw $t7,0($i3) # Td2[s1>>8]
ext $t11,$s0,0,8
$PTR_INS $i0,$t8,2,8
$PTR_INS $i1,$t9,2,8
$PTR_INS $i2,$t10,2,8
$PTR_INS $i3,$t11,2,8
lw $t8,0($i0) # Td3[s1]
$PTR_INS $i0,$s0,2,8
lw $t9,0($i1) # Td3[s2]
$PTR_INS $i1,$s1,2,8
lw $t10,0($i2) # Td3[s3]
$PTR_INS $i2,$s2,2,8
lw $t11,0($i3) # Td3[s0]
$PTR_INS $i3,$s3,2,8
#else
lw $t4,0($i0) # Td2[s2>>8]
$PTR_INS $i0,$s1,2,8
lw $t5,0($i1) # Td2[s3>>8]
$PTR_INS $i1,$s2,2,8
lw $t6,0($i2) # Td2[s0>>8]
$PTR_INS $i2,$s3,2,8
lw $t7,0($i3) # Td2[s1>>8]
$PTR_INS $i3,$s0,2,8
lw $t8,0($i0) # Td3[s1]
_xtr $i0,$s0,24-2
lw $t9,0($i1) # Td3[s2]
_xtr $i1,$s1,24-2
lw $t10,0($i2) # Td3[s3]
_xtr $i2,$s2,24-2
lw $t11,0($i3) # Td3[s0]
_xtr $i3,$s3,24-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
#endif
rotr $t4,$t4,16
rotr $t5,$t5,16
rotr $t6,$t6,16
rotr $t7,$t7,16
rotr $t8,$t8,24
rotr $t9,$t9,24
rotr $t10,$t10,24
rotr $t11,$t11,24
#else
lwl $t4,2($i0) # Td2[s2>>8]
lwl $t5,2($i1) # Td2[s3>>8]
lwl $t6,2($i2) # Td2[s0>>8]
lwl $t7,2($i3) # Td2[s1>>8]
lwr $t4,1($i0) # Td2[s2>>8]
_xtr $i0,$s1,0-2
lwr $t5,1($i1) # Td2[s3>>8]
_xtr $i1,$s2,0-2
lwr $t6,1($i2) # Td2[s0>>8]
_xtr $i2,$s3,0-2
lwr $t7,1($i3) # Td2[s1>>8]
_xtr $i3,$s0,0-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lwl $t8,1($i0) # Td3[s1]
lwl $t9,1($i1) # Td3[s2]
lwl $t10,1($i2) # Td3[s3]
lwl $t11,1($i3) # Td3[s0]
lwr $t8,0($i0) # Td3[s1]
_xtr $i0,$s0,24-2
lwr $t9,0($i1) # Td3[s2]
_xtr $i1,$s1,24-2
lwr $t10,0($i2) # Td3[s3]
_xtr $i2,$s2,24-2
lwr $t11,0($i3) # Td3[s0]
_xtr $i3,$s3,24-2
and $i0,0x3fc
and $i1,0x3fc
and $i2,0x3fc
and $i3,0x3fc
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
#endif
xor $t0,$t4
lw $t4,0($i0) # Td0[s0>>24]
xor $t1,$t5
lw $t5,0($i1) # Td0[s1>>24]
xor $t2,$t6
lw $t6,0($i2) # Td0[s2>>24]
xor $t3,$t7
lw $t7,0($i3) # Td0[s3>>24]
xor $t0,$t8
lw $s0,0($key0)
xor $t1,$t9
lw $s1,4($key0)
xor $t2,$t10
lw $s2,8($key0)
xor $t3,$t11
lw $s3,12($key0)
xor $t0,$t4
xor $t1,$t5
xor $t2,$t6
xor $t3,$t7
subu $cnt,1
$PTR_ADD $key0,16
xor $s0,$t0
xor $s1,$t1
xor $s2,$t2
xor $s3,$t3
.set noreorder
bnez $cnt,.Loop_dec
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
ext $t0,$s3,16,8
#endif
_xtr $i0,$s3,16-2
#endif
.set reorder
lw $t4,1024($Tbl) # prefetch Td4
_xtr $i0,$s3,16
lw $t5,1024+32($Tbl)
_xtr $i1,$s0,16
lw $t6,1024+64($Tbl)
_xtr $i2,$s1,16
lw $t7,1024+96($Tbl)
_xtr $i3,$s2,16
lw $t8,1024+128($Tbl)
and $i0,0xff
lw $t9,1024+160($Tbl)
and $i1,0xff
lw $t10,1024+192($Tbl)
and $i2,0xff
lw $t11,1024+224($Tbl)
and $i3,0xff
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $t0,1024($i0) # Td4[s3>>16]
_xtr $i0,$s2,8
lbu $t1,1024($i1) # Td4[s0>>16]
_xtr $i1,$s3,8
lbu $t2,1024($i2) # Td4[s1>>16]
_xtr $i2,$s0,8
lbu $t3,1024($i3) # Td4[s2>>16]
_xtr $i3,$s1,8
and $i0,0xff
and $i1,0xff
and $i2,0xff
and $i3,0xff
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
# if defined(_MIPSEL)
lbu $t4,1024($i0) # Td4[s2>>8]
$PTR_INS $i0,$s0,0,8
lbu $t5,1024($i1) # Td4[s3>>8]
$PTR_INS $i1,$s1,0,8
lbu $t6,1024($i2) # Td4[s0>>8]
$PTR_INS $i2,$s2,0,8
lbu $t7,1024($i3) # Td4[s1>>8]
$PTR_INS $i3,$s3,0,8
lbu $t8,1024($i0) # Td4[s0>>24]
_xtr $i0,$s1,0
lbu $t9,1024($i1) # Td4[s1>>24]
_xtr $i1,$s2,0
lbu $t10,1024($i2) # Td4[s2>>24]
_xtr $i2,$s3,0
lbu $t11,1024($i3) # Td4[s3>>24]
_xtr $i3,$s0,0
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
# else
lbu $t4,1024($i0) # Td4[s2>>8]
_xtr $i0,$s0,24
lbu $t5,1024($i1) # Td4[s3>>8]
_xtr $i1,$s1,24
lbu $t6,1024($i2) # Td4[s0>>8]
_xtr $i2,$s2,24
lbu $t7,1024($i3) # Td4[s1>>8]
_xtr $i3,$s3,24
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $t8,1024($i0) # Td4[s0>>24]
$PTR_INS $i0,$s1,0,8
lbu $t9,1024($i1) # Td4[s1>>24]
$PTR_INS $i1,$s2,0,8
lbu $t10,1024($i2) # Td4[s2>>24]
$PTR_INS $i2,$s3,0,8
lbu $t11,1024($i3) # Td4[s3>>24]
$PTR_INS $i3,$s0,0,8
# endif
_ins $t0,16
_ins $t1,16
_ins $t2,16
_ins $t3,16
_ins2 $t0,$t4,8
lbu $t4,1024($i0) # Td4[s1]
_ins2 $t1,$t5,8
lbu $t5,1024($i1) # Td4[s2]
_ins2 $t2,$t6,8
lbu $t6,1024($i2) # Td4[s3]
_ins2 $t3,$t7,8
lbu $t7,1024($i3) # Td4[s0]
_ins2 $t0,$t8,24
lw $s0,0($key0)
_ins2 $t1,$t9,24
lw $s1,4($key0)
_ins2 $t2,$t10,24
lw $s2,8($key0)
_ins2 $t3,$t11,24
lw $s3,12($key0)
_ins2 $t0,$t4,0
_ins2 $t1,$t5,0
_ins2 $t2,$t6,0
_ins2 $t3,$t7,0
#else
lbu $t4,1024($i0) # Td4[s2>>8]
_xtr $i0,$s0,24
lbu $t5,1024($i1) # Td4[s3>>8]
_xtr $i1,$s1,24
lbu $t6,1024($i2) # Td4[s0>>8]
_xtr $i2,$s2,24
lbu $t7,1024($i3) # Td4[s1>>8]
_xtr $i3,$s3,24
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $t8,1024($i0) # Td4[s0>>24]
_xtr $i0,$s1,0
lbu $t9,1024($i1) # Td4[s1>>24]
_xtr $i1,$s2,0
lbu $t10,1024($i2) # Td4[s2>>24]
_xtr $i2,$s3,0
lbu $t11,1024($i3) # Td4[s3>>24]
_xtr $i3,$s0,0
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
_ins $t0,16
_ins $t1,16
_ins $t2,16
_ins $t3,16
_ins $t4,8
_ins $t5,8
_ins $t6,8
_ins $t7,8
xor $t0,$t4
lbu $t4,1024($i0) # Td4[s1]
xor $t1,$t5
lbu $t5,1024($i1) # Td4[s2]
xor $t2,$t6
lbu $t6,1024($i2) # Td4[s3]
xor $t3,$t7
lbu $t7,1024($i3) # Td4[s0]
_ins $t8,24
lw $s0,0($key0)
_ins $t9,24
lw $s1,4($key0)
_ins $t10,24
lw $s2,8($key0)
_ins $t11,24
lw $s3,12($key0)
xor $t0,$t8
xor $t1,$t9
xor $t2,$t10
xor $t3,$t11
_ins $t4,0
_ins $t5,0
_ins $t6,0
_ins $t7,0
xor $t0,$t4
xor $t1,$t5
xor $t2,$t6
xor $t3,$t7
#endif
xor $s0,$t0
xor $s1,$t1
xor $s2,$t2
xor $s3,$t3
jr $ra
.end _mips_AES_decrypt
.align 5
.globl AES_decrypt
.ent AES_decrypt
AES_decrypt:
.frame $sp,$FRAMESIZE,$ra
.mask $SAVED_REGS_MASK,-$SZREG
.set noreorder
___
$code.=<<___ if ($flavour =~ /o32/i); # o32 PIC-ification
.cpload $pf
___
$code.=<<___;
$PTR_SUB $sp,$FRAMESIZE
$REG_S $ra,$FRAMESIZE-1*$SZREG($sp)
$REG_S $fp,$FRAMESIZE-2*$SZREG($sp)
$REG_S $s11,$FRAMESIZE-3*$SZREG($sp)
$REG_S $s10,$FRAMESIZE-4*$SZREG($sp)
$REG_S $s9,$FRAMESIZE-5*$SZREG($sp)
$REG_S $s8,$FRAMESIZE-6*$SZREG($sp)
$REG_S $s7,$FRAMESIZE-7*$SZREG($sp)
$REG_S $s6,$FRAMESIZE-8*$SZREG($sp)
$REG_S $s5,$FRAMESIZE-9*$SZREG($sp)
$REG_S $s4,$FRAMESIZE-10*$SZREG($sp)
___
$code.=<<___ if ($flavour =~ /nubi/i); # optimize non-nubi prologue
$REG_S \$15,$FRAMESIZE-11*$SZREG($sp)
$REG_S \$14,$FRAMESIZE-12*$SZREG($sp)
$REG_S \$13,$FRAMESIZE-13*$SZREG($sp)
$REG_S \$12,$FRAMESIZE-14*$SZREG($sp)
$REG_S $gp,$FRAMESIZE-15*$SZREG($sp)
___
$code.=<<___ if ($flavour !~ /o32/i); # non-o32 PIC-ification
.cplocal $Tbl
.cpsetup $pf,$zero,AES_decrypt
___
$code.=<<___;
.set reorder
$PTR_LA $Tbl,AES_Td # PIC-ified 'load address'
#if defined(_MIPS_ARCH_MIPS32R6) || defined(_MIPS_ARCH_MIPS64R6)
lw $s0,0($inp)
lw $s1,4($inp)
lw $s2,8($inp)
lw $s3,12($inp)
#else
lwl $s0,0+$MSB($inp)
lwl $s1,4+$MSB($inp)
lwl $s2,8+$MSB($inp)
lwl $s3,12+$MSB($inp)
lwr $s0,0+$LSB($inp)
lwr $s1,4+$LSB($inp)
lwr $s2,8+$LSB($inp)
lwr $s3,12+$LSB($inp)
#endif
bal _mips_AES_decrypt
#if defined(_MIPS_ARCH_MIPS32R6) || defined(_MIPS_ARCH_MIPS64R6)
sw $s0,0($out)
sw $s1,4($out)
sw $s2,8($out)
sw $s3,12($out)
#else
swr $s0,0+$LSB($out)
swr $s1,4+$LSB($out)
swr $s2,8+$LSB($out)
swr $s3,12+$LSB($out)
swl $s0,0+$MSB($out)
swl $s1,4+$MSB($out)
swl $s2,8+$MSB($out)
swl $s3,12+$MSB($out)
#endif
.set noreorder
$REG_L $ra,$FRAMESIZE-1*$SZREG($sp)
$REG_L $fp,$FRAMESIZE-2*$SZREG($sp)
$REG_L $s11,$FRAMESIZE-3*$SZREG($sp)
$REG_L $s10,$FRAMESIZE-4*$SZREG($sp)
$REG_L $s9,$FRAMESIZE-5*$SZREG($sp)
$REG_L $s8,$FRAMESIZE-6*$SZREG($sp)
$REG_L $s7,$FRAMESIZE-7*$SZREG($sp)
$REG_L $s6,$FRAMESIZE-8*$SZREG($sp)
$REG_L $s5,$FRAMESIZE-9*$SZREG($sp)
$REG_L $s4,$FRAMESIZE-10*$SZREG($sp)
___
$code.=<<___ if ($flavour =~ /nubi/i);
$REG_L \$15,$FRAMESIZE-11*$SZREG($sp)
$REG_L \$14,$FRAMESIZE-12*$SZREG($sp)
$REG_L \$13,$FRAMESIZE-13*$SZREG($sp)
$REG_L \$12,$FRAMESIZE-14*$SZREG($sp)
$REG_L $gp,$FRAMESIZE-15*$SZREG($sp)
___
$code.=<<___;
jr $ra
$PTR_ADD $sp,$FRAMESIZE
.end AES_decrypt
___
}}}
{{{
my $FRAMESIZE=8*$SZREG;
my $SAVED_REGS_MASK = ($flavour =~ /nubi/i) ? "0xc000f008" : "0xc0000000";
my ($inp,$bits,$key,$Tbl)=($a0,$a1,$a2,$a3);
my ($rk0,$rk1,$rk2,$rk3,$rk4,$rk5,$rk6,$rk7)=($a4,$a5,$a6,$a7,$s0,$s1,$s2,$s3);
my ($i0,$i1,$i2,$i3)=($at,$t0,$t1,$t2);
my ($rcon,$cnt)=($gp,$fp);
$code.=<<___;
.align 5
.ent _mips_AES_set_encrypt_key
_mips_AES_set_encrypt_key:
.frame $sp,0,$ra
.set noreorder
beqz $inp,.Lekey_done
li $t0,-1
beqz $key,.Lekey_done
$PTR_ADD $rcon,$Tbl,256
.set reorder
#if defined(_MIPS_ARCH_MIPS32R6) || defined(_MIPS_ARCH_MIPS64R6)
lw $rk0,0($inp) # load 128 bits
lw $rk1,4($inp)
lw $rk2,8($inp)
lw $rk3,12($inp)
#else
lwl $rk0,0+$MSB($inp) # load 128 bits
lwl $rk1,4+$MSB($inp)
lwl $rk2,8+$MSB($inp)
lwl $rk3,12+$MSB($inp)
lwr $rk0,0+$LSB($inp)
lwr $rk1,4+$LSB($inp)
lwr $rk2,8+$LSB($inp)
lwr $rk3,12+$LSB($inp)
#endif
li $at,128
.set noreorder
beq $bits,$at,.L128bits
li $cnt,10
.set reorder
#if defined(_MIPS_ARCH_MIPS32R6) || defined(_MIPS_ARCH_MIPS64R6)
lw $rk4,16($inp) # load 192 bits
lw $rk5,20($inp)
#else
lwl $rk4,16+$MSB($inp) # load 192 bits
lwl $rk5,20+$MSB($inp)
lwr $rk4,16+$LSB($inp)
lwr $rk5,20+$LSB($inp)
#endif
li $at,192
.set noreorder
beq $bits,$at,.L192bits
li $cnt,8
.set reorder
#if defined(_MIPS_ARCH_MIPS32R6) || defined(_MIPS_ARCH_MIPS64R6)
lw $rk6,24($inp) # load 256 bits
lw $rk7,28($inp)
#else
lwl $rk6,24+$MSB($inp) # load 256 bits
lwl $rk7,28+$MSB($inp)
lwr $rk6,24+$LSB($inp)
lwr $rk7,28+$LSB($inp)
#endif
li $at,256
.set noreorder
beq $bits,$at,.L256bits
li $cnt,7
b .Lekey_done
li $t0,-2
.align 4
.L128bits:
.set reorder
srl $i0,$rk3,16
srl $i1,$rk3,8
and $i0,0xff
and $i1,0xff
and $i2,$rk3,0xff
srl $i3,$rk3,24
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $i0,0($i0)
lbu $i1,0($i1)
lbu $i2,0($i2)
lbu $i3,0($i3)
sw $rk0,0($key)
sw $rk1,4($key)
sw $rk2,8($key)
sw $rk3,12($key)
subu $cnt,1
$PTR_ADD $key,16
_bias $i0,24
_bias $i1,16
_bias $i2,8
_bias $i3,0
xor $rk0,$i0
lw $i0,0($rcon)
xor $rk0,$i1
xor $rk0,$i2
xor $rk0,$i3
xor $rk0,$i0
xor $rk1,$rk0
xor $rk2,$rk1
xor $rk3,$rk2
.set noreorder
bnez $cnt,.L128bits
$PTR_ADD $rcon,4
sw $rk0,0($key)
sw $rk1,4($key)
sw $rk2,8($key)
li $cnt,10
sw $rk3,12($key)
li $t0,0
sw $cnt,80($key)
b .Lekey_done
$PTR_SUB $key,10*16
.align 4
.L192bits:
.set reorder
srl $i0,$rk5,16
srl $i1,$rk5,8
and $i0,0xff
and $i1,0xff
and $i2,$rk5,0xff
srl $i3,$rk5,24
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $i0,0($i0)
lbu $i1,0($i1)
lbu $i2,0($i2)
lbu $i3,0($i3)
sw $rk0,0($key)
sw $rk1,4($key)
sw $rk2,8($key)
sw $rk3,12($key)
sw $rk4,16($key)
sw $rk5,20($key)
subu $cnt,1
$PTR_ADD $key,24
_bias $i0,24
_bias $i1,16
_bias $i2,8
_bias $i3,0
xor $rk0,$i0
lw $i0,0($rcon)
xor $rk0,$i1
xor $rk0,$i2
xor $rk0,$i3
xor $rk0,$i0
xor $rk1,$rk0
xor $rk2,$rk1
xor $rk3,$rk2
xor $rk4,$rk3
xor $rk5,$rk4
.set noreorder
bnez $cnt,.L192bits
$PTR_ADD $rcon,4
sw $rk0,0($key)
sw $rk1,4($key)
sw $rk2,8($key)
li $cnt,12
sw $rk3,12($key)
li $t0,0
sw $cnt,48($key)
b .Lekey_done
$PTR_SUB $key,12*16
.align 4
.L256bits:
.set reorder
srl $i0,$rk7,16
srl $i1,$rk7,8
and $i0,0xff
and $i1,0xff
and $i2,$rk7,0xff
srl $i3,$rk7,24
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $i0,0($i0)
lbu $i1,0($i1)
lbu $i2,0($i2)
lbu $i3,0($i3)
sw $rk0,0($key)
sw $rk1,4($key)
sw $rk2,8($key)
sw $rk3,12($key)
sw $rk4,16($key)
sw $rk5,20($key)
sw $rk6,24($key)
sw $rk7,28($key)
subu $cnt,1
_bias $i0,24
_bias $i1,16
_bias $i2,8
_bias $i3,0
xor $rk0,$i0
lw $i0,0($rcon)
xor $rk0,$i1
xor $rk0,$i2
xor $rk0,$i3
xor $rk0,$i0
xor $rk1,$rk0
xor $rk2,$rk1
xor $rk3,$rk2
beqz $cnt,.L256bits_done
srl $i0,$rk3,24
srl $i1,$rk3,16
srl $i2,$rk3,8
and $i3,$rk3,0xff
and $i1,0xff
and $i2,0xff
$PTR_ADD $i0,$Tbl
$PTR_ADD $i1,$Tbl
$PTR_ADD $i2,$Tbl
$PTR_ADD $i3,$Tbl
lbu $i0,0($i0)
lbu $i1,0($i1)
lbu $i2,0($i2)
lbu $i3,0($i3)
sll $i0,24
sll $i1,16
sll $i2,8
xor $rk4,$i0
xor $rk4,$i1
xor $rk4,$i2
xor $rk4,$i3
xor $rk5,$rk4
xor $rk6,$rk5
xor $rk7,$rk6
$PTR_ADD $key,32
.set noreorder
b .L256bits
$PTR_ADD $rcon,4
.L256bits_done:
sw $rk0,32($key)
sw $rk1,36($key)
sw $rk2,40($key)
li $cnt,14
sw $rk3,44($key)
li $t0,0
sw $cnt,48($key)
$PTR_SUB $key,12*16
.Lekey_done:
jr $ra
nop
.end _mips_AES_set_encrypt_key
.globl AES_set_encrypt_key
.ent AES_set_encrypt_key
AES_set_encrypt_key:
.frame $sp,$FRAMESIZE,$ra
.mask $SAVED_REGS_MASK,-$SZREG
.set noreorder
___
$code.=<<___ if ($flavour =~ /o32/i); # o32 PIC-ification
.cpload $pf
___
$code.=<<___;
$PTR_SUB $sp,$FRAMESIZE
$REG_S $ra,$FRAMESIZE-1*$SZREG($sp)
$REG_S $fp,$FRAMESIZE-2*$SZREG($sp)
___
$code.=<<___ if ($flavour =~ /nubi/i); # optimize non-nubi prologue
$REG_S $s3,$FRAMESIZE-3*$SZREG($sp)
$REG_S $s2,$FRAMESIZE-4*$SZREG($sp)
$REG_S $s1,$FRAMESIZE-5*$SZREG($sp)
$REG_S $s0,$FRAMESIZE-6*$SZREG($sp)
$REG_S $gp,$FRAMESIZE-7*$SZREG($sp)
___
$code.=<<___ if ($flavour !~ /o32/i); # non-o32 PIC-ification
.cplocal $Tbl
.cpsetup $pf,$zero,AES_set_encrypt_key
___
$code.=<<___;
.set reorder
$PTR_LA $Tbl,AES_Te4 # PIC-ified 'load address'
bal _mips_AES_set_encrypt_key
.set noreorder
move $a0,$t0
$REG_L $ra,$FRAMESIZE-1*$SZREG($sp)
$REG_L $fp,$FRAMESIZE-2*$SZREG($sp)
___
$code.=<<___ if ($flavour =~ /nubi/i);
$REG_L $s3,$FRAMESIZE-11*$SZREG($sp)
$REG_L $s2,$FRAMESIZE-12*$SZREG($sp)
$REG_L $s1,$FRAMESIZE-13*$SZREG($sp)
$REG_L $s0,$FRAMESIZE-14*$SZREG($sp)
$REG_L $gp,$FRAMESIZE-15*$SZREG($sp)
___
$code.=<<___;
jr $ra
$PTR_ADD $sp,$FRAMESIZE
.end AES_set_encrypt_key
___
my ($head,$tail)=($inp,$bits);
my ($tp1,$tp2,$tp4,$tp8,$tp9,$tpb,$tpd,$tpe)=($a4,$a5,$a6,$a7,$s0,$s1,$s2,$s3);
my ($m,$x80808080,$x7f7f7f7f,$x1b1b1b1b)=($at,$t0,$t1,$t2);
$code.=<<___;
.align 5
.globl AES_set_decrypt_key
.ent AES_set_decrypt_key
AES_set_decrypt_key:
.frame $sp,$FRAMESIZE,$ra
.mask $SAVED_REGS_MASK,-$SZREG
.set noreorder
___
$code.=<<___ if ($flavour =~ /o32/i); # o32 PIC-ification
.cpload $pf
___
$code.=<<___;
$PTR_SUB $sp,$FRAMESIZE
$REG_S $ra,$FRAMESIZE-1*$SZREG($sp)
$REG_S $fp,$FRAMESIZE-2*$SZREG($sp)
___
$code.=<<___ if ($flavour =~ /nubi/i); # optimize non-nubi prologue
$REG_S $s3,$FRAMESIZE-3*$SZREG($sp)
$REG_S $s2,$FRAMESIZE-4*$SZREG($sp)
$REG_S $s1,$FRAMESIZE-5*$SZREG($sp)
$REG_S $s0,$FRAMESIZE-6*$SZREG($sp)
$REG_S $gp,$FRAMESIZE-7*$SZREG($sp)
___
$code.=<<___ if ($flavour !~ /o32/i); # non-o32 PIC-ification
.cplocal $Tbl
.cpsetup $pf,$zero,AES_set_decrypt_key
___
$code.=<<___;
.set reorder
$PTR_LA $Tbl,AES_Te4 # PIC-ified 'load address'
bal _mips_AES_set_encrypt_key
bltz $t0,.Ldkey_done
sll $at,$cnt,4
$PTR_ADD $head,$key,0
$PTR_ADD $tail,$key,$at
.align 4
.Lswap:
lw $rk0,0($head)
lw $rk1,4($head)
lw $rk2,8($head)
lw $rk3,12($head)
lw $rk4,0($tail)
lw $rk5,4($tail)
lw $rk6,8($tail)
lw $rk7,12($tail)
sw $rk0,0($tail)
sw $rk1,4($tail)
sw $rk2,8($tail)
sw $rk3,12($tail)
$PTR_ADD $head,16
$PTR_SUB $tail,16
sw $rk4,-16($head)
sw $rk5,-12($head)
sw $rk6,-8($head)
sw $rk7,-4($head)
bne $head,$tail,.Lswap
lw $tp1,16($key) # modulo-scheduled
lui $x80808080,0x8080
subu $cnt,1
or $x80808080,0x8080
sll $cnt,2
$PTR_ADD $key,16
lui $x1b1b1b1b,0x1b1b
nor $x7f7f7f7f,$zero,$x80808080
or $x1b1b1b1b,0x1b1b
.align 4
.Lmix:
and $m,$tp1,$x80808080
and $tp2,$tp1,$x7f7f7f7f
srl $tp4,$m,7
addu $tp2,$tp2 # tp2<<1
subu $m,$tp4
and $m,$x1b1b1b1b
xor $tp2,$m
and $m,$tp2,$x80808080
and $tp4,$tp2,$x7f7f7f7f
srl $tp8,$m,7
addu $tp4,$tp4 # tp4<<1
subu $m,$tp8
and $m,$x1b1b1b1b
xor $tp4,$m
and $m,$tp4,$x80808080
and $tp8,$tp4,$x7f7f7f7f
srl $tp9,$m,7
addu $tp8,$tp8 # tp8<<1
subu $m,$tp9
and $m,$x1b1b1b1b
xor $tp8,$m
xor $tp9,$tp8,$tp1
xor $tpe,$tp8,$tp4
xor $tpb,$tp9,$tp2
xor $tpd,$tp9,$tp4
#if defined(_MIPS_ARCH_MIPS32R2) || defined(_MIPS_ARCH_MIPS64R2)
rotr $tp1,$tpd,16
xor $tpe,$tp2
rotr $tp2,$tp9,8
xor $tpe,$tp1
rotr $tp4,$tpb,24
xor $tpe,$tp2
lw $tp1,4($key) # modulo-scheduled
xor $tpe,$tp4
#else
_ror $tp1,$tpd,16
xor $tpe,$tp2
_ror $tp2,$tpd,-16
xor $tpe,$tp1
_ror $tp1,$tp9,8
xor $tpe,$tp2
_ror $tp2,$tp9,-24
xor $tpe,$tp1
_ror $tp1,$tpb,24
xor $tpe,$tp2
_ror $tp2,$tpb,-8
xor $tpe,$tp1
lw $tp1,4($key) # modulo-scheduled
xor $tpe,$tp2
#endif
subu $cnt,1
sw $tpe,0($key)
$PTR_ADD $key,4
bnez $cnt,.Lmix
li $t0,0
.Ldkey_done:
.set noreorder
move $a0,$t0
$REG_L $ra,$FRAMESIZE-1*$SZREG($sp)
$REG_L $fp,$FRAMESIZE-2*$SZREG($sp)
___
$code.=<<___ if ($flavour =~ /nubi/i);
$REG_L $s3,$FRAMESIZE-11*$SZREG($sp)
$REG_L $s2,$FRAMESIZE-12*$SZREG($sp)
$REG_L $s1,$FRAMESIZE-13*$SZREG($sp)
$REG_L $s0,$FRAMESIZE-14*$SZREG($sp)
$REG_L $gp,$FRAMESIZE-15*$SZREG($sp)
___
$code.=<<___;
jr $ra
$PTR_ADD $sp,$FRAMESIZE
.end AES_set_decrypt_key
___
}}}
######################################################################
# Tables are kept in endian-neutral manner
$code.=<<___;
.rdata
.align 10
AES_Te:
.byte 0xc6,0x63,0x63,0xa5, 0xf8,0x7c,0x7c,0x84 # Te0
.byte 0xee,0x77,0x77,0x99, 0xf6,0x7b,0x7b,0x8d
.byte 0xff,0xf2,0xf2,0x0d, 0xd6,0x6b,0x6b,0xbd
.byte 0xde,0x6f,0x6f,0xb1, 0x91,0xc5,0xc5,0x54
.byte 0x60,0x30,0x30,0x50, 0x02,0x01,0x01,0x03
.byte 0xce,0x67,0x67,0xa9, 0x56,0x2b,0x2b,0x7d
.byte 0xe7,0xfe,0xfe,0x19, 0xb5,0xd7,0xd7,0x62
.byte 0x4d,0xab,0xab,0xe6, 0xec,0x76,0x76,0x9a
.byte 0x8f,0xca,0xca,0x45, 0x1f,0x82,0x82,0x9d
.byte 0x89,0xc9,0xc9,0x40, 0xfa,0x7d,0x7d,0x87
.byte 0xef,0xfa,0xfa,0x15, 0xb2,0x59,0x59,0xeb
.byte 0x8e,0x47,0x47,0xc9, 0xfb,0xf0,0xf0,0x0b
.byte 0x41,0xad,0xad,0xec, 0xb3,0xd4,0xd4,0x67
.byte 0x5f,0xa2,0xa2,0xfd, 0x45,0xaf,0xaf,0xea
.byte 0x23,0x9c,0x9c,0xbf, 0x53,0xa4,0xa4,0xf7
.byte 0xe4,0x72,0x72,0x96, 0x9b,0xc0,0xc0,0x5b
.byte 0x75,0xb7,0xb7,0xc2, 0xe1,0xfd,0xfd,0x1c
.byte 0x3d,0x93,0x93,0xae, 0x4c,0x26,0x26,0x6a
.byte 0x6c,0x36,0x36,0x5a, 0x7e,0x3f,0x3f,0x41
.byte 0xf5,0xf7,0xf7,0x02, 0x83,0xcc,0xcc,0x4f
.byte 0x68,0x34,0x34,0x5c, 0x51,0xa5,0xa5,0xf4
.byte 0xd1,0xe5,0xe5,0x34, 0xf9,0xf1,0xf1,0x08
.byte 0xe2,0x71,0x71,0x93, 0xab,0xd8,0xd8,0x73
.byte 0x62,0x31,0x31,0x53, 0x2a,0x15,0x15,0x3f
.byte 0x08,0x04,0x04,0x0c, 0x95,0xc7,0xc7,0x52
.byte 0x46,0x23,0x23,0x65, 0x9d,0xc3,0xc3,0x5e
.byte 0x30,0x18,0x18,0x28, 0x37,0x96,0x96,0xa1
.byte 0x0a,0x05,0x05,0x0f, 0x2f,0x9a,0x9a,0xb5
.byte 0x0e,0x07,0x07,0x09, 0x24,0x12,0x12,0x36
.byte 0x1b,0x80,0x80,0x9b, 0xdf,0xe2,0xe2,0x3d
.byte 0xcd,0xeb,0xeb,0x26, 0x4e,0x27,0x27,0x69
.byte 0x7f,0xb2,0xb2,0xcd, 0xea,0x75,0x75,0x9f
.byte 0x12,0x09,0x09,0x1b, 0x1d,0x83,0x83,0x9e
.byte 0x58,0x2c,0x2c,0x74, 0x34,0x1a,0x1a,0x2e
.byte 0x36,0x1b,0x1b,0x2d, 0xdc,0x6e,0x6e,0xb2
.byte 0xb4,0x5a,0x5a,0xee, 0x5b,0xa0,0xa0,0xfb
.byte 0xa4,0x52,0x52,0xf6, 0x76,0x3b,0x3b,0x4d
.byte 0xb7,0xd6,0xd6,0x61, 0x7d,0xb3,0xb3,0xce
.byte 0x52,0x29,0x29,0x7b, 0xdd,0xe3,0xe3,0x3e
.byte 0x5e,0x2f,0x2f,0x71, 0x13,0x84,0x84,0x97
.byte 0xa6,0x53,0x53,0xf5, 0xb9,0xd1,0xd1,0x68
.byte 0x00,0x00,0x00,0x00, 0xc1,0xed,0xed,0x2c
.byte 0x40,0x20,0x20,0x60, 0xe3,0xfc,0xfc,0x1f
.byte 0x79,0xb1,0xb1,0xc8, 0xb6,0x5b,0x5b,0xed
.byte 0xd4,0x6a,0x6a,0xbe, 0x8d,0xcb,0xcb,0x46
.byte 0x67,0xbe,0xbe,0xd9, 0x72,0x39,0x39,0x4b
.byte 0x94,0x4a,0x4a,0xde, 0x98,0x4c,0x4c,0xd4
.byte 0xb0,0x58,0x58,0xe8, 0x85,0xcf,0xcf,0x4a
.byte 0xbb,0xd0,0xd0,0x6b, 0xc5,0xef,0xef,0x2a
.byte 0x4f,0xaa,0xaa,0xe5, 0xed,0xfb,0xfb,0x16
.byte 0x86,0x43,0x43,0xc5, 0x9a,0x4d,0x4d,0xd7
.byte 0x66,0x33,0x33,0x55, 0x11,0x85,0x85,0x94
.byte 0x8a,0x45,0x45,0xcf, 0xe9,0xf9,0xf9,0x10
.byte 0x04,0x02,0x02,0x06, 0xfe,0x7f,0x7f,0x81
.byte 0xa0,0x50,0x50,0xf0, 0x78,0x3c,0x3c,0x44
.byte 0x25,0x9f,0x9f,0xba, 0x4b,0xa8,0xa8,0xe3
.byte 0xa2,0x51,0x51,0xf3, 0x5d,0xa3,0xa3,0xfe
.byte 0x80,0x40,0x40,0xc0, 0x05,0x8f,0x8f,0x8a
.byte 0x3f,0x92,0x92,0xad, 0x21,0x9d,0x9d,0xbc
.byte 0x70,0x38,0x38,0x48, 0xf1,0xf5,0xf5,0x04
.byte 0x63,0xbc,0xbc,0xdf, 0x77,0xb6,0xb6,0xc1
.byte 0xaf,0xda,0xda,0x75, 0x42,0x21,0x21,0x63
.byte 0x20,0x10,0x10,0x30, 0xe5,0xff,0xff,0x1a
.byte 0xfd,0xf3,0xf3,0x0e, 0xbf,0xd2,0xd2,0x6d
.byte 0x81,0xcd,0xcd,0x4c, 0x18,0x0c,0x0c,0x14
.byte 0x26,0x13,0x13,0x35, 0xc3,0xec,0xec,0x2f
.byte 0xbe,0x5f,0x5f,0xe1, 0x35,0x97,0x97,0xa2
.byte 0x88,0x44,0x44,0xcc, 0x2e,0x17,0x17,0x39
.byte 0x93,0xc4,0xc4,0x57, 0x55,0xa7,0xa7,0xf2
.byte 0xfc,0x7e,0x7e,0x82, 0x7a,0x3d,0x3d,0x47
.byte 0xc8,0x64,0x64,0xac, 0xba,0x5d,0x5d,0xe7
.byte 0x32,0x19,0x19,0x2b, 0xe6,0x73,0x73,0x95
.byte 0xc0,0x60,0x60,0xa0, 0x19,0x81,0x81,0x98
.byte 0x9e,0x4f,0x4f,0xd1, 0xa3,0xdc,0xdc,0x7f
.byte 0x44,0x22,0x22,0x66, 0x54,0x2a,0x2a,0x7e
.byte 0x3b,0x90,0x90,0xab, 0x0b,0x88,0x88,0x83
.byte 0x8c,0x46,0x46,0xca, 0xc7,0xee,0xee,0x29
.byte 0x6b,0xb8,0xb8,0xd3, 0x28,0x14,0x14,0x3c
.byte 0xa7,0xde,0xde,0x79, 0xbc,0x5e,0x5e,0xe2
.byte 0x16,0x0b,0x0b,0x1d, 0xad,0xdb,0xdb,0x76
.byte 0xdb,0xe0,0xe0,0x3b, 0x64,0x32,0x32,0x56
.byte 0x74,0x3a,0x3a,0x4e, 0x14,0x0a,0x0a,0x1e
.byte 0x92,0x49,0x49,0xdb, 0x0c,0x06,0x06,0x0a
.byte 0x48,0x24,0x24,0x6c, 0xb8,0x5c,0x5c,0xe4
.byte 0x9f,0xc2,0xc2,0x5d, 0xbd,0xd3,0xd3,0x6e
.byte 0x43,0xac,0xac,0xef, 0xc4,0x62,0x62,0xa6
.byte 0x39,0x91,0x91,0xa8, 0x31,0x95,0x95,0xa4
.byte 0xd3,0xe4,0xe4,0x37, 0xf2,0x79,0x79,0x8b
.byte 0xd5,0xe7,0xe7,0x32, 0x8b,0xc8,0xc8,0x43
.byte 0x6e,0x37,0x37,0x59, 0xda,0x6d,0x6d,0xb7
.byte 0x01,0x8d,0x8d,0x8c, 0xb1,0xd5,0xd5,0x64
.byte 0x9c,0x4e,0x4e,0xd2, 0x49,0xa9,0xa9,0xe0
.byte 0xd8,0x6c,0x6c,0xb4, 0xac,0x56,0x56,0xfa
.byte 0xf3,0xf4,0xf4,0x07, 0xcf,0xea,0xea,0x25
.byte 0xca,0x65,0x65,0xaf, 0xf4,0x7a,0x7a,0x8e
.byte 0x47,0xae,0xae,0xe9, 0x10,0x08,0x08,0x18
.byte 0x6f,0xba,0xba,0xd5, 0xf0,0x78,0x78,0x88
.byte 0x4a,0x25,0x25,0x6f, 0x5c,0x2e,0x2e,0x72
.byte 0x38,0x1c,0x1c,0x24, 0x57,0xa6,0xa6,0xf1
.byte 0x73,0xb4,0xb4,0xc7, 0x97,0xc6,0xc6,0x51
.byte 0xcb,0xe8,0xe8,0x23, 0xa1,0xdd,0xdd,0x7c
.byte 0xe8,0x74,0x74,0x9c, 0x3e,0x1f,0x1f,0x21
.byte 0x96,0x4b,0x4b,0xdd, 0x61,0xbd,0xbd,0xdc
.byte 0x0d,0x8b,0x8b,0x86, 0x0f,0x8a,0x8a,0x85
.byte 0xe0,0x70,0x70,0x90, 0x7c,0x3e,0x3e,0x42
.byte 0x71,0xb5,0xb5,0xc4, 0xcc,0x66,0x66,0xaa
.byte 0x90,0x48,0x48,0xd8, 0x06,0x03,0x03,0x05
.byte 0xf7,0xf6,0xf6,0x01, 0x1c,0x0e,0x0e,0x12
.byte 0xc2,0x61,0x61,0xa3, 0x6a,0x35,0x35,0x5f
.byte 0xae,0x57,0x57,0xf9, 0x69,0xb9,0xb9,0xd0
.byte 0x17,0x86,0x86,0x91, 0x99,0xc1,0xc1,0x58
.byte 0x3a,0x1d,0x1d,0x27, 0x27,0x9e,0x9e,0xb9
.byte 0xd9,0xe1,0xe1,0x38, 0xeb,0xf8,0xf8,0x13
.byte 0x2b,0x98,0x98,0xb3, 0x22,0x11,0x11,0x33
.byte 0xd2,0x69,0x69,0xbb, 0xa9,0xd9,0xd9,0x70
.byte 0x07,0x8e,0x8e,0x89, 0x33,0x94,0x94,0xa7
.byte 0x2d,0x9b,0x9b,0xb6, 0x3c,0x1e,0x1e,0x22
.byte 0x15,0x87,0x87,0x92, 0xc9,0xe9,0xe9,0x20
.byte 0x87,0xce,0xce,0x49, 0xaa,0x55,0x55,0xff
.byte 0x50,0x28,0x28,0x78, 0xa5,0xdf,0xdf,0x7a
.byte 0x03,0x8c,0x8c,0x8f, 0x59,0xa1,0xa1,0xf8
.byte 0x09,0x89,0x89,0x80, 0x1a,0x0d,0x0d,0x17
.byte 0x65,0xbf,0xbf,0xda, 0xd7,0xe6,0xe6,0x31
.byte 0x84,0x42,0x42,0xc6, 0xd0,0x68,0x68,0xb8
.byte 0x82,0x41,0x41,0xc3, 0x29,0x99,0x99,0xb0
.byte 0x5a,0x2d,0x2d,0x77, 0x1e,0x0f,0x0f,0x11
.byte 0x7b,0xb0,0xb0,0xcb, 0xa8,0x54,0x54,0xfc
.byte 0x6d,0xbb,0xbb,0xd6, 0x2c,0x16,0x16,0x3a
AES_Td:
.byte 0x51,0xf4,0xa7,0x50, 0x7e,0x41,0x65,0x53 # Td0
.byte 0x1a,0x17,0xa4,0xc3, 0x3a,0x27,0x5e,0x96
.byte 0x3b,0xab,0x6b,0xcb, 0x1f,0x9d,0x45,0xf1
.byte 0xac,0xfa,0x58,0xab, 0x4b,0xe3,0x03,0x93
.byte 0x20,0x30,0xfa,0x55, 0xad,0x76,0x6d,0xf6
.byte 0x88,0xcc,0x76,0x91, 0xf5,0x02,0x4c,0x25
.byte 0x4f,0xe5,0xd7,0xfc, 0xc5,0x2a,0xcb,0xd7
.byte 0x26,0x35,0x44,0x80, 0xb5,0x62,0xa3,0x8f
.byte 0xde,0xb1,0x5a,0x49, 0x25,0xba,0x1b,0x67
.byte 0x45,0xea,0x0e,0x98, 0x5d,0xfe,0xc0,0xe1
.byte 0xc3,0x2f,0x75,0x02, 0x81,0x4c,0xf0,0x12
.byte 0x8d,0x46,0x97,0xa3, 0x6b,0xd3,0xf9,0xc6
.byte 0x03,0x8f,0x5f,0xe7, 0x15,0x92,0x9c,0x95
.byte 0xbf,0x6d,0x7a,0xeb, 0x95,0x52,0x59,0xda
.byte 0xd4,0xbe,0x83,0x2d, 0x58,0x74,0x21,0xd3
.byte 0x49,0xe0,0x69,0x29, 0x8e,0xc9,0xc8,0x44
.byte 0x75,0xc2,0x89,0x6a, 0xf4,0x8e,0x79,0x78
.byte 0x99,0x58,0x3e,0x6b, 0x27,0xb9,0x71,0xdd
.byte 0xbe,0xe1,0x4f,0xb6, 0xf0,0x88,0xad,0x17
.byte 0xc9,0x20,0xac,0x66, 0x7d,0xce,0x3a,0xb4
.byte 0x63,0xdf,0x4a,0x18, 0xe5,0x1a,0x31,0x82
.byte 0x97,0x51,0x33,0x60, 0x62,0x53,0x7f,0x45
.byte 0xb1,0x64,0x77,0xe0, 0xbb,0x6b,0xae,0x84
.byte 0xfe,0x81,0xa0,0x1c, 0xf9,0x08,0x2b,0x94
.byte 0x70,0x48,0x68,0x58, 0x8f,0x45,0xfd,0x19
.byte 0x94,0xde,0x6c,0x87, 0x52,0x7b,0xf8,0xb7
.byte 0xab,0x73,0xd3,0x23, 0x72,0x4b,0x02,0xe2
.byte 0xe3,0x1f,0x8f,0x57, 0x66,0x55,0xab,0x2a
.byte 0xb2,0xeb,0x28,0x07, 0x2f,0xb5,0xc2,0x03
.byte 0x86,0xc5,0x7b,0x9a, 0xd3,0x37,0x08,0xa5
.byte 0x30,0x28,0x87,0xf2, 0x23,0xbf,0xa5,0xb2
.byte 0x02,0x03,0x6a,0xba, 0xed,0x16,0x82,0x5c
.byte 0x8a,0xcf,0x1c,0x2b, 0xa7,0x79,0xb4,0x92
.byte 0xf3,0x07,0xf2,0xf0, 0x4e,0x69,0xe2,0xa1
.byte 0x65,0xda,0xf4,0xcd, 0x06,0x05,0xbe,0xd5
.byte 0xd1,0x34,0x62,0x1f, 0xc4,0xa6,0xfe,0x8a
.byte 0x34,0x2e,0x53,0x9d, 0xa2,0xf3,0x55,0xa0
.byte 0x05,0x8a,0xe1,0x32, 0xa4,0xf6,0xeb,0x75
.byte 0x0b,0x83,0xec,0x39, 0x40,0x60,0xef,0xaa
.byte 0x5e,0x71,0x9f,0x06, 0xbd,0x6e,0x10,0x51
.byte 0x3e,0x21,0x8a,0xf9, 0x96,0xdd,0x06,0x3d
.byte 0xdd,0x3e,0x05,0xae, 0x4d,0xe6,0xbd,0x46
.byte 0x91,0x54,0x8d,0xb5, 0x71,0xc4,0x5d,0x05
.byte 0x04,0x06,0xd4,0x6f, 0x60,0x50,0x15,0xff
.byte 0x19,0x98,0xfb,0x24, 0xd6,0xbd,0xe9,0x97
.byte 0x89,0x40,0x43,0xcc, 0x67,0xd9,0x9e,0x77
.byte 0xb0,0xe8,0x42,0xbd, 0x07,0x89,0x8b,0x88
.byte 0xe7,0x19,0x5b,0x38, 0x79,0xc8,0xee,0xdb
.byte 0xa1,0x7c,0x0a,0x47, 0x7c,0x42,0x0f,0xe9
.byte 0xf8,0x84,0x1e,0xc9, 0x00,0x00,0x00,0x00
.byte 0x09,0x80,0x86,0x83, 0x32,0x2b,0xed,0x48
.byte 0x1e,0x11,0x70,0xac, 0x6c,0x5a,0x72,0x4e
.byte 0xfd,0x0e,0xff,0xfb, 0x0f,0x85,0x38,0x56
.byte 0x3d,0xae,0xd5,0x1e, 0x36,0x2d,0x39,0x27
.byte 0x0a,0x0f,0xd9,0x64, 0x68,0x5c,0xa6,0x21
.byte 0x9b,0x5b,0x54,0xd1, 0x24,0x36,0x2e,0x3a
.byte 0x0c,0x0a,0x67,0xb1, 0x93,0x57,0xe7,0x0f
.byte 0xb4,0xee,0x96,0xd2, 0x1b,0x9b,0x91,0x9e
.byte 0x80,0xc0,0xc5,0x4f, 0x61,0xdc,0x20,0xa2
.byte 0x5a,0x77,0x4b,0x69, 0x1c,0x12,0x1a,0x16
.byte 0xe2,0x93,0xba,0x0a, 0xc0,0xa0,0x2a,0xe5
.byte 0x3c,0x22,0xe0,0x43, 0x12,0x1b,0x17,0x1d
.byte 0x0e,0x09,0x0d,0x0b, 0xf2,0x8b,0xc7,0xad
.byte 0x2d,0xb6,0xa8,0xb9, 0x14,0x1e,0xa9,0xc8
.byte 0x57,0xf1,0x19,0x85, 0xaf,0x75,0x07,0x4c
.byte 0xee,0x99,0xdd,0xbb, 0xa3,0x7f,0x60,0xfd
.byte 0xf7,0x01,0x26,0x9f, 0x5c,0x72,0xf5,0xbc
.byte 0x44,0x66,0x3b,0xc5, 0x5b,0xfb,0x7e,0x34
.byte 0x8b,0x43,0x29,0x76, 0xcb,0x23,0xc6,0xdc
.byte 0xb6,0xed,0xfc,0x68, 0xb8,0xe4,0xf1,0x63
.byte 0xd7,0x31,0xdc,0xca, 0x42,0x63,0x85,0x10
.byte 0x13,0x97,0x22,0x40, 0x84,0xc6,0x11,0x20
.byte 0x85,0x4a,0x24,0x7d, 0xd2,0xbb,0x3d,0xf8
.byte 0xae,0xf9,0x32,0x11, 0xc7,0x29,0xa1,0x6d
.byte 0x1d,0x9e,0x2f,0x4b, 0xdc,0xb2,0x30,0xf3
.byte 0x0d,0x86,0x52,0xec, 0x77,0xc1,0xe3,0xd0
.byte 0x2b,0xb3,0x16,0x6c, 0xa9,0x70,0xb9,0x99
.byte 0x11,0x94,0x48,0xfa, 0x47,0xe9,0x64,0x22
.byte 0xa8,0xfc,0x8c,0xc4, 0xa0,0xf0,0x3f,0x1a
.byte 0x56,0x7d,0x2c,0xd8, 0x22,0x33,0x90,0xef
.byte 0x87,0x49,0x4e,0xc7, 0xd9,0x38,0xd1,0xc1
.byte 0x8c,0xca,0xa2,0xfe, 0x98,0xd4,0x0b,0x36
.byte 0xa6,0xf5,0x81,0xcf, 0xa5,0x7a,0xde,0x28
.byte 0xda,0xb7,0x8e,0x26, 0x3f,0xad,0xbf,0xa4
.byte 0x2c,0x3a,0x9d,0xe4, 0x50,0x78,0x92,0x0d
.byte 0x6a,0x5f,0xcc,0x9b, 0x54,0x7e,0x46,0x62
.byte 0xf6,0x8d,0x13,0xc2, 0x90,0xd8,0xb8,0xe8
.byte 0x2e,0x39,0xf7,0x5e, 0x82,0xc3,0xaf,0xf5
.byte 0x9f,0x5d,0x80,0xbe, 0x69,0xd0,0x93,0x7c
.byte 0x6f,0xd5,0x2d,0xa9, 0xcf,0x25,0x12,0xb3
.byte 0xc8,0xac,0x99,0x3b, 0x10,0x18,0x7d,0xa7
.byte 0xe8,0x9c,0x63,0x6e, 0xdb,0x3b,0xbb,0x7b
.byte 0xcd,0x26,0x78,0x09, 0x6e,0x59,0x18,0xf4
.byte 0xec,0x9a,0xb7,0x01, 0x83,0x4f,0x9a,0xa8
.byte 0xe6,0x95,0x6e,0x65, 0xaa,0xff,0xe6,0x7e
.byte 0x21,0xbc,0xcf,0x08, 0xef,0x15,0xe8,0xe6
.byte 0xba,0xe7,0x9b,0xd9, 0x4a,0x6f,0x36,0xce
.byte 0xea,0x9f,0x09,0xd4, 0x29,0xb0,0x7c,0xd6
.byte 0x31,0xa4,0xb2,0xaf, 0x2a,0x3f,0x23,0x31
.byte 0xc6,0xa5,0x94,0x30, 0x35,0xa2,0x66,0xc0
.byte 0x74,0x4e,0xbc,0x37, 0xfc,0x82,0xca,0xa6
.byte 0xe0,0x90,0xd0,0xb0, 0x33,0xa7,0xd8,0x15
.byte 0xf1,0x04,0x98,0x4a, 0x41,0xec,0xda,0xf7
.byte 0x7f,0xcd,0x50,0x0e, 0x17,0x91,0xf6,0x2f
.byte 0x76,0x4d,0xd6,0x8d, 0x43,0xef,0xb0,0x4d
.byte 0xcc,0xaa,0x4d,0x54, 0xe4,0x96,0x04,0xdf
.byte 0x9e,0xd1,0xb5,0xe3, 0x4c,0x6a,0x88,0x1b
.byte 0xc1,0x2c,0x1f,0xb8, 0x46,0x65,0x51,0x7f
.byte 0x9d,0x5e,0xea,0x04, 0x01,0x8c,0x35,0x5d
.byte 0xfa,0x87,0x74,0x73, 0xfb,0x0b,0x41,0x2e
.byte 0xb3,0x67,0x1d,0x5a, 0x92,0xdb,0xd2,0x52
.byte 0xe9,0x10,0x56,0x33, 0x6d,0xd6,0x47,0x13
.byte 0x9a,0xd7,0x61,0x8c, 0x37,0xa1,0x0c,0x7a
.byte 0x59,0xf8,0x14,0x8e, 0xeb,0x13,0x3c,0x89
.byte 0xce,0xa9,0x27,0xee, 0xb7,0x61,0xc9,0x35
.byte 0xe1,0x1c,0xe5,0xed, 0x7a,0x47,0xb1,0x3c
.byte 0x9c,0xd2,0xdf,0x59, 0x55,0xf2,0x73,0x3f
.byte 0x18,0x14,0xce,0x79, 0x73,0xc7,0x37,0xbf
.byte 0x53,0xf7,0xcd,0xea, 0x5f,0xfd,0xaa,0x5b
.byte 0xdf,0x3d,0x6f,0x14, 0x78,0x44,0xdb,0x86
.byte 0xca,0xaf,0xf3,0x81, 0xb9,0x68,0xc4,0x3e
.byte 0x38,0x24,0x34,0x2c, 0xc2,0xa3,0x40,0x5f
.byte 0x16,0x1d,0xc3,0x72, 0xbc,0xe2,0x25,0x0c
.byte 0x28,0x3c,0x49,0x8b, 0xff,0x0d,0x95,0x41
.byte 0x39,0xa8,0x01,0x71, 0x08,0x0c,0xb3,0xde
.byte 0xd8,0xb4,0xe4,0x9c, 0x64,0x56,0xc1,0x90
.byte 0x7b,0xcb,0x84,0x61, 0xd5,0x32,0xb6,0x70
.byte 0x48,0x6c,0x5c,0x74, 0xd0,0xb8,0x57,0x42
.byte 0x52, 0x09, 0x6a, 0xd5, 0x30, 0x36, 0xa5, 0x38 # Td4
.byte 0xbf, 0x40, 0xa3, 0x9e, 0x81, 0xf3, 0xd7, 0xfb
.byte 0x7c, 0xe3, 0x39, 0x82, 0x9b, 0x2f, 0xff, 0x87
.byte 0x34, 0x8e, 0x43, 0x44, 0xc4, 0xde, 0xe9, 0xcb
.byte 0x54, 0x7b, 0x94, 0x32, 0xa6, 0xc2, 0x23, 0x3d
.byte 0xee, 0x4c, 0x95, 0x0b, 0x42, 0xfa, 0xc3, 0x4e
.byte 0x08, 0x2e, 0xa1, 0x66, 0x28, 0xd9, 0x24, 0xb2
.byte 0x76, 0x5b, 0xa2, 0x49, 0x6d, 0x8b, 0xd1, 0x25
.byte 0x72, 0xf8, 0xf6, 0x64, 0x86, 0x68, 0x98, 0x16
.byte 0xd4, 0xa4, 0x5c, 0xcc, 0x5d, 0x65, 0xb6, 0x92
.byte 0x6c, 0x70, 0x48, 0x50, 0xfd, 0xed, 0xb9, 0xda
.byte 0x5e, 0x15, 0x46, 0x57, 0xa7, 0x8d, 0x9d, 0x84
.byte 0x90, 0xd8, 0xab, 0x00, 0x8c, 0xbc, 0xd3, 0x0a
.byte 0xf7, 0xe4, 0x58, 0x05, 0xb8, 0xb3, 0x45, 0x06
.byte 0xd0, 0x2c, 0x1e, 0x8f, 0xca, 0x3f, 0x0f, 0x02
.byte 0xc1, 0xaf, 0xbd, 0x03, 0x01, 0x13, 0x8a, 0x6b
.byte 0x3a, 0x91, 0x11, 0x41, 0x4f, 0x67, 0xdc, 0xea
.byte 0x97, 0xf2, 0xcf, 0xce, 0xf0, 0xb4, 0xe6, 0x73
.byte 0x96, 0xac, 0x74, 0x22, 0xe7, 0xad, 0x35, 0x85
.byte 0xe2, 0xf9, 0x37, 0xe8, 0x1c, 0x75, 0xdf, 0x6e
.byte 0x47, 0xf1, 0x1a, 0x71, 0x1d, 0x29, 0xc5, 0x89
.byte 0x6f, 0xb7, 0x62, 0x0e, 0xaa, 0x18, 0xbe, 0x1b
.byte 0xfc, 0x56, 0x3e, 0x4b, 0xc6, 0xd2, 0x79, 0x20
.byte 0x9a, 0xdb, 0xc0, 0xfe, 0x78, 0xcd, 0x5a, 0xf4
.byte 0x1f, 0xdd, 0xa8, 0x33, 0x88, 0x07, 0xc7, 0x31
.byte 0xb1, 0x12, 0x10, 0x59, 0x27, 0x80, 0xec, 0x5f
.byte 0x60, 0x51, 0x7f, 0xa9, 0x19, 0xb5, 0x4a, 0x0d
.byte 0x2d, 0xe5, 0x7a, 0x9f, 0x93, 0xc9, 0x9c, 0xef
.byte 0xa0, 0xe0, 0x3b, 0x4d, 0xae, 0x2a, 0xf5, 0xb0
.byte 0xc8, 0xeb, 0xbb, 0x3c, 0x83, 0x53, 0x99, 0x61
.byte 0x17, 0x2b, 0x04, 0x7e, 0xba, 0x77, 0xd6, 0x26
.byte 0xe1, 0x69, 0x14, 0x63, 0x55, 0x21, 0x0c, 0x7d
AES_Te4:
.byte 0x63, 0x7c, 0x77, 0x7b, 0xf2, 0x6b, 0x6f, 0xc5 # Te4
.byte 0x30, 0x01, 0x67, 0x2b, 0xfe, 0xd7, 0xab, 0x76
.byte 0xca, 0x82, 0xc9, 0x7d, 0xfa, 0x59, 0x47, 0xf0
.byte 0xad, 0xd4, 0xa2, 0xaf, 0x9c, 0xa4, 0x72, 0xc0
.byte 0xb7, 0xfd, 0x93, 0x26, 0x36, 0x3f, 0xf7, 0xcc
.byte 0x34, 0xa5, 0xe5, 0xf1, 0x71, 0xd8, 0x31, 0x15
.byte 0x04, 0xc7, 0x23, 0xc3, 0x18, 0x96, 0x05, 0x9a
.byte 0x07, 0x12, 0x80, 0xe2, 0xeb, 0x27, 0xb2, 0x75
.byte 0x09, 0x83, 0x2c, 0x1a, 0x1b, 0x6e, 0x5a, 0xa0
.byte 0x52, 0x3b, 0xd6, 0xb3, 0x29, 0xe3, 0x2f, 0x84
.byte 0x53, 0xd1, 0x00, 0xed, 0x20, 0xfc, 0xb1, 0x5b
.byte 0x6a, 0xcb, 0xbe, 0x39, 0x4a, 0x4c, 0x58, 0xcf
.byte 0xd0, 0xef, 0xaa, 0xfb, 0x43, 0x4d, 0x33, 0x85
.byte 0x45, 0xf9, 0x02, 0x7f, 0x50, 0x3c, 0x9f, 0xa8
.byte 0x51, 0xa3, 0x40, 0x8f, 0x92, 0x9d, 0x38, 0xf5
.byte 0xbc, 0xb6, 0xda, 0x21, 0x10, 0xff, 0xf3, 0xd2
.byte 0xcd, 0x0c, 0x13, 0xec, 0x5f, 0x97, 0x44, 0x17
.byte 0xc4, 0xa7, 0x7e, 0x3d, 0x64, 0x5d, 0x19, 0x73
.byte 0x60, 0x81, 0x4f, 0xdc, 0x22, 0x2a, 0x90, 0x88
.byte 0x46, 0xee, 0xb8, 0x14, 0xde, 0x5e, 0x0b, 0xdb
.byte 0xe0, 0x32, 0x3a, 0x0a, 0x49, 0x06, 0x24, 0x5c
.byte 0xc2, 0xd3, 0xac, 0x62, 0x91, 0x95, 0xe4, 0x79
.byte 0xe7, 0xc8, 0x37, 0x6d, 0x8d, 0xd5, 0x4e, 0xa9
.byte 0x6c, 0x56, 0xf4, 0xea, 0x65, 0x7a, 0xae, 0x08
.byte 0xba, 0x78, 0x25, 0x2e, 0x1c, 0xa6, 0xb4, 0xc6
.byte 0xe8, 0xdd, 0x74, 0x1f, 0x4b, 0xbd, 0x8b, 0x8a
.byte 0x70, 0x3e, 0xb5, 0x66, 0x48, 0x03, 0xf6, 0x0e
.byte 0x61, 0x35, 0x57, 0xb9, 0x86, 0xc1, 0x1d, 0x9e
.byte 0xe1, 0xf8, 0x98, 0x11, 0x69, 0xd9, 0x8e, 0x94
.byte 0x9b, 0x1e, 0x87, 0xe9, 0xce, 0x55, 0x28, 0xdf
.byte 0x8c, 0xa1, 0x89, 0x0d, 0xbf, 0xe6, 0x42, 0x68
.byte 0x41, 0x99, 0x2d, 0x0f, 0xb0, 0x54, 0xbb, 0x16
.byte 0x01,0x00,0x00,0x00, 0x02,0x00,0x00,0x00 # rcon
.byte 0x04,0x00,0x00,0x00, 0x08,0x00,0x00,0x00
.byte 0x10,0x00,0x00,0x00, 0x20,0x00,0x00,0x00
.byte 0x40,0x00,0x00,0x00, 0x80,0x00,0x00,0x00
.byte 0x1B,0x00,0x00,0x00, 0x36,0x00,0x00,0x00
___
foreach (split("\n",$code)) {
s/\`([^\`]*)\`/eval $1/ge;
# made-up _instructions, _xtr, _ins, _ror and _bias, cope
# with byte order dependencies...
if (/^\s+_/) {
s/(_[a-z]+\s+)(\$[0-9]+),([^,]+)(#.*)*$/$1$2,$2,$3/;
s/_xtr\s+(\$[0-9]+),(\$[0-9]+),([0-9]+(\-2)*)/
sprintf("srl\t$1,$2,%d",$big_endian ? eval($3)
: eval("24-$3"))/e or
s/_ins\s+(\$[0-9]+),(\$[0-9]+),([0-9]+)/
sprintf("sll\t$1,$2,%d",$big_endian ? eval($3)
: eval("24-$3"))/e or
s/_ins2\s+(\$[0-9]+),(\$[0-9]+),([0-9]+)/
sprintf("ins\t$1,$2,%d,8",$big_endian ? eval($3)
: eval("24-$3"))/e or
s/_ror\s+(\$[0-9]+),(\$[0-9]+),(\-?[0-9]+)/
sprintf("srl\t$1,$2,%d",$big_endian ? eval($3)
: eval("$3*-1"))/e or
s/_bias\s+(\$[0-9]+),(\$[0-9]+),([0-9]+)/
sprintf("sll\t$1,$2,%d",$big_endian ? eval($3)
: eval("($3-16)&31"))/e;
s/srl\s+(\$[0-9]+),(\$[0-9]+),\-([0-9]+)/
sprintf("sll\t$1,$2,$3")/e or
s/srl\s+(\$[0-9]+),(\$[0-9]+),0/
sprintf("and\t$1,$2,0xff")/e or
s/(sll\s+\$[0-9]+,\$[0-9]+,0)/#$1/;
}
# convert lwl/lwr and swr/swl to little-endian order
if (!$big_endian && /^\s+[sl]w[lr]\s+/) {
s/([sl]wl.*)([0-9]+)\((\$[0-9]+)\)/
sprintf("$1%d($3)",eval("$2-$2%4+($2%4-1)&3"))/e or
s/([sl]wr.*)([0-9]+)\((\$[0-9]+)\)/
sprintf("$1%d($3)",eval("$2-$2%4+($2%4+1)&3"))/e;
}
if (!$big_endian) {
s/(rotr\s+\$[0-9]+,\$[0-9]+),([0-9]+)/sprintf("$1,%d",32-$2)/e;
s/(ext\s+\$[0-9]+,\$[0-9]+),([0-9]+),8/sprintf("$1,%d,8",24-$2)/e;
}
print $_,"\n";
}
close STDOUT or die "error closing STDOUT";
| 24.696874 | 79 | 0.635765 |
73f7d583d44ed215f04caa54749075e65d3c8ee6 | 1,557 | t | Perl | t/save_and_load.t | ronsavage/Tree-Persist | 122f07139446b088ac42b409fdc927933797a393 | [
"Artistic-1.0"
]
| null | null | null | t/save_and_load.t | ronsavage/Tree-Persist | 122f07139446b088ac42b409fdc927933797a393 | [
"Artistic-1.0"
]
| 2 | 2016-04-25T10:32:25.000Z | 2016-08-07T03:15:45.000Z | t/save_and_load.t | ronsavage/Tree-Persist | 122f07139446b088ac42b409fdc927933797a393 | [
"Artistic-1.0"
]
| 1 | 2016-05-05T13:06:07.000Z | 2016-05-05T13:06:07.000Z | use strict;
use warnings;
use File::Spec::Functions qw( catfile );
use File::Temp;
use Test::File;
use Test::File::Contents;
use Test::More;
# ---------------------------------------------
eval "use XML::Parser";
plan skip_all => "XML::Parser required for testing File plugin" if $@;
plan tests => 7;
# The EXLOCK option is for BSD-based systems.
my $in_dir = catfile( qw( t datafiles ) );
my $out_dir = File::Temp -> newdir('temp.XXXX', CLEANUP => 1, EXLOCK => 0, TMPDIR => 1);
plan skip_all => "Temp dir is un-writable" if (! -w $out_dir);
use_ok( 'Tree' );
my $CLASS = 'Tree::Persist';
use_ok( $CLASS ) || Test::More->builder->BAILOUT( "Cannot load $CLASS" );
my $file_name = catfile( $out_dir, 'save4.xml' );
{
file_not_exists_ok( $file_name, "$file_name file doesn't exist yet" );
my($tree) =
Tree->new( 'A' )->add_child
(
Tree->new( 'B' ),
Tree->new( 'C' )->add_child
(
Tree->new( 'D' ),
),
Tree->new( 'E' ),
);
my($writer) = $CLASS -> create_datastore
({
class => 'Tree::Persist::File::XMLWithSingleQuotes',
filename => $file_name,
tree => $tree,
});
file_exists_ok( $file_name, "$file_name file exists");
}
{
my($reader) = $CLASS -> connect
({
class => 'Tree::Persist::File::XMLWithSingleQuotes',
filename => $file_name,
});
my($tree) = $reader -> tree();
my(@kids) = $tree -> children;
isa_ok( $tree, 'Tree' );
is( $tree->value, 'A', "The tree's root value was loaded correctly" );
is( $kids[2] -> value, 'E', "The tree's 3rd child value was loaded correctly" );
}
| 21.625 | 90 | 0.590238 |
73e86466db4391b165a578b986e7200686bf8963 | 1,052 | pm | Perl | lib/Google/Ads/GoogleAds/V8/Common/MobileApplicationInfo.pm | googleads/google-ads-perl | 3ee6c09e11330fea1e6a0c9ee9f837e5e36d8177 | [
"Apache-2.0"
]
| 19 | 2019-06-21T00:43:57.000Z | 2022-03-29T14:23:01.000Z | lib/Google/Ads/GoogleAds/V8/Common/MobileApplicationInfo.pm | googleads/google-ads-perl | 3ee6c09e11330fea1e6a0c9ee9f837e5e36d8177 | [
"Apache-2.0"
]
| 16 | 2020-03-04T07:44:53.000Z | 2021-12-15T23:06:23.000Z | lib/Google/Ads/GoogleAds/V8/Common/MobileApplicationInfo.pm | googleads/google-ads-perl | 3ee6c09e11330fea1e6a0c9ee9f837e5e36d8177 | [
"Apache-2.0"
]
| 9 | 2020-02-28T03:00:48.000Z | 2021-11-10T14:23:02.000Z | # Copyright 2020, Google LLC
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
package Google::Ads::GoogleAds::V8::Common::MobileApplicationInfo;
use strict;
use warnings;
use base qw(Google::Ads::GoogleAds::BaseEntity);
use Google::Ads::GoogleAds::Utils::GoogleAdsHelper;
sub new {
my ($class, $args) = @_;
my $self = {
appId => $args->{appId},
name => $args->{name}};
# Delete the unassigned fields in this object for a more concise JSON payload
remove_unassigned_fields($self, $args);
bless $self, $class;
return $self;
}
1;
| 28.432432 | 79 | 0.722433 |
ed0706a1669b10451d629a5cc7644dc7ca71d7e8 | 6,088 | pm | Perl | modules/Bio/EnsEMBL/Variation/Pipeline/EquivalentAlleles/EquivalentAlleles_conf.pm | diegomscoelho/ensembl-variation | ac8178e987511a0bd2357334150c4271e6698896 | [
"Apache-2.0"
]
| 23 | 2015-03-12T13:38:22.000Z | 2021-11-15T10:10:14.000Z | modules/Bio/EnsEMBL/Variation/Pipeline/EquivalentAlleles/EquivalentAlleles_conf.pm | diegomscoelho/ensembl-variation | ac8178e987511a0bd2357334150c4271e6698896 | [
"Apache-2.0"
]
| 674 | 2015-02-09T15:50:52.000Z | 2022-03-30T10:23:40.000Z | modules/Bio/EnsEMBL/Variation/Pipeline/EquivalentAlleles/EquivalentAlleles_conf.pm | diegomscoelho/ensembl-variation | ac8178e987511a0bd2357334150c4271e6698896 | [
"Apache-2.0"
]
| 97 | 2015-02-05T15:48:14.000Z | 2022-02-08T17:45:41.000Z | =head1 LICENSE
Copyright [1999-2015] Wellcome Trust Sanger Institute and the EMBL-European Bioinformatics Institute
Copyright [2016-2021] EMBL-European Bioinformatics Institute
Licensed under the Apache License, Version 2.0 (the "License");
you may not use this file except in compliance with the License.
You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software
distributed under the License is distributed on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
See the License for the specific language governing permissions and
limitations under the License.
=cut
=head1 CONTACT
Please email comments or questions to the public Ensembl
developers list at <http://lists.ensembl.org/mailman/listinfo/dev>.
Questions may also be sent to the Ensembl help desk at
<http://www.ensembl.org/Help/Contact>.
=cut
package Bio::EnsEMBL::Variation::Pipeline::EquivalentAlleles::EquivalentAlleles_conf;
use strict;
use warnings;
use base ('Bio::EnsEMBL::Hive::PipeConfig::HiveGeneric_conf');
sub default_options {
my ($self) = @_;
return {
# general pipeline options that you should change to suit your environment
hive_force_init => 1,
hive_use_param_stack => 0,
hive_use_triggers => 0,
hive_auto_rebalance_semaphores => 0,
hive_no_init => 0,
hive_debug_init => 1,
hive_default_max_retry_count => 0,
# the location of your checkout of the ensembl API (the hive looks for SQL files here)
ensembl_cvs_root_dir => $ENV{'ENSEMBL_ROOT_DIR'} || $self->o('ensembl_cvs_root_dir'),
hive_root_dir => $self->o('ensembl_cvs_root_dir') . '/ensembl-hive',
pipeline_name => 'equivalent_alleles',
# a directory to keep hive output files and your registry file, you should
# create this if it doesn't exist
pipeline_dir => $self->o('pipeline_dir'),
# a directory where hive workers will dump STDOUT and STDERR for their jobs
output_dir => $self->o('pipeline_dir').'/hive_output',
# a standard ensembl registry file containing connection parameters
# for your target database(s)
reg_file => $self->o('pipeline_dir').'/ensembl.registry',
# configuration for the various resource options used in the pipeline
# EBI farm users should either change these here, or override them on the
# command line to suit the EBI farm.
default_lsf_options => '-qproduction -R"select[mem>2000] rusage[mem=2000]" -M2000',
medium_lsf_options => '-qproduction -R"select[mem>4000] rusage[mem=4000]" -M4000',
# size of region to be checked in a single job
region_size => 100000000,
# size of bin to be checked for equivalent alleles
bin_size => 5000000,
## overlap between checking bins
overlap => 1000,
# number of workers used for the parallelisable analysis
capacity => 30,
# connection parameters for the hive database, you should supply the hive_db_password
# option on the command line to init_pipeline.pl (parameters for the target database
# should be set in the registry file defined above)
# init_pipeline.pl will create the hive database on this machine, naming it
# <username>_<pipeline_name>, and will drop any existing database with this
# name
hive_db_host => 'mysql-ens-var-prod-1',
hive_db_port => 4449,
hive_db_user => 'ensadmin',
pipeline_db => {
-host => $self->o('hive_db_host'),
-port => $self->o('hive_db_port'),
-user => $self->o('hive_db_user'),
-pass => $self->o('hive_db_password'),
-dbname => $ENV{'USER'} . '_ehive_' . $self->o('pipeline_name') . '_' . $self->o('ensembl_release') . '_' . $self->o('assembly') . '_' . $self->o('species'),
-driver => 'mysql',
},
};
}
sub resource_classes {
my ($self) = @_;
return {
'default' => { 'LSF' => $self->o('default_lsf_options') },
'medium' => { 'LSF' => $self->o('medium_lsf_options') },
};
}
sub pipeline_analyses {
my ($self) = @_;
my @common_params = (
ensembl_registry => $self->o('reg_file'),
species => $self->o('species'),
pipeline_dir => $self->o('pipeline_dir'),
);
my @analyses;
push @analyses, (
{ -logic_name => 'init_equivalent_alleles',
-module => 'Bio::EnsEMBL::Variation::Pipeline::EquivalentAlleles::InitEquivalentAlleles',
-parameters => {
region_size => $self->o('region_size'),
overlap => $self->o('overlap'),
@common_params,
},
-input_ids => [{}],
-hive_capacity => -1,
-rc_name => 'medium',
-flow_into => {
2 => [ 'find_equivalent_alleles' ],
3 => [ 'finish_equivalent_alleles' ]
}
},
{ -logic_name => 'find_equivalent_alleles',
-module => 'Bio::EnsEMBL::Variation::Pipeline::EquivalentAlleles::FindEquivalentAlleles',
-parameters => {
overlap => $self->o('overlap'),
bin_size => $self->o('bin_size'),
@common_params,
},
-input_ids => [],
-hive_capacity => $self->o('capacity'),
-max_retry_count => 0,
-rc_name => 'default',
-wait_for => [ 'init_equivalent_alleles' ],
-flow_into => {},
},
{ -logic_name => 'finish_equivalent_alleles',
-module => 'Bio::EnsEMBL::Variation::Pipeline::EquivalentAlleles::FinishEquivalentAlleles',
-parameters => {
@common_params,
},
-input_ids => [],
-hive_capacity => -1,
-rc_name => 'default',
-wait_for => [ 'init_equivalent_alleles','find_equivalent_alleles' ],
-flow_into => {},
},
);
return \@analyses;
}
1;
| 32.382979 | 165 | 0.613995 |
ed3b544f7fe320ef7547f129f6c307a1ce384e32 | 1,036 | pm | Perl | lib/Azure/Storage/Blob/Client/Call/GetBlobProperties.pm | ureesoriano/Azure-Storage-Blob-Client | ab2dcde153633e9c2bf24f122affe7f5633d0316 | [
"Apache-2.0"
]
| 1 | 2020-06-16T22:59:14.000Z | 2020-06-16T22:59:14.000Z | lib/Azure/Storage/Blob/Client/Call/GetBlobProperties.pm | ureesoriano/Azure-Storage-Blob-Client | ab2dcde153633e9c2bf24f122affe7f5633d0316 | [
"Apache-2.0"
]
| 3 | 2019-10-25T14:04:18.000Z | 2020-11-10T11:20:02.000Z | lib/Azure/Storage/Blob/Client/Call/GetBlobProperties.pm | ureesoriano/Azure-Storage-Blob-Client | ab2dcde153633e9c2bf24f122affe7f5633d0316 | [
"Apache-2.0"
]
| 1 | 2019-10-23T22:14:59.000Z | 2019-10-23T22:14:59.000Z | package Azure::Storage::Blob::Client::Call::GetBlobProperties;
use Moose;
use Azure::Storage::Blob::Client::Meta::Attribute::Custom::Trait::HeaderParameter;
has operation => (is => 'ro', init_arg => undef, default => 'GetBlobProperties');
has endpoint => (is => 'ro', init_arg => undef, lazy => 1, default => sub {
my $self = shift;
return sprintf(
'https://%s.blob.core.windows.net/%s/%s',
$self->account_name,
$self->container,
$self->blob_name,
);
});
has method => (is => 'ro', init_arg => undef, default => 'HEAD');
with 'Azure::Storage::Blob::Client::Call';
has account_name => (is => 'ro', isa => 'Str', required => 1);
has api_version => (is => 'ro', isa => 'Str', traits => ['HeaderParameter'], header_name => 'x-ms-version', required => 1);
has container => (is => 'ro', isa => 'Str', required => 1);
has blob_name => (is => 'ro', isa => 'Str', required => 1);
sub parse_response {
my ($self, $response) = @_;
return { $response->headers->flatten() };
}
__PACKAGE__->meta->make_immutable();
1;
| 32.375 | 123 | 0.61583 |
73ec18d1e2f9d1bd8934a944fa6db9b598a5f45d | 309 | pm | Perl | auto-lib/Azure/Devices/SharedAccessSignatureAuthorizationRule[AccessRightsDescription].pm | pplu/azure-sdk-perl | 26cbef2d926f571bc1617c26338c106856f95568 | [
"Apache-2.0"
]
| null | null | null | auto-lib/Azure/Devices/SharedAccessSignatureAuthorizationRule[AccessRightsDescription].pm | pplu/azure-sdk-perl | 26cbef2d926f571bc1617c26338c106856f95568 | [
"Apache-2.0"
]
| null | null | null | auto-lib/Azure/Devices/SharedAccessSignatureAuthorizationRule[AccessRightsDescription].pm | pplu/azure-sdk-perl | 26cbef2d926f571bc1617c26338c106856f95568 | [
"Apache-2.0"
]
| 1 | 2021-04-08T15:26:39.000Z | 2021-04-08T15:26:39.000Z | package Azure::Devices::SharedAccessSignatureAuthorizationRule[AccessRightsDescription];
use Moose;
has 'keyName' => (is => 'ro', isa => 'Str' );
has 'primaryKey' => (is => 'ro', isa => 'Str' );
has 'rights' => (is => 'ro', isa => 'Str' );
has 'secondaryKey' => (is => 'ro', isa => 'Str' );
1;
| 34.333333 | 88 | 0.569579 |
ed0e031fd428c37ec090726458168506bf39c4b3 | 621 | t | Perl | ctest/multipart.t | mchaisso/mcpbblasr | 6c92959ba61adfd234a4f35849490709284105de | [
"BSD-3-Clause-Clear"
]
| null | null | null | ctest/multipart.t | mchaisso/mcpbblasr | 6c92959ba61adfd234a4f35849490709284105de | [
"BSD-3-Clause-Clear"
]
| null | null | null | ctest/multipart.t | mchaisso/mcpbblasr | 6c92959ba61adfd234a4f35849490709284105de | [
"BSD-3-Clause-Clear"
]
| null | null | null | Set up
$ . $TESTDIR/setup.sh
Test input.fofn containing a new bas.h5 file. Note that the new bas.h5 file does not
contain any /PulseData, instead contains /MultiPart/Parts.
$ rm -f $TMP1
$ BASFILE=/pbi/dept/secondary/siv/testdata/BlasrTestData/ctest/data/aggressiveIntervalCut/m130812_185809_42141_c100533960310000001823079711101380_s1_p0.bas.h5
$ REFFA=/pbi/dept/secondary/siv/testdata/BlasrTestData/ctest/data/references/Ecoli_BL21_O26/sequence/Ecoli_BL21_O26.fasta
$ $EXEC $BASFILE $REFFA --holeNumbers 1--100 --out $TMP1
[INFO] * [blasr] started. (glob)
[INFO] * [blasr] ended. (glob)
$ echo $?
0
| 44.357143 | 160 | 0.755233 |
73d8519d77769789d6c30a3a5e73beb8790a9de7 | 4,400 | pm | Perl | tools/intogen/external/lib/perl/Bio/Align/PairwiseStatistics.pm | globusgenomics/galaxy | 7caf74d9700057587b3e3434c64e82c5b16540f1 | [
"CC-BY-3.0"
]
| 1 | 2021-02-05T13:19:58.000Z | 2021-02-05T13:19:58.000Z | tools/intogen/external/lib/perl/Bio/Align/PairwiseStatistics.pm | globusgenomics/genomics-galaxy | 7caf74d9700057587b3e3434c64e82c5b16540f1 | [
"CC-BY-3.0"
]
| 2 | 2020-06-20T15:59:50.000Z | 2021-04-25T17:50:35.000Z | tools/intogen/external/lib/perl/Bio/Align/PairwiseStatistics.pm | globusgenomics/genomics-galaxy | 7caf74d9700057587b3e3434c64e82c5b16540f1 | [
"CC-BY-3.0"
]
| null | null | null | # $Id: PairwiseStatistics.pm,v 1.2 2002/10/22 07:45:10 lapp Exp $
#
# BioPerl module for Bio::Align::PairwiseStatistics
#
# Cared for by Jason Stajich <jason@bioperl.org>
#
# Copyright Jason Stajich
#
# You may distribute this module under the same terms as perl itself
# POD documentation - main docs before the code
=head1 NAME
Bio::Align::PairwiseStatistics - Base statistic object for Pairwise Alignments
=head1 SYNOPSIS
Give standard usage here
=head1 DESCRIPTION
Describe the object here
=head1 FEEDBACK
=head2 Mailing Lists
User feedback is an integral part of the evolution of this and other
Bioperl modules. Send your comments and suggestions preferably to
the Bioperl mailing list. Your participation is much appreciated.
bioperl-l@bioperl.org - General discussion
http://bioperl.org/MailList.shtml - About the mailing lists
=head2 Reporting Bugs
Report bugs to the Bioperl bug tracking system to help us keep track
of the bugs and their resolution. Bug reports can be submitted via
email or the web:
bioperl-bugs@bioperl.org
http://bugzilla.bioperl.org/
=head1 AUTHOR - Jason Stajich
Email jason@bioperl.org
Describe contact details here
=head1 CONTRIBUTORS
Additional contributors names and emails here
=head1 APPENDIX
The rest of the documentation details each of the object methods.
Internal methods are usually preceded with a _
=cut
# Let the code begin...
package Bio::Align::PairwiseStatistics;
use vars qw(@ISA $GapChars);
use strict;
use Bio::Align::StatisticsI;
use Bio::Root::Root;
BEGIN { $GapChars = '(\.|\-)'; }
@ISA = qw(Bio::Root::Root Bio::Align::StatisticsI );
=head2 number_of_comparable_bases
Title : number_of_comparable_bases
Usage : my $bases = $stat->number_of_comparable_bases($aln);
Function: Returns the count of the number of bases that can be
compared (L) in this alignment ( length - gaps)
Returns : integer
Args : Bio::Align::AlignI
=cut
sub number_of_comparable_bases{
my ($self,$aln) = @_;
if( ! defined $aln || ! $aln->isa('Bio::Align::AlignI') ) {
$self->warn("Must provide a Bio::Align::AlignI compliant object to Bio::Align::PairwiseStatistics");
return 0;
} elsif( $aln->no_sequences != 2 ) {
$self->warn("only pairwise calculations currently supported");
}
my $L = $aln->length - $self->number_of_gaps($aln);
return $L;
}
=head2 number_of_differences
Title : number_of_differences
Usage : my $nd = $stat->number_of_distances($aln);
Function: Returns the number of differences between two
Returns : integer
Args : Bio::Align::AlignI
=cut
sub number_of_differences{
my ($self,$aln) = @_;
if( ! defined $aln || ! $aln->isa('Bio::Align::AlignI') ) {
$self->warn("Must provide a Bio::Align::AlignI compliant object to Bio::Align::PairwiseStatistics");
return 0;
} elsif( $aln->no_sequences != 2 ) {
$self->warn("only pairwise calculations currently supported");
}
my (@seqs);
foreach my $seq ( $aln->each_seq) {
push @seqs, [ split(//,$seq->seq())];
}
my $firstseq = shift @seqs;
# my $secondseq = shift @seqs;
my $diffcount = 0;
for (my $i = 0;$i<$aln->length; $i++ ) {
next if( $firstseq->[$i] =~ /^$GapChars$/);
foreach my $seq ( @seqs ) {
next if( $seq->[$i] =~ /^$GapChars$/);
if( $firstseq->[$i] ne $seq->[$i] ) {
$diffcount++;
}
}
}
return $diffcount;
}
=head2 number_of_gaps
Title : number_of_gaps
Usage : my $nd = $stat->number_of_gaps($aln);
Function: Returns the number of differences between two
Example :
Returns :
Args :
=cut
sub number_of_gaps{
my ($self,$aln) = @_;
if( ! defined $aln || ! $aln->isa('Bio::Align::AlignI') ) {
$self->warn("Must provide a Bio::Align::AlignI compliant object to Bio::Align::PairwiseStatistics");
return 0;
} elsif( $aln->no_sequences != 2 ) {
$self->warn("only pairwise calculations currently supported");
}
my (@seqs);
foreach my $seq ( $aln->each_seq) {
push @seqs, [ split(//,$seq->seq())];
}
my $firstseq = shift @seqs;
# my $secondseq = shift @seqs;
my $gapcount = 0;
for (my $i = 0;$i<$aln->length; $i++ ) {
($gapcount++) && next if( $firstseq->[$i] =~ /^$GapChars$/);
foreach my $seq ( @seqs ) {
($gapcount++) && next if( $seq->[$i] =~ /^$GapChars$/);
}
}
return $gapcount;
}
1;
| 25 | 107 | 0.657727 |
ed472bdeffbca368fc023ea21a1a4d4891084ac6 | 70 | al | Perl | benchmark/benchmarks/FASP-benchmarks/data/small-world/smallworld-0019-90-10-24.al | krzysg/FaspHeuristic | 1929c40e3fbc49e68b04acfc5522539a18758031 | [
"MIT"
]
| null | null | null | benchmark/benchmarks/FASP-benchmarks/data/small-world/smallworld-0019-90-10-24.al | krzysg/FaspHeuristic | 1929c40e3fbc49e68b04acfc5522539a18758031 | [
"MIT"
]
| null | null | null | benchmark/benchmarks/FASP-benchmarks/data/small-world/smallworld-0019-90-10-24.al | krzysg/FaspHeuristic | 1929c40e3fbc49e68b04acfc5522539a18758031 | [
"MIT"
]
| null | null | null | 1 4 9
2 3 4 7 10
3
4 5 7 8
5 2 3 6
6 1 2 3 10
7 1 3 5 8 9
8
9 3 4 5
10 | 7 | 11 | 0.528571 |
ed21d0451ac0cf321ed6d678be86bc62d8b8f524 | 8,878 | pl | Perl | mysql/bin/mysql_config.pl | ifleeyo180/VspriteMoodleWebsite | 38baa924829c83808d2c87d44740ff365927a646 | [
"Apache-2.0"
]
| null | null | null | mysql/bin/mysql_config.pl | ifleeyo180/VspriteMoodleWebsite | 38baa924829c83808d2c87d44740ff365927a646 | [
"Apache-2.0"
]
| null | null | null | mysql/bin/mysql_config.pl | ifleeyo180/VspriteMoodleWebsite | 38baa924829c83808d2c87d44740ff365927a646 | [
"Apache-2.0"
]
| null | null | null | #!/usr/bin/perl
# -*- cperl -*-
#
# Copyright (c) 2007, 2017, Oracle and/or its affiliates. All rights reserved.
#
# This program is free software; you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
# the Free Software Foundation; version 2 of the License.
#
# This program is distributed in the hope that it will be useful,
# but WITHOUT ANY WARRANTY; without even the implied warranty of
# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
# GNU General Public License for more details.
#
# You should have received a copy of the GNU General Public License
# along with this program; if not, write to the Free Software
# Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1335 USA
##############################################################################
#
# This script reports various configuration settings that may be needed
# when using the MySQL client library.
#
# This script try to match the shell script version as close as possible,
# but in addition being compatible with ActiveState Perl on Windows.
#
# All unrecognized arguments to this script are passed to mysqld.
#
# NOTE: This script will only be used on Windows until solved how to
# handle -lmariadb ws2_32 advapi32 kernel32 shlwapi crypt32 secur32 and other strings inserted that might contain
# several arguments, possibly with spaces in them.
#
# NOTE: This script was deliberately written to be as close to the shell
# script as possible, to make the maintenance of both in parallel
# easier.
#
##############################################################################
use File::Basename;
use Getopt::Long;
use Cwd;
use strict;
my @exclude_cflags =
qw/DDBUG_OFF DSAFE_MUTEX DUNIV_MUST_NOT_INLINE DFORCE_INIT_OF_VARS
DEXTRA_DEBUG DHAVE_valgrind O O[0-9] xO[0-9] W[-A-Za-z]*
Xa xstrconst xc99=none
unroll2 ip mp restrict/;
my @exclude_libs = qw/lmtmalloc static-libcxa i-static static-intel/;
my $cwd = cwd();
my $basedir;
my $socket = '/tmp/mysql.sock';
my $version = '10.4.22';
sub which
{
my $file = shift;
my $IFS = $^O eq "MSWin32" ? ";" : ":";
foreach my $dir ( split($IFS, $ENV{PATH}) )
{
if ( -f "$dir/$file" or -f "$dir/$file.exe" )
{
return "$dir/$file";
}
}
print STDERR "which: no $file in ($ENV{PATH})\n";
exit 1;
}
# ----------------------------------------------------------------------
# If we can find the given directory relatively to where mysql_config is
# we should use this instead of the incompiled one.
# This is to ensure that this script also works with the binary MySQL
# version
# ----------------------------------------------------------------------
sub fix_path
{
my $default = shift;
my @dirs = @_;
foreach my $dirname ( @dirs )
{
my $path = "$basedir/$dirname";
if ( -d $path )
{
return $path;
}
}
return $default;
}
sub get_full_path
{
my $file = shift;
# if the file is a symlink, try to resolve it
if ( $^O ne "MSWin32" and -l $file )
{
$file = readlink($file);
}
if ( $file =~ m,^/, )
{
# Do nothing, absolute path
}
elsif ( $file =~ m,/, )
{
# Make absolute, and remove "/./" in path
$file = "$cwd/$file";
$file =~ s,/\./,/,g;
}
else
{
# Find in PATH
$file = which($file);
}
return $file;
}
##############################################################################
#
# Form a command line that can handle spaces in paths and arguments
#
##############################################################################
sub quote_options {
my @cmd;
foreach my $opt ( @_ )
{
next unless $opt; # If undefined or empty, just skip
push(@cmd, "\"$opt\""); # Quote argument
}
return join(" ", @cmd);
}
##############################################################################
#
# Main program
#
##############################################################################
my $me = get_full_path($0);
$basedir = dirname(dirname($me)); # Remove "/bin/mysql_config" part
my $ldata = 'C:/Program Files/MariaDB 10.4/data';
my $execdir = 'C:/Program Files/MySQL/bin';
my $bindir = 'C:/Program Files/MySQL/bin';
# ----------------------------------------------------------------------
# If installed, search for the compiled in directory first (might be "lib64")
# ----------------------------------------------------------------------
my $pkglibdir = fix_path('C:/Program Files/MySQL/lib',"libmysql/relwithdebinfo",
"libmysql/release","libmysql/debug","lib/mysql","lib");
my $pkgincludedir = fix_path('C:/Program Files/MySQL/include/mysql', "include/mysql", "include");
# Assume no argument with space in it
my @ldflags = split(" ",'');
my $port;
if ( '0' == 0 ) {
$port = 0;
} else {
$port = '3306';
}
# ----------------------------------------------------------------------
# Create options
# We intentionally add a space to the beginning and end of lib strings, simplifies replace later
# ----------------------------------------------------------------------
my (@lib_opts,@lib_r_opts,@lib_e_opts);
if ( $^O eq "MSWin32" )
{
my $linkpath = "$pkglibdir";
# user32 is only needed for debug or embedded
my @winlibs = ("wsock32.lib","advapi32.lib","user32.lib");
@lib_opts = ("$linkpath/mysqlclient.lib",@winlibs);
@lib_r_opts = @lib_opts;
@lib_e_opts = ("$linkpath/mysqlserver.lib",@winlibs);
}
else
{
my $linkpath = "-L$pkglibdir ";
@lib_opts = ($linkpath,"-lmysqlclient");
@lib_r_opts = ($linkpath,"-lmysqlclient_r");
@lib_e_opts = ($linkpath,"-lmysqld");
}
my $flags;
$flags->{libs} =
[@ldflags,@lib_opts,'','','',''];
$flags->{libs_r} =
[@ldflags,@lib_r_opts,'','-lmariadb ws2_32 advapi32 kernel32 shlwapi crypt32 secur32 ',''];
$flags->{embedded_libs} =
[@ldflags,@lib_e_opts,'','','-lmariadb ws2_32 advapi32 kernel32 shlwapi crypt32 secur32 ','',''];
$flags->{include} = ["-I$pkgincludedir"];
$flags->{cflags} = [@{$flags->{include}},split(" ",'')];
# ----------------------------------------------------------------------
# Remove some options that a client doesn't have to care about
# FIXME until we have a --cxxflags, we need to remove -Xa
# and -xstrconst to make --cflags usable for Sun Forte C++
# ----------------------------------------------------------------------
my $filter = join("|", @exclude_cflags);
my @tmp = @{$flags->{cflags}}; # Copy the flag list
$flags->{cflags} = []; # Clear it
foreach my $cflag ( @tmp )
{
push(@{$flags->{cflags}}, $cflag) unless $cflag =~ m/^($filter)$/o;
}
# Same for --libs(_r)
$filter = join("|", @exclude_libs);
foreach my $lib_type ( "libs","libs_r","embedded_libs" )
{
my @tmp = @{$flags->{$lib_type}}; # Copy the flag list
$flags->{$lib_type} = []; # Clear it
foreach my $lib ( @tmp )
{
push(@{$flags->{$lib_type}}, $lib) unless $lib =~ m/^($filter)$/o;
}
}
my $include = quote_options(@{$flags->{include}});
my $cflags = quote_options(@{$flags->{cflags}});
my $libs = quote_options(@{$flags->{libs}});
my $libs_r = quote_options(@{$flags->{libs_r}});
my $embedded_libs = quote_options(@{$flags->{embedded_libs}});
##############################################################################
#
# Usage information, output if no option is given
#
##############################################################################
sub usage
{
print <<EOF;
Usage: $0 [OPTIONS]
Options:
--cflags [$cflags]
--include [$include]
--libs [$libs]
--libs_r [$libs_r]
--socket [$socket]
--port [$port]
--version [$version]
--libmysqld-libs [$embedded_libs]
EOF
exit 0;
}
@ARGV or usage();
##############################################################################
#
# Get options and output the values
#
##############################################################################
GetOptions(
"cflags" => sub { print "$cflags\n" },
"include" => sub { print "$include\n" },
"libs" => sub { print "$libs\n" },
"libs_r" => sub { print "$libs_r\n" },
"socket" => sub { print "$socket\n" },
"port" => sub { print "$port\n" },
"version" => sub { print "$version\n" },
"embedded-libs|embedded|libmysqld-libs" =>
sub { print "$embedded_libs\n" },
) or usage();
exit 0
| 31.150877 | 124 | 0.499324 |
ed24a41eab91ef07273ab1beb2236e8686dd94f1 | 119 | pl | Perl | t/data/loop-block.pl | utgwkk/Perl-Critic-Policy-ControlStructures-ProhibitReturnInDoBlock | 1fc4024614a6ff94eab3021af598606047eb76a8 | [
"Artistic-1.0"
]
| null | null | null | t/data/loop-block.pl | utgwkk/Perl-Critic-Policy-ControlStructures-ProhibitReturnInDoBlock | 1fc4024614a6ff94eab3021af598606047eb76a8 | [
"Artistic-1.0"
]
| null | null | null | t/data/loop-block.pl | utgwkk/Perl-Critic-Policy-ControlStructures-ProhibitReturnInDoBlock | 1fc4024614a6ff94eab3021af598606047eb76a8 | [
"Artistic-1.0"
]
| null | null | null | use strict;
use warnings;
sub func {
for my $x (1..10) {
return if $x < 5;
}
return 1;
}
func();
| 9.916667 | 25 | 0.478992 |
ed2df2e9b2f47e42a9f96e04ada067dcf2f5ec57 | 3,490 | pm | Perl | network/checkpoint/snmp/mode/cpu.pm | nribault/centreon-plugins | e99276ba80ba202392791e78d72b00f1306d1a99 | [
"Apache-2.0"
]
| null | null | null | network/checkpoint/snmp/mode/cpu.pm | nribault/centreon-plugins | e99276ba80ba202392791e78d72b00f1306d1a99 | [
"Apache-2.0"
]
| null | null | null | network/checkpoint/snmp/mode/cpu.pm | nribault/centreon-plugins | e99276ba80ba202392791e78d72b00f1306d1a99 | [
"Apache-2.0"
]
| null | null | null | #
# Copyright 2020 Centreon (http://www.centreon.com/)
#
# Centreon is a full-fledged industry-strength solution that meets
# the needs in IT infrastructure and application monitoring for
# service performance.
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
#
package network::checkpoint::snmp::mode::cpu;
use base qw(centreon::plugins::templates::counter);
use strict;
use warnings;
sub prefix_cpu_avg_output {
my ($self, %options) = @_;
return $self->{cpu_avg}->{count} . " CPU(s) average usage is ";
}
sub prefix_cpu_core_output {
my ($self, %options) = @_;
return "CPU '" . $options{instance_value}->{display} . "' ";
}
sub set_counters {
my ($self, %options) = @_;
$self->{maps_counters_type} = [
{ name => 'cpu_avg', type => 0, cb_prefix_output => 'prefix_cpu_avg_output' },
{ name => 'cpu_core', type => 1, cb_prefix_output => 'prefix_cpu_core_output' }
];
$self->{maps_counters}->{cpu_avg} = [
{ label => 'average', nlabel => 'cpu.utilization.percentage', set => {
key_values => [ { name => 'average' } ],
output_template => '%.2f %%',
perfdatas => [
{ template => '%.2f', min => 0, max => 100, unit => '%' }
]
}
}
];
$self->{maps_counters}->{cpu_core} = [
{ label => 'core', nlabel => 'core.cpu.utilization.percentage', set => {
key_values => [ { name => 'cpu' } ],
output_template => 'usage: %.2f %%',
perfdatas => [
{ template => '%.2f', min => 0, max => 100, unit => '%', label_extra_instance => 1 }
]
}
}
];
}
sub new {
my ($class, %options) = @_;
my $self = $class->SUPER::new(package => __PACKAGE__, %options, force_new_perfdata => 1);
bless $self, $class;
$options{options}->add_options(arguments => {
});
return $self;
}
sub manage_selection {
my ($self, %options) = @_;
my $oid_cputable = '.1.3.6.1.4.1.2620.1.6.7.5.1.5';
my $result = $options{snmp}->get_table(oid => $oid_cputable, nothing_quit => 1);
$self->{cpu_avg} = {};
$self->{cpu_core} = {};
my $cpu = 0;
my $i = 0;
foreach my $key ($options{snmp}->oid_lex_sort(keys %$result)) {
$key =~ /\.([0-9]+)$/;
my $cpu_num = $1;
$cpu += $result->{$key};
$self->{cpu_core}->{$i} = {
display => $i,
cpu => $result->{$key}
};
$i++;
}
my $avg_cpu = $cpu / $i;
$self->{cpu_avg} = {
average => $avg_cpu,
count => $i
};
}
1;
__END__
=head1 MODE
Check cpu usage.
=over 8
=item B<--warning-average>
Warning threshold average CPU utilization.
=item B<--critical-average>
Critical threshold average CPU utilization.
=item B<--warning-core>
Warning thresholds for each CPU core
=item B<--critical-core>
Critical thresholds for each CPU core
=back
=cut
| 24.577465 | 104 | 0.569914 |
ed1591ca85f39795dd9857bb1d7f444824339377 | 3,993 | t | Perl | S12-enums/basic.t | ab5tract/roast | 98d86f118509991929b5661942fd85fc57e58d79 | [
"Artistic-2.0"
]
| null | null | null | S12-enums/basic.t | ab5tract/roast | 98d86f118509991929b5661942fd85fc57e58d79 | [
"Artistic-2.0"
]
| null | null | null | S12-enums/basic.t | ab5tract/roast | 98d86f118509991929b5661942fd85fc57e58d79 | [
"Artistic-2.0"
]
| null | null | null | use v6;
use Test;
plan 37;
# Very basic enum tests
# L<S12/Enumerations/the keys are specified as a parenthesized list>
enum Day <Sun Mon Tue Wed Thu Fri Sat>;
{
is 0 + Day::Sun, 0, 'First item of an enum is 0';
is 0 + Day::Sat, 6, 'Last item has the right value';
is 0 + Sun, 0, 'Values exported into namespace too.';
is 0 + Sat, 6, 'Values exported into namespace too.';
}
{
# check that the values can be used for ordinary tasks, like
# constructing ranges
isa_ok (Mon..Wed), Range, 'Can construct ranges from Enum values';
ok Mon + Tue == Wed, 'Can do arithmetics with Enum values';
}
#?rakudo skip 'Cannot convert string to number'
#?niecza skip 'enummish but'
{
my $x = 'Today' but Day::Mon;
ok $x.does(Day), 'Can test with .does() for enum type';
ok $x ~~ Day, 'Can smartmatch for enum type';
ok $x ~~ Day::Mon, 'Can Smartmatch for enum value';
my $check = 0;
given $x {
when Day::Mon { $check = 1 }
when Day::Tue { $check = 2 }
}
is $check, 1, 'given/when with enum values';
$check = 0;
given $x {
when Tue { $check = 1 }
when Mon { $check = 2 }
}
is $check, 2, 'given/when with enum values';
}
{
# usually we don't test explicit value for .perl, but here
# it's specced, so we make an exception
is Day::Mon.perl, 'Day::Mon', '.perl on long form of Enum key';
is Mon.perl, 'Day::Mon', '.perl on short form of Enum value';
is Day::Mon.key, 'Mon', '.key on long form of Enum value';
is Mon.key, 'Mon', '.key on short form of Enum value';
is Day::Mon.WHAT.gist, '(Day)', '.WHAT.gist on enum value stringifies to the enum name';
}
{
enum roman (i => 1, v => 5,
x => 10, l => 50,
c => 100, d => 500,
m => 1000);
ok v == 5, 'enum with parens works and non-0 starting point works';
is v.perl, 'roman::v', '.perl works on enum with parens';
is v.key, 'v', '.key works on enum with parens';
}
enum JustOne <Thing>;
{
ok JustOne::Thing == 0, 'Enum of one element works.';
}
#?niecza skip "Enum must have at least one value"
lives_ok { enum Empty < > }, "empty enum can be constructed";
#?niecza todo "Enum must have at least one value"
eval_lives_ok 'enum Empty2 ()', 'empty enum with () can be constructed';
enum Color <white gray black>;
my Color $c1 = Color::white;
ok($c1 == 0, 'can assign enum value to typed variable with long name');
my Color $c2 = white;
ok($c2 == 0, 'can assign enum value to typed variable with short name');
dies_ok({ my Color $c3 = "for the fail" }, 'enum as a type enforces checks');
# conflict between subs and enums
{
my sub white { 'sub' };
ok white == 0, 'short name of the enum without parenthesis is an enum';
#?niecza skip 'nonworking'
is white(), 'sub', 'short name with parenthesis is a sub';
}
# L<S12/The C<.pick> Method/"define a .pick method">
{
lives_ok { my Color $k = Color.pick }, 'Color.pick assigns to Color var';
isa_ok Color.pick, Color.pick.WHAT, 'Color.pick.isa';
ok ?(Color.pick == any(Color::white, Color::gray, Color::black)),
'.pick on enums';
ok Color.pick(2) == 2, '.pick(2) on enums';
}
{
enum RT71460::Bug <rt71460 bug71460 ticket71460>;
ok bug71460 == 1, 'enum element of enum with double colons is in namespace';
}
# RT #77982
{
enum T1 <a b c>;
enum T2 <d e f>;
is T1.enums.keys.sort.join('|'), 'a|b|c', 'enum keys (1)';
is T2.enums.keys.sort.join('|'), 'd|e|f', 'enum keys (2)';
}
# RT #75370
{
enum somenum <a b c d e>;
my somenum $temp = d;
ok $temp eq 'd', "RT #75370 enum name";
}
# RT #72696
{
enum S1 <a b c>;
enum S2 <b c d>;
throws_like { say b }, X::PoisonedAlias, :alias<b>, :package-type<enum>, :package-name<S2>;
ok S1::b == 1 && S2::b == 0, 'still can access redeclared enum values via package';
}
# vim: ft=perl6
| 30.25 | 95 | 0.590784 |
ed1d107e498862db8838007290adb6824fd5da1f | 5,986 | pl | Perl | util/RunMultipleTimes.pl | fargonauts/seqsee | 1e4d62829e34fedd37ed74b37da4cf1665c8c328 | [
"Artistic-2.0"
]
| null | null | null | util/RunMultipleTimes.pl | fargonauts/seqsee | 1e4d62829e34fedd37ed74b37da4cf1665c8c328 | [
"Artistic-2.0"
]
| null | null | null | util/RunMultipleTimes.pl | fargonauts/seqsee | 1e4d62829e34fedd37ed74b37da4cf1665c8c328 | [
"Artistic-2.0"
]
| null | null | null | use threads;
use threads::shared;
use strict;
use Tk;
use lib 'lib';
use Test::Seqsee;
use Global;
use List::Util qw{min max sum};
use Time::HiRes qw{time};
use Getopt::Long;
my $StartTime = time();
my %options = (
f => sub {
my ( $ignored, $feature_name ) = @_;
print "$feature_name will be turned on\n";
unless ( $Global::PossibleFeatures{$feature_name} ) {
print "No feature $feature_name. Typo?\n";
exit;
}
$Global::Feature{$feature_name} = 1;
}
);
GetOptions(
\%options,
"seq=s",
"view=i", # ignored
"times=i",
"f=s",
);
my $times : shared;
my $terms : shared;
( $times, $terms ) = @options{qw{times seq}};
my @selected_feature_set : shared;
@selected_feature_set = map {"-f=$_"} keys %Global::Feature;
my $TIMES_TO_RUN =$times ;
my $MW = new MainWindow();
my $Text = $MW->Scrolled( 'Text', -scrollbars => 'se', -width => 100 )->pack();
$Text->tagConfigure( 'success', -background => 'blue', -foreground => 'white' );
$Text->tagConfigure( 'qualified_success', -background => '#7777FF', -foreground => 'white' );
$Text->tagConfigure( 'error', -background => 'red', -foreground => 'white' );
$Text->tagConfigure( 'nosuccess', -background => 'yellow', -foreground => 'white' );
$Text->insert( 'end', "Please wait...." );
$Text->update();
my @RESULTS : shared;
my @WALLCLOCK_TIME : shared;
my @EFFECTIVE_CODELET_RATE : shared; # not *actual*, as contaminated by startup time.
threads->create('StartRun');
$MW->repeat(
1000,
sub {
Update();
}
);
$MW->MainLoop();
use Storable;
sub StartRun {
my ( $seq, $continuation ) = split( /\|/, $terms );
my @cmd;
if ($OSNAME eq 'MSWin32') {
@cmd = ( $EXECUTABLE_NAME, 'util/RunTestOnce.pl' );
} else {
@cmd = ('perl', 'util/RunTestOnce.pl');
}
push @cmd, (
qq{--seq="$seq"}, qq{--continuation="$continuation"},
qq{-max_steps=10000}, qq{--min_extension=3},
qq{--max_false=3}, qq{--tempfilename=foo},
@selected_feature_set,
);
# my $cmd = join(" ", @cmd);
for ( 1 .. $TIMES_TO_RUN ) {
print ">>@cmd<<\n";
unlink 'foo';
my $time_before = time();
system @cmd;
my $time_taken = time() - $time_before;
push @WALLCLOCK_TIME, $time_taken;
open( my $RESULT, '<', "foo" ) or confess "Unable to open file >>foo<<: $! ";
my $result_str = join( '', <$RESULT> );
#my $result_object = Storable::thaw($result_str)
# or confess "Unable to thaw: >>$result_str<<!!";
push @RESULTS, $result_str;
my $effective_codelet_rate = Storable::thaw($result_str)->get_steps() / $time_taken;
push @EFFECTIVE_CODELET_RATE, $effective_codelet_rate;
print "RESULT ADDED\n";
}
}
my $ResultCountAtLastUpdate = 0;
sub Update {
my $elapsed_time = time() - $StartTime;
$MW->configure(-title => 'Multiple Seqsee Runs. Time elapsed: '. sprintf('%4d', $elapsed_time) . ' seconds');
if (@RESULTS) {
return unless scalar(@RESULTS) > $ResultCountAtLastUpdate;
$ResultCountAtLastUpdate = scalar(@RESULTS);
my @RESULTS2 = map { Storable::thaw($_) } @RESULTS;
$Text->delete( '0.0', 'end' );
my @top_row = map { find_tag( $_->get_status() ) } @RESULTS2;
$Text->insert( 'end', @top_row, scalar(@RESULTS), '', "/$TIMES_TO_RUN", '', "\n" );
$Text->insert( 'end', "Times in seconds: ",
'', ( map { sprintf( '%6.2f', $_ ), '', ' ', '' } @WALLCLOCK_TIME ), "\n" );
$Text->insert( 'end', "Codelets per second: ",
'', ( map { sprintf( '%6.2f', $_ ), '', ' ', '' } @EFFECTIVE_CODELET_RATE ), "\n" );
$Text->insert( 'end', "Codelets run: ",
'', ( map { sprintf( '%6d', $_->get_steps() ), '', ' ', '' } @RESULTS2 ), "\n" );
my @times_when_successful
= map { $_->get_steps() } grep { $_->get_status()->IsSuccess } @RESULTS2;
my $sucess_percent
= sprintf( '%5.2f', 100 * scalar(@times_when_successful) / scalar(@RESULTS) );
if ( $sucess_percent > 0 ) {
$Text->insert( 'end', "$sucess_percent% successful\n" );
$Text->insert(
'end', "Steps needed when correct: ",
'', join( ', ', sort { $a <=> $b } @times_when_successful ),
'', "\n"
);
$Text->insert(
'end',
"\nMinimum steps: " . min(@times_when_successful),
'',
"\nMaximum steps: " . max(@times_when_successful),
'',
"\nAverage: "
. sprintf(
'%5.3f', sum(@times_when_successful) / scalar(@times_when_successful)
),
'', "\n"
);
}
for (@RESULTS2) {
$Text->insert( 'end', "\n............\n", '', find_tag( $_->get_status() ),
"\t", '', $_->get_steps(), '', "\n\n" );
$Text->insert( 'end', $_->get_error() ) if $_->get_error();
}
$MW->update();
}
}
sub find_tag {
my ($status) = @_;
my $string = $status->get_status_string;
# print $status;
if ( $status->IsSuccess() ) {
return ( " OK ", ["success"] );
}
elsif ( $status->IsACrash() ) {
return ( " CRASH! ", ["error"] );
}
elsif ( $status->IsAtLeastAnExtension() ) {
return ( " $string ", ["qualified_success"] );
}
else {
return ( " X ", ["nosuccess"] );
}
}
sub Display_Selected {
my ($arr_ref) = @_;
my @arr = @$arr_ref;
my @string = map { ( " X ", find_tag($_) ) } @arr;
$Text->insert( 'end', @string, " \n " );
for my $line (@arr) {
## line: $line
$Text->insert( 'end', " == == == \n \n " );
$Text->insert( 'end', $line, '', " \n " );
}
}
| 31.177083 | 113 | 0.506181 |
73d63642480cb05c3e79ba32ceaa4a9671eac57e | 6,003 | pm | Perl | lib/R/Css/Grid.pm | darviarush/rubin-forms | d3b0d16f937c58439d4ab1be667e573ff5555f06 | [
"BSD-2-Clause"
]
| null | null | null | lib/R/Css/Grid.pm | darviarush/rubin-forms | d3b0d16f937c58439d4ab1be667e573ff5555f06 | [
"BSD-2-Clause"
]
| null | null | null | lib/R/Css/Grid.pm | darviarush/rubin-forms | d3b0d16f937c58439d4ab1be667e573ff5555f06 | [
"BSD-2-Clause"
]
| null | null | null | package R::Css::Grid;
# методы для создания сетки
use common::sense;
use R::App;
use R::Css;
has qw/prefix names/;
# конструктор
sub new {
my ($cls) = @_;
bless {
prefix => [qw/s w m g/],
names => {small=> "s", phone => "w", tablet => "m", descktop => "g"},
the => {}, # name => the. Массив классов в адаптиве
}, ref $cls || $cls;
}
# регистрирует классы grid в css
sub register {
my ($self) = @_;
my $names = $self->{names};
while(my ($name, $suffix) = each %$names) {
my $fix = $suffix eq 'w'? '': "-$suffix";
$self->_register("$suffix*_*", $name, sub { $app->css->size($_) });
$self->_register("offset$fix*_*", $name, sub { $app->css->move($_) });
$self->_register("push$fix*_*", $name, sub { $app->css->locate($_) });
$self->_register("pull$fix*_*", $name, sub { $app->css->locateoff($_) });
$self->_register("lines$fix*", $name, sub { $app->css->size(undef, $_ eq "auto"? $_: ($app->cssConst->lineHeight * 1/$_) . "em") });
$self->_register("$suffix*_*em", $name, sub { $app->css->size($_ . "em") });
$self->_register("offset$fix*_*em", $name, sub { $app->css->move($_ . "em") });
$self->_register("push$fix*_*em", $name, sub { $app->css->locate($_ . "em") });
$self->_register("pull$fix*_*em", $name, sub { $app->css->locateoff($_ . "em") });
$self->_register("$suffix*_*px", $name, sub { $app->css->size($_ . "px") });
$self->_register("offset$fix*_*px", $name, sub { $app->css->move($_ . "px") });
$self->_register("push$fix*_*px", $name, sub { $app->css->locate($_ . "px") });
$self->_register("pull$fix*_*px", $name, sub { $app->css->locateoff($_ . "px") });
}
$self
}
# хелпер для регистрации одной маски
sub _register {
my ($self, $mask, $name, $sub) = @_;
$app->css->register($mask, closure $self, $name, $sub, \&_reg);
$app->css->register($mask, closure $self, $name, $sub, \&_reg) if $mask =~ s/_\*//;
}
# обработчик класса
sub _reg {
my ($self, $name, $sub, $class, $i, $j) = @_;
local $_;
$app->css->gosub($name);
if(my $the = $self->{the}{$name}) {
$the->{the} .= ", .$class";
}
else {
$app->css->the(".$class")->like(".float")->block;
$self->{the}{$name} = $app->css->the;
}
$app->css->the(".$class");
if(!defined $j) {
$_ = $i==0? "auto": 1 / $i;
} else {
$_ = $i / $j;
}
$sub->();
$app->css->end;
}
# адаптивные окна
sub adaptive {
my ($self) = @_;
# my $phone = em 768 / $fontSize;
# my $tablet = em 992 / $fontSize;
# my $descktop = em 1200 / $fontSize;
my $phone = px 768;
my $tablet = px 992;
my $descktop = px 1200;
my $unit = "px";
$app->css->the(".float")->
set(
float => "left",
clear => "none",
position => "relative",
($app->ini->{"design"}{"grid"}? (outline => "dotted 1px red"): ()),
);
# grid(12, "s");
# linegrid(12, "s");
# $app->css->prince("small")->
# the(".s-hide")->hide->
# the(".w-show")->hide->
# the(".m-show")->hide->
# the(".g-show")->hide->
# end->
$app->css->
prince("small-only")->media("all and (max-width: " . ($phone - 1e-14 ) . "$unit)")->end->
prince("phone-only")->media("all and (min-width: $phone) and (max-width: ". ($tablet-1e-14) ."$unit)")->end->
prince("tablet-only")->media("all and (min-width: $tablet) and (max-width: ". ($descktop-1e-14) ."$unit)")->end->
prince("descktop-only")->media("all and (min-width: $descktop)")->end->
prince("small-to-phone")->media("all and (max-width: " . ($tablet - 1e-14 ) . "$unit)")->end->
prince("small-to-tablet")->media("all and (max-width: " . ($descktop - 1e-14 ) . "$unit)")->end->
prince("small-to-descktop")->end->
prince("phone-to-tablet")->media("all and (min-width: $phone) and (max-width: " . ($descktop - 1e-14 ) . "$unit)")->end->
prince("phone-to-descktop")->media("all and (min-width: $phone)")->end->
prince("tablet-to-descktop")->media("all and (min-width: $tablet)")->end;
$self->supergrid("small", 0);
$self->supergrid("phone", $phone);
$self->supergrid("tablet", $tablet);
$self->supergrid("descktop", $descktop);
$self
}
sub supergrid {
my ($self, $name, $size) = @_;
my $prefix = $self->{names}{$name};
my $css = $app->css;
my ($unit) = $size =~ /([a-z]+)$/;
$css->prince($name);
$css->media("all and (min-width: $size)") if $size;
$css->
the(".in1")->size($size * 0.95 . $unit)->
the(".in2")->size($size * 0.9 . $unit)->
the(".in3")->size($size * 0.85 . $unit)->
the(".pass")->size(undef, $size * 0.1 . $unit)->
the(".$prefix-hide")->hide;
$css->the(".$_-show")->hide for grep { $_ ne $prefix } @{$self->{prefix}};
#grid(12, $prefix);
#linegrid(12, $prefix);
$css->end;
$self
}
# строит сетку
sub grid {
my ($self, $rem, $suffix) = @_;
my $fix = $suffix eq 'w'? '': "-$suffix";
my @names;
for my $j (1..$rem) {
for my $i (1..$j) {
#next if $i == $j;
my $k = $i / $j;
my $t = $i . "_" . $j;
if($i == 1) {
push @names, "." . $suffix . $j;
push @names, ".offset" . $fix . $j;
push @names, ".push" . $fix . $j;
push @names, ".pull" . $fix . $j;
$app->css->
the(".$suffix$j, .${suffix}1_$j")->size($k)->
the(".offset$fix$j, .offset${fix}1_$j")->move($k)->
the(".push$fix$j, .push${fix}1_$j")->locate($k)->
the(".pull$fix$j, .pull${fix}1_$j")->locateoff($k);
} else {
$app->css->
the(".$suffix${i}_$j")->size($k)->
the(".offset$fix${i}_$j")->move($k)->
the(".push$fix${i}_$j")->locate($k)->
the(".pull$fix${i}_$j")->locateoff($k);
}
push @names, "." . $suffix . $t;
push @names, ".offset" . $fix . $t;
push @names, ".push" . $fix . $t;
push @names, ".pull" . $fix . $t;
}
}
$app->css->the(join ", ", @names)->like(".float")->block;
$self
}
# строит сетку высоты
sub linegrid {
my ($self, $rem, $suffix) = @_;
$suffix = $suffix eq "w"? "": "-$suffix";
for(my $i=1; $i<=$rem; $i++) {
$app->css->the(".lines$suffix$i")->size(undef, $app->cssConst->lineHeight * $i . "em");
}
$self
}
1; | 24.205645 | 134 | 0.523238 |
ed35a8b777d53641690e1990b69dffab2837038f | 1,662 | al | Perl | AddOns/FIK/test/src/COD148025.TestFIKEventSubscribers.al | Ema-Falamas/ALAppExtensions | f9ee74c1e06c7382b1f8ff74a0e48ac3781646f6 | [
"MIT"
]
| 1 | 2021-12-30T18:27:05.000Z | 2021-12-30T18:27:05.000Z | AddOns/FIK/test/src/COD148025.TestFIKEventSubscribers.al | Ema-Falamas/ALAppExtensions | f9ee74c1e06c7382b1f8ff74a0e48ac3781646f6 | [
"MIT"
]
| 3 | 2020-06-24T12:59:52.000Z | 2020-06-24T14:51:04.000Z | AddOns/FIK/test/src/COD148025.TestFIKEventSubscribers.al | Ema-Falamas/ALAppExtensions | f9ee74c1e06c7382b1f8ff74a0e48ac3781646f6 | [
"MIT"
]
| 1 | 2020-07-30T12:20:36.000Z | 2020-07-30T12:20:36.000Z | // ------------------------------------------------------------------------------------------------
// Copyright (c) Microsoft Corporation. All rights reserved.
// Licensed under the MIT License. See License.txt in the project root for license information.
// ------------------------------------------------------------------------------------------------
codeunit 148025 "FIK Event Subscribers"
{
Subtype = Test;
TestPermissions = Disabled;
var
LibrarySales: Codeunit "Library - Sales";
LibraryReportDataset: Codeunit "Library - Report Dataset";
trigger OnRun();
begin
// [FEATURE] [FIK]
end;
[Test]
[HandlerFunctions('SalesInvoiceRequestPageHandler')]
procedure SetDocumentReferenceTxtOnPrintSalesInvoice();
var
SalesHeader: Record "Sales Header";
SalesInvoiceHeader: Record "Sales Invoice Header";
FIKManagement: Codeunit FIKManagement;
begin
LibrarySales.CreateSalesInvoice(SalesHeader);
SalesInvoiceHeader.GET(LibrarySales.PostSalesDocument(SalesHeader, TRUE, TRUE));
REPORT.RUN(REPORT::"Sales - Invoice", TRUE, FALSE, SalesInvoiceHeader);
LibraryReportDataset.LoadDataSetFile();
LibraryReportDataset.GetNextRow();
LibraryReportDataset.AssertElementWithValueExists('DocumentReference', FIKManagement.GetFIK71String(SalesInvoiceHeader."No."));
end;
[RequestPageHandler]
procedure SalesInvoiceRequestPageHandler(VAR SalesInvoice: TestRequestPage "Sales - Invoice");
begin
SalesInvoice.SAVEASXML(LibraryReportDataset.GetParametersFileName(), LibraryReportDataset.GetFileName());
end;
} | 39.571429 | 135 | 0.637786 |
ed0852c4d9173d9ad49f99ba1a26d2945d844020 | 2,410 | pl | Perl | bench/ua-vs-human/gimli/run.pl | DadaIsCrazy/usuba | 5ecbf056d7d8bd77462d29309c85f897f36d0f49 | [
"MIT"
]
| 41 | 2018-06-22T18:19:20.000Z | 2021-11-14T16:24:15.000Z | bench/ua-vs-human/gimli/run.pl | DadaIsCrazy/usuba | 5ecbf056d7d8bd77462d29309c85f897f36d0f49 | [
"MIT"
]
| 2 | 2018-06-22T17:55:02.000Z | 2020-07-10T21:54:32.000Z | bench/ua-vs-human/gimli/run.pl | DadaIsCrazy/usuba | 5ecbf056d7d8bd77462d29309c85f897f36d0f49 | [
"MIT"
]
| 3 | 2019-04-02T22:19:25.000Z | 2021-12-03T02:36:23.000Z | #!/usr/bin/perl
use strict;
use warnings;
use feature 'say';
use utf8;
use open qw( :encoding(UTF-8) :std );
use autodie qw( open close );
use List::Util qw( sum );
use FindBin;
chdir "$FindBin::Bin";
my $gen = "@ARGV" =~ /-[ag]/;
my $compile = "@ARGV" =~ /-[ac]/;
my $run = !@ARGV || "@ARGV" =~ /-[ar]/;
my $cc = "clang";
my $c_opts = "-O3 -march=native -fno-tree-vectorize -fno-slp-vectorize";
my $source_file = "gimli.ua";
my $usubac = "../../../usubac";
my $ua_opts = "-gen-bench -inline-all -unroll";
my $bench_main = "../../../experimentations/bench_generic/bench.c";
my $bench_opts = "-D WARMUP=10000 -D NB_RUN=4000000";
my $c_headers = "-I ../../../arch";
my $bin_dir = "bin";
my @archs = qw(sse avx);
my $nb_run = 30;
sub avg_stdev {
my $u = sum(@_) / @_; # mean
my $s = (sum(map {($_-$u)**2} @_) / @_) ** 0.5; # stdev
return ($u, $s);
}
if ($gen) {
say "Generating C files...";
for my $arch (@archs) {
# Generating default Usuba
system "$usubac $ua_opts -arch $arch -o gimli-ua-$arch.c $source_file";
}
}
if ($compile) {
say "Compiling C files...";
mkdir "bin" unless -d "bin";
for my $arch (@archs) {
system "$cc $c_opts $bench_main $bench_opts $c_headers " .
"gimli-ua-$arch.c -o $bin_dir/gimli-ua-$arch";
system "$cc $c_opts $bench_main $bench_opts $c_headers " .
"gimli-ref-$arch.c -o $bin_dir/gimli-ref-$arch";
system "$cc $c_opts $bench_main $bench_opts $c_headers " .
"gimli-ref-$arch-2.c -o $bin_dir/gimli-ref-2-$arch";
}
}
if ($run) {
say "Running benchmarks...";
for my $arch (@archs) {
my %times;
for (1 .. $nb_run) {
for my $bench (qw(gimli-ua gimli-ref gimli-ref-2)) {
push @{$times{$bench}}, (`./$bin_dir/$bench-$arch` =~ s/ .*$//r)+0;
}
}
say "Arch: $arch";
my ($ua, $ua_stdev) = avg_stdev(@{$times{"gimli-ua"}});
printf "Usuba: %.2f +-%.2f\n", $ua, $ua_stdev;
my ($ref, $ref_stdev) = avg_stdev(@{$times{"gimli-ref"}});
printf "Ref : %.2f +-%.2f (x%.2f)\n", $ref, $ref_stdev, $ref/$ua;
my ($ref2, $ref2_stdev) = avg_stdev(@{$times{"gimli-ref-2"}});
printf "Ref 2: %.2f +-%.2f (x%.2f)\n", $ref2, $ref2_stdev, $ref2/$ua;
say "\n\n", "*" x 80, "\n";
}
}
| 27.701149 | 83 | 0.516183 |
73e70a4f280a21d32f8695a045f603f57af912cd | 24,944 | pm | Perl | WQFM/scripts/scripts-reroot-using-perl/bioPerl-1.5.2/lib/perl5/Bio/LiveSeq/Transcript.pm | sharmin-mim/wQFM-2020 | 92cbab0a6f4876fb30758991aacc686b2c54058c | [
"Apache-2.0"
]
| 10 | 2020-09-12T19:50:47.000Z | 2022-03-21T15:04:28.000Z | WQFM/scripts/scripts-reroot-using-perl/bioPerl-1.5.2/lib/perl5/Bio/LiveSeq/Transcript.pm | sharmin-mim/wQFM-2020 | 92cbab0a6f4876fb30758991aacc686b2c54058c | [
"Apache-2.0"
]
| 2 | 2021-06-11T15:14:13.000Z | 2022-03-29T12:19:00.000Z | WQFM/scripts/scripts-reroot-using-perl/bioPerl-1.5.2/lib/perl5/Bio/LiveSeq/Transcript.pm | sharmin-mim/wQFM-2020 | 92cbab0a6f4876fb30758991aacc686b2c54058c | [
"Apache-2.0"
]
| 2 | 2021-06-06T13:46:03.000Z | 2021-11-12T20:58:15.000Z | # $Id: Transcript.pm,v 1.21.4.1 2006/10/02 23:10:21 sendu Exp $
#
# bioperl module for Bio::LiveSeq::Transcript
#
# Cared for by Joseph Insana <insana@ebi.ac.uk> <jinsana@gmx.net>
#
# Copyright Joseph Insana
#
# You may distribute this module under the same terms as perl itself
#
# POD documentation - main docs before the code
=head1 NAME
Bio::LiveSeq::Transcript - Transcript class for LiveSeq
=head1 SYNOPSIS
# documentation needed
=head1 DESCRIPTION
This stores informations about coding sequences (CDS).
The implementation is that a Transcript object accesses a collection of
Exon objects, inferring from them the nucleotide structure and sequence.
=head1 AUTHOR - Joseph A.L. Insana
Email: Insana@ebi.ac.uk, jinsana@gmx.net
=head1 APPENDIX
The rest of the documentation details each of the object
methods. Internal methods are usually preceded with a _
=cut
# Let the code begin...
package Bio::LiveSeq::Transcript;
use strict;
# use Carp qw(carp cluck);
use Bio::LiveSeq::Exon; # uses Exon to create new exon in case of deletion
use base qw(Bio::LiveSeq::SeqI);
=head2 new
Title : new
Usage : $transcript = Bio::LiveSeq::Transcript->new(-exons => \@obj_refs);
Function: generates a new Bio::LiveSeq::Transcript
Returns : reference to a new object of class Transcript
Errorcode -1
Args : reference to an array of Exon object references
=cut
sub new {
my ($thing, %args) = @_;
my $class = ref($thing) || $thing;
my ($obj,%transcript);
my @exons=@{$args{-exons}};
$obj = \%transcript;
$obj = bless $obj, $class;
unless (@exons) {
$obj->warn("$class not initialised because exons array empty");
return(-1);
}
# now useless, after start and end methods have been overridden here
my $firstexon = $exons[0];
#my $lastexon = $exons[-1];
#my $start = $firstexon->start;
#my $end = $lastexon->end;
my $strand = $firstexon->strand;
my $seq = $firstexon->{'seq'};
$obj->alphabet('rna');
unless (_checkexons(\@exons)) {
$obj->warn("$class not initialised because of problems in the exon structure");
return(-1);
}
$obj->{'strand'}=$strand;
$obj->{'exons'}=\@exons;
$obj->{'seq'}=$seq;
# set Transcript into each Exon
my $exon;
foreach $exon (@exons) {
$exon->{'transcript'}=$obj;
}
return $obj;
}
=head2 all_Exons
Title : all_Exons
Usage : $transcript_obj->all_Exons()
Function: returns references to all Exon objects the Transcript is composed of
Example : foreach $exon ($transcript->all_Exons()) { do_something }
Returns : array of object references
Args : none
=cut
sub all_Exons {
my $self=shift;
my $exonsref=$self->{'exons'};
my @exons=@{$exonsref};
my @newexons;
my $exon;
foreach $exon (@exons) {
unless ($exon->obj_valid) {
$self->warn("$exon no more valid, start or end label lost, skipping....",1); # ignorable
} else {
push(@newexons,$exon);
}
}
if ($#exons != $#newexons) {
# update exons field
$self->{'exons'}=\@newexons;
}
return (@newexons);
}
=head2 downstream_seq
Title : downstream_seq
Usage : $transcript_obj->downstream_seq()
: $transcript_obj->downstream_seq(64)
Function: returns a string of nucleotides downstream of the end of the
CDS. If there is some information of the real mRNA, from features in
an attached Gene object, it will return up to those boundaries.
Otherwise it will return 1000 nucleotides.
If an argument is given it will override the default 1000 number
and return instead /that/ requested number of nucleotides.
But if a Gene object is attached, this argument will be ignored.
Returns : string
Args : an optional integer number of nucleotides to be returned instead of
the default if no gene attached
=cut
sub downstream_seq {
my ($self,$howmany)=@_;
my $str;
if (defined ($howmany)) {
unless ($howmany > 0) {
$self->throw("No sense in asking less than 1 downstream nucleotides!");
}
} else {
unless ($self->{'seq'}->alphabet eq 'rna') { # if rna retrieve until the end
#$str=$DNAobj->labelsubseq($self->end,undef,undef,"unsecuremoderequested");
#return(substr($str,1)); # delete first nucleotide that is the last of Transcript
if ($self->gene) { # if there is Gene object attached fetch relevant info
$str=$self->{'seq'}->labelsubseq($self->end,undef,$self->gene->maxtranscript->end); # retrieve from end of this Transcript to end of the maxtranscript
$str=substr($str,1); # delete first nucleotide that is the last of Transcript
if (CORE::length($str) > 0) {
return($str);
} else { # if there was no downstream through the gene's maxtranscript, go the usual way
$howmany = 1000;
}
} else {
$howmany = 1000;
}
}
}
my @exons=$self->all_Exons;
my $strand=$self->strand();
my $lastexon=$exons[-1];
my $lastexonlength=$lastexon->length;
# $howmany nucs after end of last exon
#my $downstream_seq=$lastexon->subseq($lastexonlength+1,undef,$howmany);
my $downstream_seq;
if ($howmany) {
$downstream_seq=substr($lastexon->labelsubseq($self->end,$howmany,undef,"unsecuremoderequested"),1);
} else {
if ($strand == 1) {
$downstream_seq=substr($lastexon->labelsubseq($self->end,undef,$self->{'seq'}->end,"unsecuremoderequested"),1);
} else {
$downstream_seq=substr($lastexon->labelsubseq($self->end,undef,$self->{'seq'}->start,"unsecuremoderequested"),1);
}
}
return $downstream_seq;
}
=head2 upstream_seq
Title : upstream_seq
Usage : $transcript_obj->upstream_seq()
: $transcript_obj->upstream_seq(64)
Function: just like downstream_seq but returns nucleotides before the ATG
Note : the default, if no Gene information present and no nucleotides
number given, is to return up to 400 nucleotides.
=cut
sub upstream_seq {
my ($self,$howmany)=@_;
if (defined ($howmany)) {
unless ($howmany > 0) {
$self->throw("No sense in asking less than 1 upstream nucleotides!");
}
} else {
unless ($self->{'seq'}->alphabet eq 'rna') { # if rna retrieve from the start
if ($self->gene) { # if there is Gene object attached fetch relevant info
my $str=$self->{'seq'}->labelsubseq($self->gene->maxtranscript->start,undef,$self->start); # retrieve from start of maxtranscript to start of this Transcript
chop $str; # delete last nucleotide that is the A of starting ATG
if (length($str) > 0) {
return($str);
} else { # if there was no upstream through the gene's maxtranscript, go the usual way
$howmany = 400;
}
} else {
$howmany = 400;
}
}
}
my @exons=$self->all_Exons;
my $firstexon=$exons[0];
my $upstream_seq;
my $strand=$self->strand();
if ($howmany) {# $howmany nucs before begin of first exon
my $labelbefore=$firstexon->label(-$howmany,$firstexon->start);
if ($labelbefore < 1) {
if ($strand == 1) {
$labelbefore=$self->{'seq'}->start;
} else {
$labelbefore=$self->{'seq'}->end;
}
}
$upstream_seq=$firstexon->labelsubseq($labelbefore,undef,$firstexon->start,"unsecuremoderequested");
chop $upstream_seq;
} else {
if ($strand == 1) {
$upstream_seq=$firstexon->labelsubseq($self->{'seq'}->start,undef,$self->start,"unsecuremoderequested");
chop $upstream_seq; # delete last nucleotide that is the A of starting ATG
} else {
$upstream_seq=$firstexon->labelsubseq($self->{'seq'}->end,undef,$self->start,"unsecuremoderequested");
chop $upstream_seq; # delete last nucleotide that is the A of starting ATG
}
}
return $upstream_seq;
}
# These get redefined here, overriding the SeqI one because they draw their
# information from the Exons a Transcript is built of
# optional argument: firstlabel. If not given, it checks coordinate_start
# This is useful when called by Translation
# also used by _delete
sub label {
my ($self,$position,$firstlabel)=@_;
unless ($position) { # if position = 0 complain ?
$self->warn("Position not given or position 0");
return (-1);
}
my ($start,$end,$strand)=($self->start(),$self->end(),$self->strand());
my ($label,@labels,$length,$arraypos);
unless (defined ($firstlabel)) {
$firstlabel=$self->coordinate_start; # this is inside Transcript obj
}
my $coord_pos=$self->_inside_position($firstlabel);
$length=$self->length;
#if ($strand == 1) {
if ($position < 1) {
$position++; # to account for missing of 0 position
}
$arraypos=$position+$coord_pos-2;
#print "\n=-=-=-=-DEBUG: arraypos $arraypos, pos $position, coordpos: $coord_pos";
if ($arraypos < 0) {
$label=$self->{'seq'}->label($arraypos,$start,$strand); #?
} elsif ($arraypos >= $length) {
$label=$self->{'seq'}->label($arraypos-$length+2,$end,$strand); #?
} else { # inside the Transcript
@labels=$self->all_labels;
$label=$labels[$arraypos];
}
#}
}
# argument: label
# returns: position of label according to coord_start
# errorcode: 0 label not found
# optional argument: firstlabel. If not given, it checks coordinate_start
# This is useful when called by Translation
sub position {
my ($self,$label,$firstlabel)=@_;
unless ($self->{'seq'}->valid($label)) {
$self->warn("label is not valid");
return (0);
}
unless (defined ($firstlabel)) {
$firstlabel=$self->coordinate_start; # this is inside Transcript obj
}
if ($label == $firstlabel) {
return (1);
}
my ($start,$end,$strand)=($self->start(),$self->end(),$self->strand());
my ($position,$in_pos,$out_pos,$coord_pos);
my $length=$self->length;
$coord_pos=$self->_inside_position($firstlabel);
if ($self->valid($label)) { # if label is inside the Transcript
$in_pos=$self->_inside_position($label);
$position=$in_pos-$coord_pos+1;
if ($position <= 0) {
return ($position-1); # accounts for the missing of the 0 position
}
} else {
if ($self->follows($end,$label)) { # label after end of transcript
$out_pos=$self->{'seq'}->position($label,$end,$strand);
#print "\n+++++++++DEBUG label $label FOLLOWS end $end outpos $out_pos coordpos $coord_pos";
$position=$out_pos+$length-$coord_pos;
} elsif ($self->follows($label,$start)) { # label before begin of transcript
#print "\n+++++++++DEBUG label $label BEFORE start $start outpos $out_pos coordpos $coord_pos";
$out_pos=$self->{'seq'}->position($label,$start,$strand);
$position=$out_pos-$coord_pos+1;
} else { # label is in intron (not valid, not after, not before)!
$self->warn("Cannot give position of label pointing to intron according to CDS numbering!",1);
return (0);
}
}
return ($position);
}
sub seq {
my $self=shift;
my ($exon,$str);
my @exons=$self->all_Exons();
foreach $exon (@exons) {
$str .= $exon->seq();
}
return $str;
}
sub length {
my $self=shift;
my ($exon,$length);
my @exons=$self->all_Exons();
foreach $exon (@exons) {
$length += $exon->length();
}
return $length;
}
sub all_labels {
my $self=shift;
my ($exon,@labels);
my @exons=$self->all_Exons();
foreach $exon (@exons) {
push (@labels,$exon->all_labels());
}
return @labels;
}
# redefined here so that it will retrieve effective subseq without introns
# otherwise it would have retrieved an underlying DNA (possibly with introns)
# subsequence
# Drawback: this is really bulky, label->position and then a call to
# subseq that will do the opposite position-> label
#
# one day this can be rewritten as the main one so that the normal subseq
# will rely on this one and hence avoid this double (useless and lengthy)
# conversion between labels and positions
sub old_labelsubseq {
my ($self,$start,$length,$end)=@_;
my ($pos1,$pos2);
if ($start) {
unless ($self->valid($start)) {
$self->warn("Start label not valid"); return (-1);
}
$pos1=$self->position($start);
}
if ($end) {
if ($end == $start) {
$length=1;
} else {
unless ($self->valid($end)) {
$self->warn("End label not valid"); return (-1);
}
unless ($self->follows($start,$end) == 1) {
$self->warn("End label does not follow Start label!"); return (-1);
}
$pos2=$self->position($end);
undef $length;
}
}
return ($self->subseq($pos1,$pos2,$length));
}
# rewritten, eventually
sub labelsubseq {
my ($self,$start,$length,$end,$unsecuremode)=@_;
unless (defined $unsecuremode &&
$unsecuremode eq "unsecuremoderequested")
{ # to skip security checks (faster)
if ($start) {
unless ($self->valid($start)) {
$self->warn("Start label not valid"); return (-1);
}
} else {
$start=$self->start;
}
if ($end) {
if ($end == $start) {
$length=1;
undef $end;
} else {
undef $length; # end argument overrides length argument
unless ($self->valid($end)) {
$self->warn("End label not valid"); return (-1);
}
unless ($self->follows($start,$end) == 1) {
$self->warn("End label does not follow Start label!"); return (-1);
}
}
} else {
$end=$self->end;
}
}
my ($seq,$exon,$startexon,$endexon); my @exonlabels;
my @exons=$self->all_Exons;
EXONCHECK:
foreach $exon (@exons) {
if ((!(defined($startexon)))&&($exon->valid($start))) { # checks only if not yet found
$startexon=$exon;
}
if ($exon->valid($end)) {
$endexon=$exon;
}
if ((!(defined($seq)) && (defined($startexon)))) { # initializes only once
if ((defined($endexon)) && ($endexon eq $startexon)) { # then perfect, we are finished
if ($length) {
$seq = $startexon->labelsubseq($start,$length,undef,"unsecuremoderequested");
last EXONCHECK;
} else {
$seq = $startexon->labelsubseq($start,undef,$end,"unsecuremoderequested");
}
last EXONCHECK;
} else { # get up to the end of the exon
$seq = $startexon->labelsubseq($start,undef,undef,"unsecuremoderequested");
}
}
if (($startexon)&&($exon ne $startexon)) {
if (defined($endexon)) { # we arrived to the last exon
$seq .= $endexon->labelsubseq(undef,undef,$end,"unsecuremoderequested"); # get from the start of the exon
last EXONCHECK;
} elsif (defined($startexon)) { # we are in a whole-exon-in-the-middle case
$seq .= $exon->seq; # we add it completely to the seq
} # else, we still have to reach the start point, exon useless, we move on
if ($length) { # if length argument specified
if (($seq && (CORE::length($seq) >= $length))) {
last EXONCHECK;
}
}
}
}
if ($length) {
return (substr($seq,0,$length));
} else {
return ($seq);
}
}
# argument: label
# returns: the objref and progressive number of the Exon containing that label
# errorcode: -1
sub in_which_Exon {
my ($self,$label)=@_;
my ($count,$exon);
my @exons=$self->all_Exons;
foreach $exon (@exons) {
$count++; # 1st exon is numbered "1"
if ($exon->valid($label)) {
return ($exon,$count)
}
}
return (-1); # if nothing found
}
# recoded to exploit the new fast labelsubseq()
# valid only inside Transcript
sub subseq {
my ($self,$pos1,$pos2,$length) = @_;
my ($str,$startlabel,$endlabel);
if (defined ($pos1)) {
if ($pos1 == 0) { # if position = 0 complain
$self->warn("Position cannot be 0!"); return (-1);
}
if ((defined ($pos2))&&($pos1>$pos2)) {
$self->warn("1st position($pos1) cannot be > 2nd position($pos2)!"); return (-1);
}
$startlabel=$self->label($pos1);
unless ($self->valid($startlabel)) {
$self->warn("Start label not valid"); return (-1);
}
if ($startlabel < 1) {
$self->warn("position $pos1 not valid as start of subseq!"); return (-1);
}
} else {
$startlabel=$self->start;
}
if (defined ($pos2)) {
if ($pos2 == 0) { # if position = 0 complain
$self->warn("Position cannot be 0!"); return (-1);
}
undef $length;
if ((defined ($pos1))&&($pos1>$pos2)) {
$self->warn("1st position($pos1) cannot be > 2nd position($pos2)!"); return (-1);
}
$endlabel=$self->label($pos2);
unless ($self->valid($endlabel)) {
$self->warn("End label not valid"); return (-1);
}
if ($endlabel < 1) {
$self->warn("position $pos2 not valid as end of subseq!"); return (-1);
}
} else {
unless (defined ($length)) {
$endlabel=$self->end;
}
}
return ($self->labelsubseq($startlabel,$length,$endlabel,"unsecuremoderequested"));
}
# works only inside the transcript, complains if asked outside
sub old_subseq {
my ($self,$pos1,$pos2,$length) = @_;
my ($str,$startcount,$endcount,$seq,$seqlength);
if (defined ($length)) {
if ($length < 1) {
$self->warn("No sense asking for a subseq of length < 1");
return (-1);
}
}
my $firstlabel=$self->coordinate_start; # this is inside Transcript obj
my $coord_pos=$self->_inside_position($firstlabel); # TESTME old
$seq=$self->seq;
$seqlength=CORE::length($seq);
unless (defined ($pos1)) {
$startcount=1+$coord_pos-1; # i.e. coord_pos
} else {
if ($pos1 == 0) { # if position = 0 complain
$self->warn("Position cannot be 0!"); return (-1);
} elsif ($pos1 < 0) {
$pos1++;
}
if ((defined ($pos2))&&($pos1>$pos2)) {
$self->warn("1st position ($pos1) cannot be > 2nd position ($pos2)!");
return (-1);
}
$startcount=$pos1+$coord_pos-1;
}
unless (defined ($pos2)) {
;
} else {
if ($pos2 == 0) { # if position = 0 complain
$self->warn("Position cannot be 0!"); return (-1);
} elsif ($pos2 < 0) {
$pos2++;
}
if ((defined ($pos1))&&($pos1>$pos2)) {
$self->warn("1st position ($pos1) cannot be > 2nd position ($pos2)!");
return (-1);
}
$endcount=$pos2+$coord_pos-1;
if ($endcount > $seqlength) {
#print "\n###DEBUG###: pos1 $pos1 pos2 $pos2 coordpos $coord_pos endcount $endcount seqln $seqlength\n";
$self->warn("Cannot access end position after the end of Transcript");
return (-1);
}
$length=$endcount-$startcount+1;
}
#print "\n###DEBUG pos1 $pos1 pos2 $pos2 start $startcount end $endcount length $length coordpos $coord_pos\n";
my $offset=$startcount-1;
if ($offset < 0) {
$self->warn("Cannot access startposition before the beginning of Transcript, returning from start",1); # ignorable
return (substr($seq,0,$length));
} elsif ($offset >= $seqlength) {
$self->warn("Cannot access startposition after the end of Transcript");
return (-1);
} else {
$str=substr($seq,$offset,$length);
if (CORE::length($str) < $length) {
$self->warn("Attention, cannot return the length requested ".
"for subseq",1) if $self->verbose > 0; # ignorable
}
return $str;
}
}
# redefined so that it doesn't require other methods (after deletions) to
# reset it.
sub start {
my $self = shift;
my $exonsref=$self->{'exons'};
my @exons=@{$exonsref};
return ($exons[0]->start);
}
sub end {
my $self = shift;
my $exonsref=$self->{'exons'};
my @exons=@{$exonsref};
return ($exons[-1]->end);
}
# internal methods begin here
# returns: position of label in transcript's all_labels
# with STARTlabel == 1
# errorcode 0 -> label not found
# argument: label
sub _inside_position {
my ($self,$label)=@_;
my ($start,$end,$strand)=($self->start(),$self->end(),$self->strand());
my ($position,$checkme);
my @labels=$self->all_labels;
foreach $checkme (@labels) {
$position++;
if ($label == $checkme) {
return ($position);
}
}
return (0);
}
# returns 1 OK or 0 ERROR
# arguments: reference to array of Exon object references
sub _checkexons {
my ($exon,$thisstart);
my $self=$exon;
my $exonsref=$_[0];
my @exons=@{$exonsref};
my $firstexon = $exons[0];
unless (ref($firstexon) eq "Bio::LiveSeq::Exon") {
$self->warn("Object not of class Exon");
return (0);
}
my $strand = $firstexon->strand;
my $prevend = $firstexon->end;
shift @exons; # skip first one
foreach $exon (@exons) {
unless (ref($exon) eq "Bio::LiveSeq::Exon") { # object class check
$self->warn("Object not of class Exon");
return (0);
}
if ($exon->strand != $strand) { # strand consistency check
$self->warn("Exons' strands not consistent when trying to create Transcript");
return (0);
}
$thisstart = $exon->start;
unless ($exon->{'seq'}->follows($prevend,$thisstart,$strand)) {
$self->warn("Exons not in correct order when trying to create Transcript");
return (0);
}
$prevend = $exon->end;
}
return (1);
}
=head2 get_Translation
Title : valid
Usage : $translation = $obj->get_Translation()
Function: retrieves the reference to the object of class Translation (if any)
attached to a LiveSeq object
Returns : object reference
Args : none
=cut
sub get_Translation {
my $self=shift;
return ($self->{'translation'}); # this is set when Translation->new is called
}
# this checks so that deletion spanning multiple exons is
# handled accordingly and correctly
# arguments: begin and end label of a deletion
# this is called BEFORE any deletion in the chain
sub _deletecheck {
my ($self,$startlabel,$endlabel)=@_;
my $exonsref=$self->{'exons'};
my @exons=@{$exonsref};
my ($startexon,$endexon,$exon);
$startexon=$endexon=0;
foreach $exon (@exons) {
if (($startexon == 0)&&($exon->valid($startlabel))) {
$startexon=$exon; # exon containing start of deletion
}
if (($endexon == 0)&&($exon->valid($endlabel))) {
$endexon=$exon; # exon containing end of deletion
}
if (($startexon)&&($endexon)) {
last; # don't check further
}
}
my $nextend=$self->label(2,$endlabel); # retrieve the next label
my $prevstart=$self->label(-1,$startlabel); # retrieve the prev label
if ($startexon eq $endexon) { # intra-exon deletion
if (($startexon->start eq $startlabel) && ($startexon->end eq $endlabel)) {
# let's delete the entire exon
my @newexons;
foreach $exon (@exons) {
unless ($exon eq $startexon) {
push(@newexons,$exon);
}
}
$self->{'exons'}=\@newexons;
} elsif ($startexon->start eq $startlabel) { # special cases
$startexon->{'start'}=$nextend; # set a new start of exon
} elsif ($startexon->end eq $endlabel) {
$startexon->{'end'}=$prevstart; # set a new end of exon
} else {
return; # no problem
}
} else { # two new exons to be created, inter-exons deletion
my @newexons;
my $exonobj;
my $dna=$self->{'seq'};
my $strand=$self->strand;
my $notmiddle=1; # flag for skipping exons in the middle of deletion
foreach $exon (@exons) {
if ($exon eq $startexon) {
$exonobj=Bio::LiveSeq::Exon->new('-seq'=>$dna,'-start'=>$exon->start,'-end'=>$prevstart,'-strand'=>$strand); # new partial exon
push(@newexons,$exonobj);
$notmiddle=0; # now we enter totally deleted exons
} elsif ($exon eq $endexon) {
$exonobj=Bio::LiveSeq::Exon->new('-seq'=>$dna,'-start'=>$nextend,'-end'=>$exon->end,'-strand'=>$strand); # new partial exon
push(@newexons,$exonobj);
$notmiddle=1; # exiting totally deleted exons
} else {
if ($notmiddle) { # if before or after exons with deletion
push(@newexons,$exon);
}# else skip them
}
}
$self->{'exons'}=\@newexons;
}
}
=head2 translation_table
Title : translation_table
Usage : $name = $obj->translation_table;
: $name = $obj->translation_table(11);
Function: Returns or sets the translation_table used for translating the
transcript.
If it has never been set, it will return undef.
Returns : an integer
=cut
sub translation_table {
my ($self,$value) = @_;
if (defined $value) {
$self->{'translation_table'} = $value;
}
unless (exists $self->{'translation_table'}) {
return;
} else {
return $self->{'translation_table'};
}
}
=head2 frame
Title : frame
Usage : $frame = $transcript->frame($label);
Function: Returns the frame of a particular nucleotide.
Frame can be 0 1 or 2 and means the position in the codon triplet
of the particulat nucleotide. 0 is the first codon_position.
Codon_position (1 2 3) is simply frame+1.
If the label asked for is not inside the Transcript, -1 will be
returned.
Args : a label
Returns : 0 1 or 2
Errorcode -1
=cut
# args: label
# returns: frame of nucleotide (0 1 2)
# errorcode: -1
sub frame {
my ($self,$inputlabel)=@_;
my @labels=$self->all_labels;
my ($label,$frame,$count);
foreach $label (@labels) {
if ($inputlabel == $label) {
return ($count % 3);
}
$count++; # 0 1 2 3 4....
}
return (-1); # label not found amid Transcript labels
}
1;
| 30.531212 | 158 | 0.627566 |
ed45e9fa3541b6436e7876ddc7b8a712ce874170 | 1,444 | al | Perl | results/alignments_translated/Bo5g009990_exon4.al | naturalis/brassica-genes | e060d0938407566b6a7d0f30d61a61eea0c37f1c | [
"MIT"
]
| null | null | null | results/alignments_translated/Bo5g009990_exon4.al | naturalis/brassica-genes | e060d0938407566b6a7d0f30d61a61eea0c37f1c | [
"MIT"
]
| null | null | null | results/alignments_translated/Bo5g009990_exon4.al | naturalis/brassica-genes | e060d0938407566b6a7d0f30d61a61eea0c37f1c | [
"MIT"
]
| null | null | null | >geneid:Bo5g009990;contig:C5;feature:exon4;seqstart:3718158;seqstop:3720230
VKTCQALGRATPPRAQGGQDTALGSLRRPPLMQSSTLTSRNQAAPLTTQPRSASPDPLWR
TSRQGLTRPPPISITYRRENFSPSVVCSPWMRRPSKSLPTARTPPSSRWPVMRFPALANR
VLAGRTGASSLLLAPLRCRKRDSVTSPCTPFSCIARLPQSPSTRLCTGSQGASSSTSNRS
LTKFPLLLVLCNRTSLQRRSLGCSLCPAGAWRGSATRWFRRFSSSPGMTEWLISFTTMIT
ERSSPRSQSLVSLTLVSIIQPRTSLKRLVFSLRTRFGSLTATQNMGCFKTKSFPLISPCA
APRLERLTAVICSTWPTWILLHLLLWRLWTRRTEEKGTPPPLIPPRLGRGRGYGVWWFVT
TQLRGSSRFLSGTLVSFRKCLRYTSTRRWSWRTRLLRRTSCARRRSCAICCVTLRWGLSR
RAPT-WTLNAMEQLSCTKTRYGSWGLRASSISRRLRGCASTTLTRLVALIACTTLGFLEL
LLETRSAEWRLGSRRKTSSGSVLTPLGKDGEVRSMIQTIGMTRGECTRGLPSRPSSKW-K
QGVYLGRTMRWMPYTPCSLFGTLSRMGKLPMIRRSFTRSLMIRLMVYKSKLSLARWFVSR
LPLCRYWRLILMDWLMVGTRRLLSLVFLLMKQSGSISSHMLRILQLKSLRGCKMHK
>seqstart:3722893;seqstop3724964+
VKTCQALGRATPPRAQGGQDTALGSLRRPLLTQSSTLISRSQAAPLTTQPRSASPDPVWR
TSRQGLTRPRLISITYRRESFSPSVVCSPWMRRPSKSLPTARTPPSSRWPVMRFPALANR
VLAGRTGASSLLLAPLRCRKRDSVTSPCTPFSCIARLPQSPSTRLCTGSQGASSSTSNRS
LTKFPLLLVLCNRTSLQRRSLGCSLCPAGAWRGSATRWFRRFSSSPGMTEWLISFTTMIT
ERSSPRSQSLVSLTLVSIIQPRTSLKRLVFSLRTRFGSLTATQNMGCFKTKSFPLISPCA
APRLERLTAVICSTWPTWILLHLLLWRLWTRRTEEKGTPPPLIPPRLRRERGCGDWWFVT
TRLRGSSRFLSGTLVSFRKCLRYTSTRRWSWRTRLLRRTSCARRRSCAICCVTLPWGLSR
RAPTLWTLNAMEQLSCTKTRYGSWGLRASSISRRLRGCASTTLTRLVALIACTTLGFLEL
LLETRSAEWRLGSRRKTSSGSALTPLGKDGEVRSMIQSIETTRGECTRGHRSRLFLKWSR
RGVCLGRTTRWMPYTPCSLFGMLSRMGKLPMIRRSFTRS-MIRLMVYKSKLSLARWFVSR
QLLCRYWRLILMDWLMVGTRRLLSLVFLLMKQ-GSISSHLLKILQLKSLRGCKMH-
| 57.76 | 75 | 0.970222 |
ed413f8f543cee3d4df7925fe1c0be4a1078fbda | 2,177 | t | Perl | t/220_magic.t | mcmillhj/Unicode-UTF8-PP | 404b09c369675df8172d1eee8ffe5d8856e594e3 | [
"Artistic-1.0"
]
| null | null | null | t/220_magic.t | mcmillhj/Unicode-UTF8-PP | 404b09c369675df8172d1eee8ffe5d8856e594e3 | [
"Artistic-1.0"
]
| null | null | null | t/220_magic.t | mcmillhj/Unicode-UTF8-PP | 404b09c369675df8172d1eee8ffe5d8856e594e3 | [
"Artistic-1.0"
]
| null | null | null | #!perl
use strict;
use warnings;
use Test::More;
BEGIN {
eval 'use Variable::Magic qw[cast wizard];';
plan skip_all => 'Variable::Magic is required for this test' if $@;
plan tests => 13;
}
BEGIN {
use_ok('Unicode::UTF8::PP', qw[ decode_utf8
encode_utf8 ]);
}
my ($string_get,
$string_set,
$octets_get,
$octets_set);
my $w_string = wizard get => sub { $string_get++ },
set => sub { $string_set++ };
my $w_octets = wizard get => sub { $octets_get++ },
set => sub { $octets_set++ };
($string_get, $string_set, $octets_get, $octets_set) = (0, 0, 0, 0);
{
my $octets = "\x80\x80\x80";
my $string;
cast $octets, $w_octets;
cast $string, $w_string;
{
no warnings 'utf8';
$string = decode_utf8($octets);
}
is($octets_get, 1, 'decode_utf8() $octets GET magic');
is($octets_set, 0, 'decode_utf8() $octets SET magic');
is($string_get, 0, 'decode_utf8() $string GET magic');
is($string_set, 1, 'decode_utf8() $string SET magic');
}
($string_get, $string_set, $octets_get, $octets_set) = (0, 0, 0, 0);
{
my $octets = "Foo \xE2\x98\xBA";
my $string;
utf8::upgrade($octets);
cast $octets, $w_octets;
cast $string, $w_string;
{
no warnings 'utf8';
$string = decode_utf8($octets);
}
is($octets_get, 1, 'decode_utf8(upgraded) $octets GET magic');
is($octets_set, 0, 'decode_utf8(upgraded) $octets SET magic');
is($string_get, 0, 'decode_utf8(upgraded) $string GET magic');
is($string_set, 1, 'decode_utf8(upgraded) $string SET magic');
}
($string_get, $string_set, $octets_get, $octets_set) = (0, 0, 0, 0);
{
my $string = "\x{110000}\x{110000}\x{110000}";
my $octets;
cast $octets, $w_octets;
cast $string, $w_string;
{
no warnings 'utf8';
$octets = encode_utf8($string);
}
is($octets_get, 0, 'encode_utf8() $octets GET magic');
is($octets_set, 1, 'encode_utf8() $octets SET magic');
is($string_get, 1, 'encode_utf8() $string GET magic');
is($string_set, 0, 'encode_utf8() $string SET magic');
}
| 24.188889 | 71 | 0.580156 |
ed1023a3a8a218dd865d9872293d608f552bca8b | 3,333 | pm | Perl | auto-lib/Paws/Lambda/ListFunctionEventInvokeConfigs.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 164 | 2015-01-08T14:58:53.000Z | 2022-02-20T19:16:24.000Z | auto-lib/Paws/Lambda/ListFunctionEventInvokeConfigs.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 348 | 2015-01-07T22:08:38.000Z | 2022-01-27T14:34:44.000Z | auto-lib/Paws/Lambda/ListFunctionEventInvokeConfigs.pm | 0leksii/aws-sdk-perl | b2132fe3c79a06fd15b6137e8a0eb628de722e0f | [
"Apache-2.0"
]
| 87 | 2015-04-22T06:29:47.000Z | 2021-09-29T14:45:55.000Z |
package Paws::Lambda::ListFunctionEventInvokeConfigs;
use Moose;
has FunctionName => (is => 'ro', isa => 'Str', traits => ['ParamInURI'], uri_name => 'FunctionName', required => 1);
has Marker => (is => 'ro', isa => 'Str', traits => ['ParamInQuery'], query_name => 'Marker');
has MaxItems => (is => 'ro', isa => 'Int', traits => ['ParamInQuery'], query_name => 'MaxItems');
use MooseX::ClassAttribute;
class_has _api_call => (isa => 'Str', is => 'ro', default => 'ListFunctionEventInvokeConfigs');
class_has _api_uri => (isa => 'Str', is => 'ro', default => '/2019-09-25/functions/{FunctionName}/event-invoke-config/list');
class_has _api_method => (isa => 'Str', is => 'ro', default => 'GET');
class_has _returns => (isa => 'Str', is => 'ro', default => 'Paws::Lambda::ListFunctionEventInvokeConfigsResponse');
1;
### main pod documentation begin ###
=head1 NAME
Paws::Lambda::ListFunctionEventInvokeConfigs - Arguments for method ListFunctionEventInvokeConfigs on L<Paws::Lambda>
=head1 DESCRIPTION
This class represents the parameters used for calling the method ListFunctionEventInvokeConfigs on the
L<AWS Lambda|Paws::Lambda> service. Use the attributes of this class
as arguments to method ListFunctionEventInvokeConfigs.
You shouldn't make instances of this class. Each attribute should be used as a named argument in the call to ListFunctionEventInvokeConfigs.
=head1 SYNOPSIS
my $lambda = Paws->service('Lambda');
# To view a list of asynchronous invocation configurations
# The following example returns a list of asynchronous invocation configurations
# for a function named my-function.
my $ListFunctionEventInvokeConfigsResponse =
$lambda->ListFunctionEventInvokeConfigs(
'FunctionName' => 'my-function' );
# Results:
my $FunctionEventInvokeConfigs =
$ListFunctionEventInvokeConfigsResponse->FunctionEventInvokeConfigs;
# Returns a L<Paws::Lambda::ListFunctionEventInvokeConfigsResponse> object.
Values for attributes that are native types (Int, String, Float, etc) can passed as-is (scalar values). Values for complex Types (objects) can be passed as a HashRef. The keys and values of the hashref will be used to instance the underlying object.
For the AWS API documentation, see L<https://docs.aws.amazon.com/goto/WebAPI/lambda/ListFunctionEventInvokeConfigs>
=head1 ATTRIBUTES
=head2 B<REQUIRED> FunctionName => Str
The name of the Lambda function.
B<Name formats>
=over
=item *
B<Function name> - C<my-function>.
=item *
B<Function ARN> -
C<arn:aws:lambda:us-west-2:123456789012:function:my-function>.
=item *
B<Partial ARN> - C<123456789012:function:my-function>.
=back
The length constraint applies only to the full ARN. If you specify only
the function name, it is limited to 64 characters in length.
=head2 Marker => Str
Specify the pagination token that's returned by a previous request to
retrieve the next page of results.
=head2 MaxItems => Int
The maximum number of configurations to return.
=head1 SEE ALSO
This class forms part of L<Paws>, documenting arguments for method ListFunctionEventInvokeConfigs in L<Paws::Lambda>
=head1 BUGS and CONTRIBUTIONS
The source code is located here: L<https://github.com/pplu/aws-sdk-perl>
Please report bugs to: L<https://github.com/pplu/aws-sdk-perl/issues>
=cut
| 31.443396 | 249 | 0.738674 |
ed3a3b0b8eef4ae84a130b273ec3874432ddf8b1 | 3,921 | al | Perl | benchmark/benchmarks/FASP-benchmarks/data/random-oriented/randomoriented-1506-420-630.al | krzysg/FaspHeuristic | 1929c40e3fbc49e68b04acfc5522539a18758031 | [
"MIT"
]
| null | null | null | benchmark/benchmarks/FASP-benchmarks/data/random-oriented/randomoriented-1506-420-630.al | krzysg/FaspHeuristic | 1929c40e3fbc49e68b04acfc5522539a18758031 | [
"MIT"
]
| null | null | null | benchmark/benchmarks/FASP-benchmarks/data/random-oriented/randomoriented-1506-420-630.al | krzysg/FaspHeuristic | 1929c40e3fbc49e68b04acfc5522539a18758031 | [
"MIT"
]
| null | null | null | 1 100 234
2 91
3
4
5 125
6 154
7 114 158
8 248
9 40 153 403
10 53
11 330
12 8
13 52
14 16 255
15
16 91 184
17 59 208 402
18
19 407
20 267 288 358
21 37 110
22 271 324
23 106
24 96
25 202
26 20 234
27
28
29 261 413
30 90 143 219
31 215
32 56 89
33 108
34
35 57
36 190 286 395
37
38 155 165 420
39 119
40 49
41 147 190 264
42 4 136 257 416
43 281
44 253
45 59 166
46 156 231
47 266 362 376
48 247
49 275
50
51 24 329 400
52 232
53 335 350
54 355
55 255 358 406
56 105 218 333
57 45
58
59
60 52 242
61 98 152
62 122
63 370
64 132 414
65 236
66 20
67
68 305
69 60 225 410
70 379
71 317 346
72 77 248
73 7
74 17 188 304
75 94 99 120 216 406
76
77 384
78
79 179 183
80 8 74 277
81 4 281
82 301
83
84 32 117 126 302
85 288
86
87 227
88 41 269 351
89 135 166
90 143 345
91 157 413
92 343
93
94 5
95 31 234 319 330
96 95 126
97
98 236
99
100 236
101 110
102
103 47 98 116 390
104 241
105 118
106 63 90
107 170 357
108 15 240 382
109 143 219
110 63 64 130 337
111 82 253 399
112 18 39 66 72 241
113 138
114 131 365
115
116 54 97 262 402
117
118
119 11
120
121 182
122 11 409
123 29 86
124 48 143 407
125
126 40 117
127 30 311
128
129 40 144 333
130 71 201 224 368 399
131 217
132 311
133 253 310
134 21
135 83 184 417
136 233
137 351
138 173
139
140 160 214 392
141 186
142 373
143 300
144 155
145 240
146 162
147 361 412
148
149
150 171 333
151 44 77
152
153
154
155 124 138 271 357
156
157 383
158
159 232 380
160
161
162 81
163
164
165
166 193
167
168 116 174
169
170 130 420
171 31
172 201
173 269 351
174 248
175 392
176 19
177
178
179 146
180 169 274
181 13 205 372
182
183 186 205
184 175 378
185 157 372
186 41 284
187 117 251
188 55 132 306
189 171
190
191
192 10 20 160 186 381
193
194
195 131
196 33 307
197 402
198 228
199 77 230
200
201 355
202 294
203 90 92 216 259
204 159 274
205 354
206 165
207 111 157 340 365 383
208
209 221 324 405
210 33 64 302
211 63 231 404 416
212 138 176
213 6 311
214
215 47 71 303
216 31 45 376
217 55
218 162
219 45
220 22 311 324
221 116
222 186
223 254
224
225 26
226
227 78
228
229
230 245
231
232 8 175 223
233
234 140 393
235 60 91
236 215
237 246
238 118
239
240 119
241 121 271 297 417
242
243 303 334
244 207 213
245 174 287
246 98 248
247 215
248 94 121 130 212
249 191
250 48 67
251
252 13 332
253
254 200 420
255 27
256 157
257 385
258
259 13 47
260 283
261
262 317 390
263 232
264 59 89 121 159
265 204
266 263 296
267
268 204 337
269 97 145 153 266 297
270 52
271 103 204 299 306
272 128 243 283
273 280
274 189
275 120
276
277 62 267
278 163
279
280 194 389
281 61
282 292
283
284 128 333
285 236
286 215 236 277
287
288 154
289 92 387
290
291 66 316
292 176 332
293 44
294 61 79
295
296 402
297 129 166
298 232 340 405
299
300 53 288
301 200 232 371
302
303 294
304 202
305 49 375
306 278
307 123 203 215
308 73 340
309 99
310 149 167 280 321 328
311
312 196
313 76
314 83
315
316 228 332 387
317 118 324
318
319 139 272
320 92 133 134 244 307
321
322 256
323 200 213 392
324
325 315 401
326
327 1
328 41 189 399
329 118 316
330 2 9
331 175 226 286 363 384
332 29 44 54
333 243 355 367
334 110
335 250
336 56
337 328
338
339 9 159 253
340 87
341
342
343 146 288 387
344 58 164 229
345 1 351
346 153 204 284 386
347 85 88 168 350 365 369
348
349 167 228 356 362
350 130 133
351 327
352 3 320 389
353 264
354
355
356 260 287
357 7 236
358 255 271
359 97
360 293
361 16 168 316 419
362 192 265
363 296 385
364 137 157 353
365 244 249 362
366
367 140
368 13
369
370 169 391 417
371 61 123 377 386
372
373 35 310
374 347 396
375 30 156 253 290 377
376
377 81 376
378 120 298
379 169
380 16 200
381
382 230
383 166 257
384 115 204 345
385 110
386 26
387
388 17 58 151 262 306
389 207
390
391 172 412
392 221
393 74
394 275
395 132 260
396 169
397 80
398 152
399
400 58
401
402 93
403 40 111 416
404
405 379
406 11 268
407 274
408 383 402
409 286 367
410 118 310
411
412 74 263 275
413 125 229 391
414 307 324 373
415 141 239
416 15
417
418 71 209 359
419 16 160 165
420 185 310 | 9.335714 | 25 | 0.732466 |
73e831c3f0cb5b4fb15a1ae6122d5308567d5a99 | 31,674 | pm | Perl | lib/Test/Mojo.pm | stigtsp/mojo | 5dc30d9387d74d13d7cfd3769ad319973f8100f0 | [
"Artistic-2.0"
]
| null | null | null | lib/Test/Mojo.pm | stigtsp/mojo | 5dc30d9387d74d13d7cfd3769ad319973f8100f0 | [
"Artistic-2.0"
]
| null | null | null | lib/Test/Mojo.pm | stigtsp/mojo | 5dc30d9387d74d13d7cfd3769ad319973f8100f0 | [
"Artistic-2.0"
]
| null | null | null | package Test::Mojo;
use Mojo::Base -base;
# "Amy: He knows when you are sleeping.
# Professor: He knows when you're on the can.
# Leela: He'll hunt you down and blast your ass from here to Pakistan.
# Zoidberg: Oh.
# Hermes: You'd better not breathe, you'd better not move.
# Bender: You're better off dead, I'm telling you, dude.
# Fry: Santa Claus is gunning you down!"
use Mojo::IOLoop;
use Mojo::JSON 'j';
use Mojo::JSON::Pointer;
use Mojo::Server;
use Mojo::UserAgent;
use Mojo::Util qw(decode encode);
use Test::More ();
has [qw(message success tx)];
has ua =>
sub { Mojo::UserAgent->new(insecure => 1)->ioloop(Mojo::IOLoop->singleton) };
# Silent or loud tests
$ENV{MOJO_LOG_LEVEL} ||= $ENV{HARNESS_IS_VERBOSE} ? 'debug' : 'fatal';
sub app {
my ($self, $app) = @_;
return $self->ua->server->app unless $app;
$self->ua->server->app($app);
return $self;
}
sub content_is {
my ($self, $value, $desc) = @_;
return $self->_test('is', $self->tx->res->text,
$value, _desc($desc, 'exact match for content'));
}
sub content_isnt {
my ($self, $value, $desc) = @_;
return $self->_test('isnt', $self->tx->res->text,
$value, _desc($desc, 'no match for content'));
}
sub content_like {
my ($self, $regex, $desc) = @_;
return $self->_test('like', $self->tx->res->text,
$regex, _desc($desc, 'content is similar'));
}
sub content_type_is {
my ($self, $type, $desc) = @_;
$desc = _desc($desc, "Content-Type: $type");
return $self->_test('is', $self->tx->res->headers->content_type, $type,
$desc);
}
sub content_type_isnt {
my ($self, $type, $desc) = @_;
$desc = _desc($desc, "not Content-Type: $type");
return $self->_test('isnt', $self->tx->res->headers->content_type, $type,
$desc);
}
sub content_type_like {
my ($self, $regex, $desc) = @_;
$desc = _desc($desc, 'Content-Type is similar');
return $self->_test('like', $self->tx->res->headers->content_type, $regex,
$desc);
}
sub content_type_unlike {
my ($self, $regex, $desc) = @_;
$desc = _desc($desc, 'Content-Type is not similar');
return $self->_test('unlike', $self->tx->res->headers->content_type, $regex,
$desc);
}
sub content_unlike {
my ($self, $regex, $desc) = @_;
return $self->_test('unlike', $self->tx->res->text,
$regex, _desc($desc, 'content is not similar'));
}
sub delete_ok { shift->_build_ok(DELETE => @_) }
sub element_count_is {
my ($self, $selector, $count, $desc) = @_;
my $size = $self->tx->res->dom->find($selector)->size;
return $self->_test('is', $size, $count,
_desc($desc, qq{element count for selector "$selector"}));
}
sub element_exists {
my ($self, $selector, $desc) = @_;
$desc = _desc($desc, qq{element for selector "$selector" exists});
return $self->_test('ok', $self->tx->res->dom->at($selector), $desc);
}
sub element_exists_not {
my ($self, $selector, $desc) = @_;
$desc = _desc($desc, qq{no element for selector "$selector"});
return $self->_test('ok', !$self->tx->res->dom->at($selector), $desc);
}
sub finish_ok {
my $self = shift;
$self->tx->finish(@_) if $self->tx->is_websocket;
Mojo::IOLoop->one_tick while !$self->{finished};
return $self->_test('ok', 1, 'closed WebSocket');
}
sub finished_ok {
my ($self, $code) = @_;
Mojo::IOLoop->one_tick while !$self->{finished};
Test::More::diag "WebSocket closed with status $self->{finished}[0]"
unless my $ok = $self->{finished}[0] == $code;
return $self->_test('ok', $ok, "WebSocket closed with status $code");
}
sub get_ok { shift->_build_ok(GET => @_) }
sub head_ok { shift->_build_ok(HEAD => @_) }
sub header_is {
my ($self, $name, $value, $desc) = @_;
$desc = _desc($desc, "$name: " . ($value // ''));
return $self->_test('is', $self->tx->res->headers->header($name), $value,
$desc);
}
sub header_isnt {
my ($self, $name, $value, $desc) = @_;
$desc = _desc($desc, "not $name: " . ($value // ''));
return $self->_test('isnt', $self->tx->res->headers->header($name), $value,
$desc);
}
sub header_like {
my ($self, $name, $regex, $desc) = @_;
$desc = _desc($desc, "$name is similar");
return $self->_test('like', $self->tx->res->headers->header($name), $regex,
$desc);
}
sub header_unlike {
my ($self, $name, $regex, $desc) = @_;
$desc = _desc($desc, "$name is not similar");
return $self->_test('unlike', $self->tx->res->headers->header($name),
$regex, $desc);
}
sub json_has {
my ($self, $p, $desc) = @_;
$desc = _desc($desc, qq{has value for JSON Pointer "$p"});
return $self->_test('ok',
!!Mojo::JSON::Pointer->new($self->tx->res->json)->contains($p), $desc);
}
sub json_hasnt {
my ($self, $p, $desc) = @_;
$desc = _desc($desc, qq{has no value for JSON Pointer "$p"});
return $self->_test('ok',
!Mojo::JSON::Pointer->new($self->tx->res->json)->contains($p), $desc);
}
sub json_is {
my $self = shift;
my ($p, $data) = @_ > 1 ? (shift, shift) : ('', shift);
my $desc = _desc(shift, qq{exact match for JSON Pointer "$p"});
return $self->_test('is_deeply', $self->tx->res->json($p), $data, $desc);
}
sub json_like {
my ($self, $p, $regex, $desc) = @_;
return $self->_test('like', $self->tx->res->json($p),
$regex, _desc($desc, qq{similar match for JSON Pointer "$p"}));
}
sub json_message_has {
my ($self, $p, $desc) = @_;
$desc = _desc($desc, qq{has value for JSON Pointer "$p"});
return $self->_test('ok', $self->_json(contains => $p), $desc);
}
sub json_message_hasnt {
my ($self, $p, $desc) = @_;
$desc = _desc($desc, qq{has no value for JSON Pointer "$p"});
return $self->_test('ok', !$self->_json(contains => $p), $desc);
}
sub json_message_is {
my $self = shift;
my ($p, $data) = @_ > 1 ? (shift, shift) : ('', shift);
my $desc = _desc(shift, qq{exact match for JSON Pointer "$p"});
return $self->_test('is_deeply', $self->_json(get => $p), $data, $desc);
}
sub json_message_like {
my ($self, $p, $regex, $desc) = @_;
return $self->_test('like', $self->_json(get => $p),
$regex, _desc($desc, qq{similar match for JSON Pointer "$p"}));
}
sub json_message_unlike {
my ($self, $p, $regex, $desc) = @_;
return $self->_test('unlike', $self->_json(get => $p),
$regex, _desc($desc, qq{no similar match for JSON Pointer "$p"}));
}
sub json_unlike {
my ($self, $p, $regex, $desc) = @_;
return $self->_test('unlike', $self->tx->res->json($p),
$regex, _desc($desc, qq{no similar match for JSON Pointer "$p"}));
}
sub message_is {
my ($self, $value, $desc) = @_;
return $self->_message('is', $value, _desc($desc, 'exact match for message'));
}
sub message_isnt {
my ($self, $value, $desc) = @_;
return $self->_message('isnt', $value, _desc($desc, 'no match for message'));
}
sub message_like {
my ($self, $regex, $desc) = @_;
return $self->_message('like', $regex, _desc($desc, 'message is similar'));
}
sub message_ok {
my ($self, $desc) = @_;
return $self->_test('ok', !!$self->_wait, _desc($desc, 'message received'));
}
sub message_unlike {
my ($self, $regex, $desc) = @_;
return $self->_message('unlike', $regex,
_desc($desc, 'message is not similar'));
}
sub new {
my $self = shift->SUPER::new;
return $self unless my $app = shift;
my @args = @_ ? {config => {config_override => 1, %{shift()}}} : ();
return $self->app(Mojo::Server->new->build_app($app, @args)) unless ref $app;
$app = Mojo::Server->new->load_app($app) unless $app->isa('Mojolicious');
return $self->app(@args ? $app->config($args[0]{config}) : $app);
}
sub options_ok { shift->_build_ok(OPTIONS => @_) }
sub or {
my ($self, $cb) = @_;
$self->$cb unless $self->success;
return $self;
}
sub patch_ok { shift->_build_ok(PATCH => @_) }
sub post_ok { shift->_build_ok(POST => @_) }
sub put_ok { shift->_build_ok(PUT => @_) }
sub request_ok { shift->_request_ok($_[0], $_[0]->req->url->to_string) }
sub reset_session {
my $self = shift;
$self->ua->cookie_jar->empty;
return $self->tx(undef);
}
sub send_ok {
my ($self, $msg, $desc) = @_;
$desc = _desc($desc, 'send message');
return $self->_test('ok', 0, $desc) unless $self->tx->is_websocket;
$self->tx->send($msg => sub { Mojo::IOLoop->stop });
Mojo::IOLoop->start;
return $self->_test('ok', 1, $desc);
}
sub status_is {
my ($self, $status, $desc) = @_;
$desc = _desc($desc, "$status " . $self->tx->res->default_message($status));
return $self->_test('is', $self->tx->res->code, $status, $desc);
}
sub status_isnt {
my ($self, $status, $desc) = @_;
return $self->_test('isnt', $self->tx->res->code,
$status,
_desc($desc, "not $status " . $self->tx->res->default_message($status)));
}
sub text_is {
my ($self, $selector, $value, $desc) = @_;
return $self->_test('is', $self->_text($selector),
$value, _desc($desc, qq{exact match for selector "$selector"}));
}
sub text_isnt {
my ($self, $selector, $value, $desc) = @_;
return $self->_test('isnt', $self->_text($selector),
$value, _desc($desc, qq{no match for selector "$selector"}));
}
sub text_like {
my ($self, $selector, $regex, $desc) = @_;
return $self->_test('like', $self->_text($selector),
$regex, _desc($desc, qq{similar match for selector "$selector"}));
}
sub text_unlike {
my ($self, $selector, $regex, $desc) = @_;
return $self->_test('unlike', $self->_text($selector),
$regex, _desc($desc, qq{no similar match for selector "$selector"}));
}
sub websocket_ok {
my $self = shift;
return $self->_request_ok($self->ua->build_websocket_tx(@_), $_[0]);
}
sub _build_ok {
my ($self, $method, $url) = (shift, shift, shift);
local $Test::Builder::Level = $Test::Builder::Level + 1;
return $self->_request_ok($self->ua->build_tx($method, $url, @_), $url);
}
sub _desc { encode 'UTF-8', shift || shift }
sub _json {
my ($self, $method, $p) = @_;
return Mojo::JSON::Pointer->new(j(@{$self->message // []}[1]))->$method($p);
}
sub _message {
my ($self, $name, $value, $desc) = @_;
local $Test::Builder::Level = $Test::Builder::Level + 1;
my ($type, $msg) = @{$self->message // []};
# Type check
if (ref $value eq 'HASH') {
my $expect = exists $value->{text} ? 'text' : 'binary';
$value = $value->{$expect};
$msg = '' unless ($type // '') eq $expect;
}
# Decode text frame if there is no type check
else { $msg = decode 'UTF-8', $msg if ($type // '') eq 'text' }
return $self->_test($name, $msg // '', $value, $desc);
}
sub _request_ok {
my ($self, $tx, $url) = @_;
local $Test::Builder::Level = $Test::Builder::Level + 1;
# Establish WebSocket connection
if ($tx->req->is_handshake) {
@$self{qw(finished messages)} = (undef, []);
$self->ua->start(
$tx => sub {
my ($ua, $tx) = @_;
$self->{finished} = [] unless $self->tx($tx)->tx->is_websocket;
$tx->on(finish => sub { shift; $self->{finished} = [@_] });
$tx->on(binary => sub { push @{$self->{messages}}, [binary => pop] });
$tx->on(text => sub { push @{$self->{messages}}, [text => pop] });
Mojo::IOLoop->stop;
}
);
Mojo::IOLoop->start;
my $desc = _desc("WebSocket handshake with $url");
return $self->_test('ok', $self->tx->is_websocket, $desc);
}
# Perform request
$self->tx($self->ua->start($tx));
my $err = $self->tx->error;
Test::More::diag $err->{message}
if !(my $ok = !$err->{message} || $err->{code}) && $err;
return $self->_test('ok', $ok, _desc("@{[uc $tx->req->method]} $url"));
}
sub _test {
my ($self, $name, @args) = @_;
local $Test::Builder::Level = $Test::Builder::Level + 2;
return $self->success(!!Test::More->can($name)->(@args));
}
sub _text {
return '' unless my $e = shift->tx->res->dom->at(shift);
return $e->text;
}
sub _wait {
my $self = shift;
Mojo::IOLoop->one_tick while !$self->{finished} && !@{$self->{messages}};
return $self->message(shift @{$self->{messages}})->message;
}
1;
=encoding utf8
=head1 NAME
Test::Mojo - Testing Mojo
=head1 SYNOPSIS
use Test::More;
use Test::Mojo;
my $t = Test::Mojo->new('MyApp');
# HTML/XML
$t->get_ok('/welcome')->status_is(200)->text_is('div#message' => 'Hello!');
# JSON
$t->post_ok('/search.json' => form => {q => 'Perl'})
->status_is(200)
->header_is('Server' => 'Mojolicious (Perl)')
->header_isnt('X-Bender' => 'Bite my shiny metal ass!')
->json_is('/results/4/title' => 'Perl rocks!')
->json_like('/results/7/title' => qr/Perl/);
# WebSocket
$t->websocket_ok('/echo')
->send_ok('hello')
->message_ok
->message_is('echo: hello')
->finish_ok;
done_testing();
=head1 DESCRIPTION
L<Test::Mojo> is a test user agent based on L<Mojo::UserAgent>, it is usually
used together with L<Test::More> to test L<Mojolicious> applications. Just run
your tests with L<prove>.
$ prove -l -v
$ prove -l -v t/foo.t
If it is not already defined, the C<MOJO_LOG_LEVEL> environment variable will
be set to C<debug> or C<fatal>, depending on the value of the
C<HARNESS_IS_VERBOSE> environment variable. And to make it esier to test
HTTPS/WSS web services L<Mojo::UserAgent/"insecure"> will be activated by
default for L</"ua">.
See L<Mojolicious::Guides::Testing> for more.
=head1 ATTRIBUTES
L<Test::Mojo> implements the following attributes.
=head2 message
my $msg = $t->message;
$t = $t->message([text => $bytes]);
Current WebSocket message represented as an array reference containing the
frame type and payload.
# More specific tests
use Mojo::JSON 'decode_json';
my $hash = decode_json $t->message->[1];
is ref $hash, 'HASH', 'right reference';
is $hash->{foo}, 'bar', 'right value';
# Test custom message
$t->message([binary => $bytes])
->json_message_has('/foo/bar')
->json_message_hasnt('/bar')
->json_message_is('/foo/baz' => {yada => [1, 2, 3]});
=head2 success
my $bool = $t->success;
$t = $t->success($bool);
True if the last test was successful.
# Build custom tests
my $location_is = sub {
my ($t, $value, $desc) = @_;
$desc ||= "Location: $value";
local $Test::Builder::Level = $Test::Builder::Level + 1;
return $t->success(is($t->tx->res->headers->location, $value, $desc));
};
$t->get_ok('/')
->status_is(302)
->$location_is('https://mojolicious.org')
->or(sub { diag 'Must have been Joel!' });
=head2 tx
my $tx = $t->tx;
$t = $t->tx(Mojo::Transaction::HTTP->new);
Current transaction, usually a L<Mojo::Transaction::HTTP> or
L<Mojo::Transaction::WebSocket> object.
# More specific tests
is $t->tx->res->json->{foo}, 'bar', 'right value';
ok $t->tx->res->content->is_multipart, 'multipart content';
is $t->tx->previous->res->code, 302, 'right status';
=head2 ua
my $ua = $t->ua;
$t = $t->ua(Mojo::UserAgent->new);
User agent used for testing, defaults to a L<Mojo::UserAgent> object.
# Allow redirects
$t->ua->max_redirects(10);
$t->get_ok('/redirect')->status_is(200)->content_like(qr/redirected/);
# Switch protocol from HTTP to HTTPS
$t->ua->server->url('https');
$t->get_ok('/secure')->status_is(200)->content_like(qr/secure/);
# Use absolute URL for request with Basic authentication
my $url = $t->ua->server->url->userinfo('sri:secr3t')->path('/secrets.json');
$t->post_ok($url => json => {limit => 10})
->status_is(200)
->json_is('/1/content', 'Mojo rocks!');
# Customize all transactions (including followed redirects)
$t->ua->on(start => sub {
my ($ua, $tx) = @_;
$tx->req->headers->accept_language('en-US');
});
$t->get_ok('/hello')->status_is(200)->content_like(qr/Howdy/);
=head1 METHODS
L<Test::Mojo> inherits all methods from L<Mojo::Base> and implements the
following new ones.
=head2 app
my $app = $t->app;
$t = $t->app(Mojolicious->new);
Access application with L<Mojo::UserAgent::Server/"app">.
# Change log level
$t->app->log->level('fatal');
# Test application directly
is $t->app->defaults->{foo}, 'bar', 'right value';
ok $t->app->routes->find('echo')->is_websocket, 'WebSocket route';
my $c = $t->app->build_controller;
ok $c->render(template => 'foo'), 'rendering was successful';
is $c->res->status, 200, 'right status';
is $c->res->body, 'Foo!', 'right content';
# Change application behavior
$t->app->hook(before_dispatch => sub {
my $c = shift;
$c->render(text => 'This request did not reach the router.')
if $c->req->url->path->contains('/user');
});
$t->get_ok('/user')->status_is(200)->content_like(qr/not reach the router/);
# Extract additional information
my $stash;
$t->app->hook(after_dispatch => sub { $stash = shift->stash });
$t->get_ok('/hello')->status_is(200);
is $stash->{foo}, 'bar', 'right value';
=head2 content_is
$t = $t->content_is('working!');
$t = $t->content_is('working!', 'right content');
Check response content for exact match after retrieving it from
L<Mojo::Message/"text">.
=head2 content_isnt
$t = $t->content_isnt('working!');
$t = $t->content_isnt('working!', 'different content');
Opposite of L</"content_is">.
=head2 content_like
$t = $t->content_like(qr/working!/);
$t = $t->content_like(qr/working!/, 'right content');
Check response content for similar match after retrieving it from
L<Mojo::Message/"text">.
=head2 content_type_is
$t = $t->content_type_is('text/html');
$t = $t->content_type_is('text/html', 'right content type');
Check response C<Content-Type> header for exact match.
=head2 content_type_isnt
$t = $t->content_type_isnt('text/html');
$t = $t->content_type_isnt('text/html', 'different content type');
Opposite of L</"content_type_is">.
=head2 content_type_like
$t = $t->content_type_like(qr/text/);
$t = $t->content_type_like(qr/text/, 'right content type');
Check response C<Content-Type> header for similar match.
=head2 content_type_unlike
$t = $t->content_type_unlike(qr/text/);
$t = $t->content_type_unlike(qr/text/, 'different content type');
Opposite of L</"content_type_like">.
=head2 content_unlike
$t = $t->content_unlike(qr/working!/);
$t = $t->content_unlike(qr/working!/, 'different content');
Opposite of L</"content_like">.
=head2 delete_ok
$t = $t->delete_ok('http://example.com/foo');
$t = $t->delete_ok('/foo');
$t = $t->delete_ok('/foo' => {Accept => '*/*'} => 'Content!');
$t = $t->delete_ok('/foo' => {Accept => '*/*'} => form => {a => 'b'});
$t = $t->delete_ok('/foo' => {Accept => '*/*'} => json => {a => 'b'});
Perform a C<DELETE> request and check for transport errors, takes the same
arguments as L<Mojo::UserAgent/"delete">, except for the callback.
=head2 element_count_is
$t = $t->element_count_is('div.foo[x=y]', 5);
$t = $t->element_count_is('html body div', 30, 'thirty elements');
Checks the number of HTML/XML elements matched by the CSS selector with
L<Mojo::DOM/"find">.
=head2 element_exists
$t = $t->element_exists('div.foo[x=y]');
$t = $t->element_exists('html head title', 'has a title');
Checks for existence of the CSS selectors first matching HTML/XML element with
L<Mojo::DOM/"at">.
# Check attribute values
$t->get_ok('/login')
->element_exists('label[for=email]')
->element_exists('input[name=email][type=text][value*="example.com"]')
->element_exists('label[for=pass]')
->element_exists('input[name=pass][type=password]')
->element_exists('input[type=submit][value]');
=head2 element_exists_not
$t = $t->element_exists_not('div.foo[x=y]');
$t = $t->element_exists_not('html head title', 'has no title');
Opposite of L</"element_exists">.
=head2 finish_ok
$t = $t->finish_ok;
$t = $t->finish_ok(1000);
$t = $t->finish_ok(1003 => 'Cannot accept data!');
Close WebSocket connection gracefully.
=head2 finished_ok
$t = $t->finished_ok(1000);
Wait for WebSocket connection to be closed gracefully and check status.
=head2 get_ok
$t = $t->get_ok('http://example.com/foo');
$t = $t->get_ok('/foo');
$t = $t->get_ok('/foo' => {Accept => '*/*'} => 'Content!');
$t = $t->get_ok('/foo' => {Accept => '*/*'} => form => {a => 'b'});
$t = $t->get_ok('/foo' => {Accept => '*/*'} => json => {a => 'b'});
Perform a C<GET> request and check for transport errors, takes the same
arguments as L<Mojo::UserAgent/"get">, except for the callback.
# Run tests against remote host
$t->get_ok('https://mojolicious.org/perldoc')->status_is(200);
# Use relative URL for request with Basic authentication
$t->get_ok('//sri:secr3t@/secrets.json')
->status_is(200)
->json_is('/1/content', 'Mojo rocks!');
# Run additional tests on the transaction
$t->get_ok('/foo')->status_is(200);
is $t->tx->res->dom->at('input')->val, 'whatever', 'right value';
=head2 head_ok
$t = $t->head_ok('http://example.com/foo');
$t = $t->head_ok('/foo');
$t = $t->head_ok('/foo' => {Accept => '*/*'} => 'Content!');
$t = $t->head_ok('/foo' => {Accept => '*/*'} => form => {a => 'b'});
$t = $t->head_ok('/foo' => {Accept => '*/*'} => json => {a => 'b'});
Perform a C<HEAD> request and check for transport errors, takes the same
arguments as L<Mojo::UserAgent/"head">, except for the callback.
=head2 header_is
$t = $t->header_is(ETag => '"abc321"');
$t = $t->header_is(ETag => '"abc321"', 'right header');
Check response header for exact match.
=head2 header_isnt
$t = $t->header_isnt(Etag => '"abc321"');
$t = $t->header_isnt(ETag => '"abc321"', 'different header');
Opposite of L</"header_is">.
=head2 header_like
$t = $t->header_like(ETag => qr/abc/);
$t = $t->header_like(ETag => qr/abc/, 'right header');
Check response header for similar match.
=head2 header_unlike
$t = $t->header_unlike(ETag => qr/abc/);
$t = $t->header_unlike(ETag => qr/abc/, 'different header');
Opposite of L</"header_like">.
=head2 json_has
$t = $t->json_has('/foo');
$t = $t->json_has('/minibar', 'has a minibar');
Check if JSON response contains a value that can be identified using the given
JSON Pointer with L<Mojo::JSON::Pointer>.
=head2 json_hasnt
$t = $t->json_hasnt('/foo');
$t = $t->json_hasnt('/minibar', 'no minibar');
Opposite of L</"json_has">.
=head2 json_is
$t = $t->json_is({foo => [1, 2, 3]});
$t = $t->json_is('/foo' => [1, 2, 3]);
$t = $t->json_is('/foo/1' => 2, 'right value');
Check the value extracted from JSON response using the given JSON Pointer with
L<Mojo::JSON::Pointer>, which defaults to the root value if it is omitted.
=head2 json_like
$t = $t->json_like('/foo/1' => qr/^\d+$/);
$t = $t->json_like('/foo/1' => qr/^\d+$/, 'right value');
Check the value extracted from JSON response using the given JSON Pointer with
L<Mojo::JSON::Pointer> for similar match.
=head2 json_message_has
$t = $t->json_message_has('/foo');
$t = $t->json_message_has('/minibar', 'has a minibar');
Check if JSON WebSocket message contains a value that can be identified using
the given JSON Pointer with L<Mojo::JSON::Pointer>.
=head2 json_message_hasnt
$t = $t->json_message_hasnt('/foo');
$t = $t->json_message_hasnt('/minibar', 'no minibar');
Opposite of L</"json_message_has">.
=head2 json_message_is
$t = $t->json_message_is({foo => [1, 2, 3]});
$t = $t->json_message_is('/foo' => [1, 2, 3]);
$t = $t->json_message_is('/foo/1' => 2, 'right value');
Check the value extracted from JSON WebSocket message using the given JSON
Pointer with L<Mojo::JSON::Pointer>, which defaults to the root value if it is
omitted.
=head2 json_message_like
$t = $t->json_message_like('/foo/1' => qr/^\d+$/);
$t = $t->json_message_like('/foo/1' => qr/^\d+$/, 'right value');
Check the value extracted from JSON WebSocket message using the given JSON
Pointer with L<Mojo::JSON::Pointer> for similar match.
=head2 json_message_unlike
$t = $t->json_message_unlike('/foo/1' => qr/^\d+$/);
$t = $t->json_message_unlike('/foo/1' => qr/^\d+$/, 'different value');
Opposite of L</"json_message_like">.
=head2 json_unlike
$t = $t->json_unlike('/foo/1' => qr/^\d+$/);
$t = $t->json_unlike('/foo/1' => qr/^\d+$/, 'different value');
Opposite of L</"json_like">.
=head2 message_is
$t = $t->message_is({binary => $bytes});
$t = $t->message_is({text => $bytes});
$t = $t->message_is('working!');
$t = $t->message_is('working!', 'right message');
Check WebSocket message for exact match.
=head2 message_isnt
$t = $t->message_isnt({binary => $bytes});
$t = $t->message_isnt({text => $bytes});
$t = $t->message_isnt('working!');
$t = $t->message_isnt('working!', 'different message');
Opposite of L</"message_is">.
=head2 message_like
$t = $t->message_like({binary => qr/$bytes/});
$t = $t->message_like({text => qr/$bytes/});
$t = $t->message_like(qr/working!/);
$t = $t->message_like(qr/working!/, 'right message');
Check WebSocket message for similar match.
=head2 message_ok
$t = $t->message_ok;
$t = $t->message_ok('got a message');
Wait for next WebSocket message to arrive.
# Wait for message and perform multiple tests on it
$t->websocket_ok('/time')
->message_ok
->message_like(qr/\d+/)
->message_unlike(qr/\w+/)
->finish_ok;
=head2 message_unlike
$t = $t->message_unlike({binary => qr/$bytes/});
$t = $t->message_unlike({text => qr/$bytes/});
$t = $t->message_unlike(qr/working!/);
$t = $t->message_unlike(qr/working!/, 'different message');
Opposite of L</"message_like">.
=head2 new
my $t = Test::Mojo->new;
my $t = Test::Mojo->new('MyApp');
my $t = Test::Mojo->new('MyApp', {foo => 'bar'});
my $t = Test::Mojo->new(Mojo::File->new('/path/to/myapp.pl'));
my $t = Test::Mojo->new(Mojo::File->new('/path/to/myapp.pl'), {foo => 'bar'});
my $t = Test::Mojo->new(MyApp->new);
my $t = Test::Mojo->new(MyApp->new, {foo => 'bar'});
Construct a new L<Test::Mojo> object. In addition to a class name or
L<Mojo::File> object pointing to the application script, you can pass along a
hash reference with configuration values that will be used to override the
application configuration. The special configuration value C<config_override>
will be set in L<Mojolicious/"config"> as well, which is used to disable
configuration plugins like L<Mojolicious::Plugin::Config> and
L<Mojolicious::Plugin::JSONConfig> for tests.
# Load application script relative to the "t" directory
use Mojo::File 'path';
my $t = Test::Mojo->new(path(__FILE__)->dirname->sibling('myapp.pl'));
=head2 options_ok
$t = $t->options_ok('http://example.com/foo');
$t = $t->options_ok('/foo');
$t = $t->options_ok('/foo' => {Accept => '*/*'} => 'Content!');
$t = $t->options_ok('/foo' => {Accept => '*/*'} => form => {a => 'b'});
$t = $t->options_ok('/foo' => {Accept => '*/*'} => json => {a => 'b'});
Perform a C<OPTIONS> request and check for transport errors, takes the same
arguments as L<Mojo::UserAgent/"options">, except for the callback.
=head2 or
$t = $t->or(sub {...});
Execute callback if the value of L</"success"> is false.
# Diagnostics
$t->get_ok('/bad')->or(sub { diag 'Must have been Glen!' })
->status_is(200)->or(sub { diag $t->tx->res->dom->at('title')->text });
=head2 patch_ok
$t = $t->patch_ok('http://example.com/foo');
$t = $t->patch_ok('/foo');
$t = $t->patch_ok('/foo' => {Accept => '*/*'} => 'Content!');
$t = $t->patch_ok('/foo' => {Accept => '*/*'} => form => {a => 'b'});
$t = $t->patch_ok('/foo' => {Accept => '*/*'} => json => {a => 'b'});
Perform a C<PATCH> request and check for transport errors, takes the same
arguments as L<Mojo::UserAgent/"patch">, except for the callback.
=head2 post_ok
$t = $t->post_ok('http://example.com/foo');
$t = $t->post_ok('/foo');
$t = $t->post_ok('/foo' => {Accept => '*/*'} => 'Content!');
$t = $t->post_ok('/foo' => {Accept => '*/*'} => form => {a => 'b'});
$t = $t->post_ok('/foo' => {Accept => '*/*'} => json => {a => 'b'});
Perform a C<POST> request and check for transport errors, takes the same
arguments as L<Mojo::UserAgent/"post">, except for the callback.
# Test file upload
my $upload = {foo => {content => 'bar', filename => 'baz.txt'}};
$t->post_ok('/upload' => form => $upload)->status_is(200);
# Test JSON API
$t->post_ok('/hello.json' => json => {hello => 'world'})
->status_is(200)
->json_is({bye => 'world'});
=head2 put_ok
$t = $t->put_ok('http://example.com/foo');
$t = $t->put_ok('/foo');
$t = $t->put_ok('/foo' => {Accept => '*/*'} => 'Content!');
$t = $t->put_ok('/foo' => {Accept => '*/*'} => form => {a => 'b'});
$t = $t->put_ok('/foo' => {Accept => '*/*'} => json => {a => 'b'});
Perform a C<PUT> request and check for transport errors, takes the same
arguments as L<Mojo::UserAgent/"put">, except for the callback.
=head2 request_ok
$t = $t->request_ok(Mojo::Transaction::HTTP->new);
Perform request and check for transport errors.
# Request with custom method
my $tx = $t->ua->build_tx(FOO => '/test.json' => json => {foo => 1});
$t->request_ok($tx)->status_is(200)->json_is({success => 1});
# Request with custom cookie
my $tx = $t->ua->build_tx(GET => '/account');
$tx->req->cookies({name => 'user', value => 'sri'});
$t->request_ok($tx)->status_is(200)->text_is('head > title' => 'Hello sri');
# Custom WebSocket handshake
my $tx = $t->ua->build_websocket_tx('/foo');
$tx->req->headers->remove('User-Agent');
$t->request_ok($tx)->message_ok->message_is('bar')->finish_ok;
=head2 reset_session
$t = $t->reset_session;
Reset user agent session.
=head2 send_ok
$t = $t->send_ok({binary => $bytes});
$t = $t->send_ok({text => $bytes});
$t = $t->send_ok({json => {test => [1, 2, 3]}});
$t = $t->send_ok([$fin, $rsv1, $rsv2, $rsv3, $op, $payload]);
$t = $t->send_ok($chars);
$t = $t->send_ok($chars, 'sent successfully');
Send message or frame via WebSocket.
# Send JSON object as "Text" message
$t->websocket_ok('/echo.json')
->send_ok({json => {test => 'I ♥ Mojolicious!'}})
->message_ok
->json_message_is('/test' => 'I ♥ Mojolicious!')
->finish_ok;
=head2 status_is
$t = $t->status_is(200);
$t = $t->status_is(200, 'right status');
Check response status for exact match.
=head2 status_isnt
$t = $t->status_isnt(200);
$t = $t->status_isnt(200, 'different status');
Opposite of L</"status_is">.
=head2 text_is
$t = $t->text_is('div.foo[x=y]' => 'Hello!');
$t = $t->text_is('html head title' => 'Hello!', 'right title');
Checks text content of the CSS selectors first matching HTML/XML element for
exact match with L<Mojo::DOM/"at">.
=head2 text_isnt
$t = $t->text_isnt('div.foo[x=y]' => 'Hello!');
$t = $t->text_isnt('html head title' => 'Hello!', 'different title');
Opposite of L</"text_is">.
=head2 text_like
$t = $t->text_like('div.foo[x=y]' => qr/Hello/);
$t = $t->text_like('html head title' => qr/Hello/, 'right title');
Checks text content of the CSS selectors first matching HTML/XML element for
similar match with L<Mojo::DOM/"at">.
=head2 text_unlike
$t = $t->text_unlike('div.foo[x=y]' => qr/Hello/);
$t = $t->text_unlike('html head title' => qr/Hello/, 'different title');
Opposite of L</"text_like">.
=head2 websocket_ok
$t = $t->websocket_ok('http://example.com/echo');
$t = $t->websocket_ok('/echo');
$t = $t->websocket_ok('/echo' => {DNT => 1} => ['v1.proto']);
Open a WebSocket connection with transparent handshake, takes the same
arguments as L<Mojo::UserAgent/"websocket">, except for the callback.
# WebSocket with permessage-deflate compression
$t->websocket_ok('/' => {'Sec-WebSocket-Extensions' => 'permessage-deflate'})
->send_ok('y' x 50000)
->message_ok
->message_is('z' x 50000)
->finish_ok;
=head1 SEE ALSO
L<Mojolicious>, L<Mojolicious::Guides>, L<https://mojolicious.org>.
=cut
| 29.382189 | 80 | 0.615773 |
ed20256bafb2ed9333accb6a046c4418e418af41 | 28,347 | pm | Perl | lib/Hijk.pm | gitpan/Hijk | a5a054c47d0ad4186e9e78a365728693d57c9676 | [
"MIT"
]
| null | null | null | lib/Hijk.pm | gitpan/Hijk | a5a054c47d0ad4186e9e78a365728693d57c9676 | [
"MIT"
]
| null | null | null | lib/Hijk.pm | gitpan/Hijk | a5a054c47d0ad4186e9e78a365728693d57c9676 | [
"MIT"
]
| null | null | null | package Hijk;
use strict;
use warnings;
use POSIX qw(:errno_h);
use Socket qw(PF_INET SOCK_STREAM pack_sockaddr_in inet_ntoa $CRLF SOL_SOCKET SO_ERROR);
use Fcntl qw(F_GETFL F_SETFL O_NONBLOCK);
our $VERSION = "0.18";
sub Hijk::Error::CONNECT_TIMEOUT () { 1 << 0 } # 1
sub Hijk::Error::READ_TIMEOUT () { 1 << 1 } # 2
sub Hijk::Error::TIMEOUT () { Hijk::Error::READ_TIMEOUT | Hijk::Error::CONNECT_TIMEOUT } # 3
sub Hijk::Error::CANNOT_RESOLVE () { 1 << 2 } # 4
sub Hijk::Error::REQUEST_SELECT_ERROR () { 1 << 3 } # 8
sub Hijk::Error::REQUEST_WRITE_ERROR () { 1 << 4 } # 16
sub Hijk::Error::REQUEST_ERROR () { Hijk::Error::REQUEST_SELECT_ERROR | Hijk::Error::REQUEST_WRITE_ERROR } # 24
sub Hijk::Error::RESPONSE_READ_ERROR () { 1 << 5 } # 32
sub Hijk::Error::RESPONSE_BAD_READ_VALUE () { 1 << 6 } # 64
sub Hijk::Error::RESPONSE_ERROR () { Hijk::Error::RESPONSE_READ_ERROR | Hijk::Error::RESPONSE_BAD_READ_VALUE } # 96
sub _read_http_message {
my ($fd, $read_length, $read_timeout, $parse_chunked, $head_as_array, $method) = @_;
$read_timeout = undef if defined($read_timeout) && $read_timeout <= 0;
my ($body,$buf,$decapitated,$nbytes,$proto);
my $status_code = 0;
my $header = $head_as_array ? [] : {};
my $no_content_len = 0;
my $head = "";
my $method_is_head = do { no warnings qw(uninitialized); $method eq "HEAD" };
vec(my $rin = '', $fd, 1) = 1;
do {
return (undef,undef,0,undef,undef, Hijk::Error::READ_TIMEOUT)
if ((select($rin, undef, undef, $read_timeout) != 1) || (defined($read_timeout) && $read_timeout <= 0));
my $nbytes = POSIX::read($fd, $buf, $read_length);
return ($proto, undef, $status_code, $header, $body)
if $no_content_len && $decapitated && (!defined($nbytes) || $nbytes == 0);
if (!defined($nbytes)) {
next if ($! == EWOULDBLOCK || $! == EAGAIN);
return (
undef, undef, 0, undef, undef,
Hijk::Error::RESPONSE_READ_ERROR,
"Failed to read http " . ($decapitated ? "body": "head") . " from socket",
$!+0,
"$!",
);
}
if ($nbytes == 0) {
return (
undef, undef, 0, undef, undef,
Hijk::Error::RESPONSE_BAD_READ_VALUE,
"Wasn't expecting a 0 byte response for http " . ($decapitated ? "body": "head" ) . ". This shouldn't happen",
);
}
if ($decapitated) {
$body .= $buf;
if (!$no_content_len) {
$read_length -= $nbytes;
}
}
else {
$head .= $buf;
my $neck_pos = index($head, "${CRLF}${CRLF}");
if ($neck_pos > 0) {
$decapitated = 1;
$body = substr($head, $neck_pos+4);
$head = substr($head, 0, $neck_pos);
$proto = substr($head, 0, 8);
$status_code = substr($head, 9, 3);
substr($head, 0, index($head, $CRLF) + 2, ""); # 2 = length($CRLF)
my ($doing_chunked, $content_length, $close_connection, $trailer_mode);
for (split /${CRLF}/o, $head) {
my ($key, $value) = split /: /, $_, 2;
if ($head_as_array) {
push @$header => $key, $value;
# Figure this out now so we don't need to scan
# the list later.
if ($key eq 'Transfer-Encoding' and $value eq 'chunked') {
$doing_chunked = 1;
} elsif ($key eq 'Content-Length') {
$content_length = $value;
} elsif ($key eq 'Connection' and $value eq 'close') {
$close_connection = 1
} elsif ($doing_chunked and $key eq 'Trailer' and $value) {
$trailer_mode = 1;
}
} else {
$header->{$key} = $value;
}
}
if (($head_as_array and $doing_chunked)
or
(!$head_as_array and ($header->{'Transfer-Encoding'} and $header->{'Transfer-Encoding'} eq 'chunked'))) {
die "PANIC: The experimental Hijk support for chunked transfer encoding needs to be explicitly enabled with parse_chunked => 1"
unless $parse_chunked;
# if there is chunked encoding we have to ignore content lenght even if we have it
return (
$close_connection, $proto, $status_code, $header,
_read_chunked_body(
$body, $fd, $read_length, $read_timeout,
$head_as_array
? $trailer_mode
: ($header->{Trailer} ? 1 : 0),
),
);
}
if ($head_as_array and $content_length) {
$read_length = $content_length - length($body);
} elsif (!$head_as_array and $header->{'Content-Length'}) {
$read_length = $header->{'Content-Length'} - length($body);
} else {
$read_length = 10204;
$no_content_len = 1;
}
}
}
} while( !$decapitated || (!$method_is_head && ($read_length > 0 || $no_content_len)) );
return (undef, $proto, $status_code, $header, $body);
}
sub _read_chunked_body {
my ($buf,$fd,$read_length,$read_timeout,$true_trailer_header) = @_;
my $chunk_size = 0;
my $body = "";
my $trailer_mode = 0;
vec(my $rin = '', $fd, 1) = 1;
while(1) {
# just read a 10k block and process it until it is consumed
if (length($buf) == 0 || length($buf) < $chunk_size) {
return (undef, Hijk::Error::READ_TIMEOUT)
if ((select($rin, undef, undef, $read_timeout) != 1) || (defined($read_timeout) && $read_timeout <= 0));
my $current_buf = "";
my $nbytes = POSIX::read($fd, $current_buf, $read_length);
if (!defined($nbytes)) {
next if ($! == EWOULDBLOCK || $! == EAGAIN);
return (
undef,
Hijk::Error::RESPONSE_READ_ERROR,
"Failed to chunked http body from socket",
$!+0,
"$!",
);
}
if ($nbytes == 0) {
return (
undef,
Hijk::Error::RESPONSE_BAD_READ_VALUE,
"Wasn't expecting a 0 byte response for chunked http body. This shouldn't happen, buf:<$buf>, current_buf:<$current_buf>",
);
}
$buf .= $current_buf;
}
if ($trailer_mode) {
# http://tools.ietf.org/html/rfc2616#section-14.40
# http://tools.ietf.org/html/rfc2616#section-3.6.1
# A server using chunked transfer-coding in a response MUST NOT use the
# trailer for any header fields unless at least one of the following is
# true:
# a)the request included a TE header field that indicates "trailers" is
# acceptable in the transfer-coding of the response, as described in
# section 14.39; or,
# b)the server is the origin server for the response, the trailer
# fields consist entirely of optional metadata, and the recipient
# could use the message (in a manner acceptable to the origin server)
# without receiving this metadata. In other words, the origin server
# is willing to accept the possibility that the trailer fields might
# be silently discarded along the path to the client.
# in case of trailer mode, we just read everything until the next CRLFCRLF
my $neck_pos = index($buf, "${CRLF}${CRLF}");
if ($neck_pos > 0) {
return $body;
}
} else {
if ($chunk_size > 0 && length($buf) >= $chunk_size) {
$body .= substr($buf, 0, $chunk_size - 2); # our chunk size includes the CRLF
$buf = substr($buf, $chunk_size);
$chunk_size = 0;
} else {
my $neck_pos = index($buf, ${CRLF});
if ($neck_pos > 0) {
$chunk_size = hex(substr($buf, 0, $neck_pos));
if ($chunk_size == 0) {
if ($true_trailer_header) {
$trailer_mode = 1;
} else {
return $body;
}
} else {
$chunk_size += 2; # include the final CRLF
$buf = substr($buf, $neck_pos + 2);
}
}
}
}
}
}
sub _construct_socket {
my ($host, $port, $connect_timeout) = @_;
# If we can't find the IP address there'll be no point in even
# setting up a socket.
my $addr;
{
my $inet_aton = gethostbyname($host);
return (undef, {error => Hijk::Error::CANNOT_RESOLVE}) unless defined $inet_aton;
$addr = pack_sockaddr_in($port, $inet_aton);
}
my $tcp_proto = getprotobyname("tcp");
my $soc;
socket($soc, PF_INET, SOCK_STREAM, $tcp_proto) || die "Failed to construct TCP socket: $!";
my $flags = fcntl($soc, F_GETFL, 0) or die "Failed to set fcntl F_GETFL flag: $!";
fcntl($soc, F_SETFL, $flags | O_NONBLOCK) or die "Failed to set fcntl O_NONBLOCK flag: $!";
if (!connect($soc, $addr) && $! != EINPROGRESS) {
die "Failed to connect $!";
}
$connect_timeout = undef if defined($connect_timeout) && $connect_timeout <= 0;
vec(my $rout = '', fileno($soc), 1) = 1;
if (select(undef, $rout, undef, $connect_timeout) != 1) {
if (defined($connect_timeout)) {
return (undef, {error => Hijk::Error::CONNECT_TIMEOUT});
} else {
return (
undef,
{
error => Hijk::Error::REQUEST_SELECT_ERROR,
error_message => "select() error on constructing the socket",
errno_number => $!+0,
errno_string => "$!",
},
);
}
}
if ($! = unpack("L", getsockopt($soc, SOL_SOCKET, SO_ERROR))) {
die $!;
}
return $soc;
}
sub _build_http_message {
my $args = $_[0];
my $path_and_qs = ($args->{path} || "/") . ( defined($args->{query_string}) ? ("?".$args->{query_string}) : "" );
return join(
$CRLF,
($args->{method} || "GET")." $path_and_qs " . ($args->{protocol} || "HTTP/1.1"),
"Host: $args->{host}",
$args->{body} ? ("Content-Length: " . length($args->{body})) : (),
$args->{head} ? (
map {
$args->{head}[2*$_] . ": " . $args->{head}[2*$_+1]
} 0..$#{$args->{head}}/2
) : (),
"",
$args->{body} ? $args->{body} : ()
) . $CRLF;
}
our $SOCKET_CACHE = {};
sub request {
my $args = $_[0];
# Backwards compatibility for code that provided the old timeout
# argument.
$args->{connect_timeout} = $args->{read_timeout} = $args->{timeout} if exists $args->{timeout};
# Ditto for providing a default socket cache, allow for setting it
# to "socket_cache => undef" to disable the cache.
$args->{socket_cache} = $SOCKET_CACHE unless exists $args->{socket_cache};
# Provide a default for the read_length option
$args->{read_length} = 10 * 2 ** 10 unless exists $args->{read_length};
# Use $; so we can use the $socket_cache->{$$, $host, $port}
# idiom to access the cache.
my $cache_key; $cache_key = join($;, $$, @$args{qw(host port)}) if defined $args->{socket_cache};
my $soc;
if (defined $cache_key and exists $args->{socket_cache}->{$cache_key}) {
$soc = $args->{socket_cache}->{$cache_key};
} else {
($soc, my $error) = _construct_socket(@$args{qw(host port connect_timeout)});
return $error if $error;
$args->{socket_cache}->{$cache_key} = $soc if defined $cache_key;
$args->{on_connect}->() if exists $args->{on_connect};
}
my $r = _build_http_message($args);
my $total = length($r);
my $left = $total;
vec(my $rout = '', fileno($soc), 1) = 1;
while ($left > 0) {
if (select(undef, $rout, undef, undef) != 1) {
delete $args->{socket_cache}->{$cache_key} if defined $cache_key;
return {
error => Hijk::Error::REQUEST_SELECT_ERROR,
error_message => "Got error on select() before the write() when while writing the HTTP request the socket",
errno_number => $!+0,
errno_string => "$!",
};
}
my $rc = syswrite($soc,$r,$left, $total - $left);
if (!defined($rc)) {
next if ($! == EWOULDBLOCK || $! == EAGAIN);
delete $args->{socket_cache}->{$cache_key} if defined $cache_key;
shutdown($soc, 2);
return {
error => Hijk::Error::REQUEST_WRITE_ERROR,
error_message => "Got error trying to write the HTTP request with write() to the socket",
errno_number => $!+0,
errno_string => "$!",
};
}
$left -= $rc;
}
my ($proto,$close_connection,$status,$head,$body,$error,$error_message,$errno_number,$errno_string);
eval {
($close_connection,$proto,$status,$head,$body,$error,$error_message,$errno_number,$errno_string) =
_read_http_message(fileno($soc), @$args{qw(read_length read_timeout parse_chunked head_as_array method)});
1;
} or do {
my $err = $@ || "zombie error";
delete $args->{socket_cache}->{$cache_key} if defined $cache_key;
shutdown($soc, 2);
die $err;
};
if ($status == 0
# We always close connections for 1.0 because some servers LIE
# and say that they're 1.0 but don't close the connection on
# us! An example of this. Test::HTTP::Server (used by the
# ShardedKV::Storage::Rest tests) is an example of such a
# server. In either case we can't cache a connection for a 1.0
# server anyway, so BEGONE!
or $close_connection
or (defined $proto and $proto eq 'HTTP/1.0')) {
delete $args->{socket_cache}->{$cache_key} if defined $cache_key;
shutdown($soc, 2);
}
return {
proto => $proto,
status => $status,
head => $head,
body => $body,
defined($error) ? ( error => $error ) : (),
defined($error_message) ? ( error_message => $error_message ) : (),
defined($errno_number) ? ( errno_number => $errno_number ) : (),
defined($errno_string) ? ( errno_string => $errno_string ) : (),
};
}
1;
__END__
=encoding utf8
=head1 NAME
Hijk - Fast & minimal low-level HTTP client
=head1 SYNOPSIS
A simple GET request:
use Hijk ();
my $res = Hijk::request({
method => "GET",
host => "example.com",
port => "80",
path => "/flower",
query_string => "color=red"
});
if (exists $res->{error} and $res->{error} & Hijk::Error::TIMEOUT) {
die "Oh noes we had some sort of timeout";
}
die "Expecting a successful response" unless $res->{status} == 200;
say $res->{body};
A POST request, you have to manually set the appropriate headers, URI
escape your values etc.
use Hijk ();
use URI::Escape qw(uri_escape);
my $res = Hijk::request({
method => "POST",
host => "example.com",
port => "80",
path => "/new",
head => [ "Content-Type" => "application/x-www-form-urlencoded" ],
query_string => "type=flower&bucket=the%20one%20out%20back",
body => "description=" . uri_escape("Another flower, let's hope it's exciting"),
});
die "Expecting a successful response" unless $res->{status} == 200;
=head1 DESCRIPTION
Hijk is a fast & minimal low-level HTTP client intended to be used
where you control both the client and the server, e.g. for talking to
some internal service from a frontend user-facing web application.
It is C<NOT> a general HTTP user agent, it doesn't support redirects,
proxies, SSL and any number of other advanced HTTP features like (in
roughly descending order of feature completeness) L<LWP::UserAgent>,
L<WWW::Curl>, L<HTTP::Tiny>, L<HTTP::Lite> or L<Furl>. This library is
basically one step above manually talking HTTP over sockets.
Having said that it's lightning fast and extensively used in
production at L<Booking.com|https://www.booking.com> where it's used
as the go-to transport layer for talking to internal services. It uses
non-blocking sockets and correctly handles all combinations of
connect/read timeouts and other issues you might encounter from
various combinations of parts of your system going down or becoming
otherwise unavailable.
=head1 FUNCTION: Hijk::request( $args :HashRef ) :HashRef
C<Hijk::request> is the only function you should use. It (or anything
else in this package for that matter) is not exported, so you have to
use the fully qualified name.
It takes a C<HashRef> of arguments and either dies or returns a
C<HashRef> as a response.
The C<HashRef> argument to it must contain some of the key-value pairs
from the following list. The value for C<host> and C<port> are
mandatory, but others are optional with default values listed below.
protocol => "HTTP/1.1", # (or "HTTP/1.0")
host => ...,
port => ...,
connect_timeout => undef,
read_timeout => undef,
read_length => 10240,
method => "GET",
path => "/",
query_string => "",
head => [],
body => "",
socket_cache => \%Hijk::SOCKET_CACHE, # (undef to disable, or \my %your_socket_cache)
on_connect => undef, # (or sub { ... })
parse_chunked => 0,
head_as_array => 0,
Notice how Hijk does not take a full URI string as input, you have to
specify the individual parts of the URL. Users who need to parse an
existing URI string to produce a request should use the L<URI> module
to do so.
The value of C<head> is an C<ArrayRef> of key-value pairs instead of a
C<HashRef>, this way you can decide in which order the headers are
sent, and you can send the same header name multiple times. For
example:
head => [
"Content-Type" => "application/json",
"X-Requested-With" => "Hijk",
]
Will produce these request headers:
Content-Type: application/json
X-Requested-With: Hijk
Hijk doesn't escape any values for you, it just passes them through
as-is. You can easily produce invalid requests if e.g. any of these
strings contain a newline, or aren't otherwise properly escaped.
The value of C<connect_timeout> or C<read_timeout> is in floating
point seconds, and is used as the time limit for connecting to the
host, and reading the response back from it, respectively. The default
value for both is C<undef>, meaning no timeout limit. If you don't
supply these timeouts and the host really is unreachable or slow,
we'll reach the TCP timeout limit before returning some other error to
you.
The default C<protocol> is C<HTTP/1.1>, but you can also specify
C<HTTP/1.0>. The advantage of using C<HTTP/1.1> is support for
keep-alive, which matters a lot in environments where the connection
setup represents non-trivial overhead. Sometimes that overhead is
negligible (e.g. on Linux talking to an nginx on the local network),
and keeping open connections down and reducing complexity is more
important, in those cases you can either use C<HTTP/1.0>, or specify
C<Connection: close> in the request, but just using C<HTTP/1.0> is an
easy way to accomplish the same thing.
By default we will provide a C<socket_cache> for you which is a global
singleton that we maintain keyed on C<join($;, $$, $host, $port)>.
Alternatively you can pass in C<socket_cache> hash of your own which
we'll use as the cache. To completely disable the cache pass in
C<undef>.
The optional C<on_connect> callback is intended to be used for you to
figure out from production traffic what you should set the
C<connect_timeout>. I.e. you can start a timer when you call
C<Hijk::request()> that you end when C<on_connect> is called, that's
how long it took us to get a connection. If you start another timer in
that callback that you end when C<Hijk::request()> returns to you
that'll give you how long it took to send/receive data after we
constructed the socket, i.e. it'll help you to tweak your
C<read_timeout>. The C<on_connect> callback is provided with no
arguments, and is called in void context.
We have experimental support for parsing chunked responses
encoding. historically Hijk didn't support this at all and if you
wanted to use it with e.g. nginx you had to add
C<chunked_transfer_encoding off> to the nginx config file.
Since you may just want to do that instead of having Hijk do more work
to parse this out with a more complex and experimental codepath you
have to explicitly enable it with C<parse_chunked>. Otherwise Hijk
will die when it encounters chunked responses. The C<parse_chunked>
option may be turned on by default in the future.
The return value is a C<HashRef> representing a response. It contains
the following key-value pairs.
proto => :Str
status => :StatusCode
body => :Str
head => :HashRef (or :ArrayRef with "head_as_array")
error => :PositiveInt
error_message => :Str
errno_number => :Int
errno_string => :Str
For example, to send request to
C<http://example.com/flower?color=red>, do the following:
my $res = Hijk::request({
host => "example.com",
port => "80",
path => "/flower",
query_string => "color=red"
});
die "Response is not OK" unless $res->{status} == 200;
Notice that you do not need to put the leading C<"?"> character in the
C<query_string>. You do, however, need to properly C<uri_escape> the content of
C<query_string>.
Again, Hijk doesn't escape any values for you, so these values B<MUST>
be properly escaped before being passed in, unless you want to issue
invalid requests.
By default the C<head> in the response is a C<HashRef> rather then an
C<ArrayRef>. This makes it easier to retrieve specific header fields,
but it means that we'll clobber any duplicated header names with the
most recently seen header value. To get the returned headers as an
C<ArrayRef> instead specify C<head_as_array>.
If you want to fiddle with the C<read_length> value it controls how
much we C<POSIX::read($fd, $buf, $read_length)> at a time.
We currently don't support servers returning a http body without an accompanying
C<Content-Length> header; bodies B<MUST> have a C<Content-Length> or we won't pick
them up.
=head1 ERROR CODES
If we had a recoverable error we'll include an "error" key whose value
is a bitfield that you can check against Hijk::Error::*
constants. Those are:
Hijk::Error::CONNECT_TIMEOUT
Hijk::Error::READ_TIMEOUT
Hijk::Error::TIMEOUT
Hijk::Error::CANNOT_RESOLVE
Hijk::Error::REQUEST_SELECT_ERROR
Hijk::Error::REQUEST_WRITE_ERROR
Hijk::Error::REQUEST_ERROR
Hijk::Error::RESPONSE_READ_ERROR
Hijk::Error::RESPONSE_BAD_READ_VALUE
Hijk::Error::RESPONSE_ERROR
In addition we might return C<error_message>, C<errno_number> and
C<errno_string> keys, see the discussion of C<Hijk::Error::REQUEST_*>
and C<Hijk::Error::RESPONSE_*> errors below.
The C<Hijk::Error::TIMEOUT> constant is the same as
C<Hijk::Error::CONNECT_TIMEOUT | Hijk::Error::READ_TIMEOUT>. It's
there for convenience so you can do:
.. if exists $res->{error} and $res->{error} & Hijk::Error::TIMEOUT;
Instead of the more verbose:
.. if exists $res->{error} and $res->{error} & (Hijk::Error::CONNECT_TIMEOUT | Hijk::Error::READ_TIMEOUT)
We'll return C<Hijk::Error::CANNOT_RESOLVE> if we can't
C<gethostbyname()> the host you've provided.
If we fail to do a C<select()> or C<write()> during when sending the
response we'll return C<Hijk::Error::REQUEST_SELECT_ERROR> or
C<Hijk::Error::REQUEST_WRITE_ERROR>, respectively. Similarly to
C<Hijk::Error::TIMEOUT> the C<Hijk::Error::REQUEST_ERROR> constant is
a union of these two, and any other request errors we might add in the
future.
When we're getting the response back we'll return
C<Hijk::Error::RESPONSE_READ_ERROR> when we can't C<read()> the
response, and C<Hijk::Error::RESPONSE_BAD_READ_VALUE> when the value
we got from C<read()> is C<0>. The C<Hijk::Error::RESPONSE_ERROR>
constant is a union of these two and any other response errors we
might add in the future.
Some of these C<Hijk::Error::REQUEST_*> and C<Hijk::Error::RESPONSE_*>
errors are re-thrown errors from system calls. In that case we'll also
pass along C<error_message> which is a short human readable error
message about the error, as well as C<errno_number> & C<errno_string>,
which are C<$!+0> and C<"$!"> at the time we had the error.
Hijk might encounter other errors during the course of the request and
C<WILL> call C<die> if that happens, so if you don't want your program
to stop when a request like that fails wrap it in C<eval>.
Having said that the point of the C<Hijk::Error::*> interface is that
all errors that happen during normal operation, i.e. making valid
requests against servers where you can have issues like timeouts,
network blips or the server thread on the other end being suddenly
kill -9'd should be caught, categorized and returned in a structural
way by Hijk.
We're not currently aware of any issues that occur in such normal
operations that aren't classified as a C<Hijk::Error::*>, and if we
find new issues that fit the criteria above we'll likely just make a
new C<Hijk::Error::*> for it.
We're just not trying to guarantee that the library can never C<die>,
and aren't trying to catch truly exceptional issues like
e.g. C<fcntl()> failing on a valid socket.
=head1 AUTHORS
=over 4
=item Kang-min Liu <gugod@gugod.org>
=item Ævar Arnfjörð Bjarmason <avar@cpan.org>
=item Borislav Nikolov <jack@sofialondonmoskva.com>
=item Damian Gryski <damian@gryski.com>
=back
=head1 COPYRIGHT
Copyright (c) 2013 Kang-min Liu C<< <gugod@gugod.org> >>.
=head1 LICENCE
The MIT License
=head1 DISCLAIMER OF WARRANTY
BECAUSE THIS SOFTWARE IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY
FOR THE SOFTWARE, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN
OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES
PROVIDE THE SOFTWARE "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER
EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED
WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE
ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE SOFTWARE IS WITH
YOU. SHOULD THE SOFTWARE PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL
NECESSARY SERVICING, REPAIR, OR CORRECTION.
IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR
REDISTRIBUTE THE SOFTWARE AS PERMITTED BY THE ABOVE LICENCE, BE
LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL,
OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE
THE SOFTWARE (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING
RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A
FAILURE OF THE SOFTWARE TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF
SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF
SUCH DAMAGES.
=cut
| 40.094767 | 147 | 0.603803 |
ed27cedd3e2ff382b7cc9c3c0daca816769287d0 | 61,282 | pm | Perl | old/cygwin-per5.14/lib/ExtUtils/MM_VMS.pm | rwhitworth/precompiled-perl-mods | bbcfaa3e1663eaac8d770548ca275c50c5eead97 | [
"Artistic-2.0"
]
| null | null | null | old/cygwin-per5.14/lib/ExtUtils/MM_VMS.pm | rwhitworth/precompiled-perl-mods | bbcfaa3e1663eaac8d770548ca275c50c5eead97 | [
"Artistic-2.0"
]
| null | null | null | old/cygwin-per5.14/lib/ExtUtils/MM_VMS.pm | rwhitworth/precompiled-perl-mods | bbcfaa3e1663eaac8d770548ca275c50c5eead97 | [
"Artistic-2.0"
]
| null | null | null | package ExtUtils::MM_VMS;
use strict;
use ExtUtils::MakeMaker::Config;
require Exporter;
BEGIN {
# so we can compile the thing on non-VMS platforms.
if( $^O eq 'VMS' ) {
require VMS::Filespec;
VMS::Filespec->import;
}
}
use File::Basename;
our $VERSION = '7.04';
require ExtUtils::MM_Any;
require ExtUtils::MM_Unix;
our @ISA = qw( ExtUtils::MM_Any ExtUtils::MM_Unix );
use ExtUtils::MakeMaker qw($Verbose neatvalue);
our $Revision = $ExtUtils::MakeMaker::Revision;
=head1 NAME
ExtUtils::MM_VMS - methods to override UN*X behaviour in ExtUtils::MakeMaker
=head1 SYNOPSIS
Do not use this directly.
Instead, use ExtUtils::MM and it will figure out which MM_*
class to use for you.
=head1 DESCRIPTION
See ExtUtils::MM_Unix for a documentation of the methods provided
there. This package overrides the implementation of these methods, not
the semantics.
=head2 Methods always loaded
=over 4
=item wraplist
Converts a list into a string wrapped at approximately 80 columns.
=cut
sub wraplist {
my($self) = shift;
my($line,$hlen) = ('',0);
foreach my $word (@_) {
# Perl bug -- seems to occasionally insert extra elements when
# traversing array (scalar(@array) doesn't show them, but
# foreach(@array) does) (5.00307)
next unless $word =~ /\w/;
$line .= ' ' if length($line);
if ($hlen > 80) { $line .= "\\\n\t"; $hlen = 0; }
$line .= $word;
$hlen += length($word) + 2;
}
$line;
}
# This isn't really an override. It's just here because ExtUtils::MM_VMS
# appears in @MM::ISA before ExtUtils::Liblist::Kid, so if there isn't an ext()
# in MM_VMS, then AUTOLOAD is called, and bad things happen. So, we just
# mimic inheritance here and hand off to ExtUtils::Liblist::Kid.
# XXX This hackery will die soon. --Schwern
sub ext {
require ExtUtils::Liblist::Kid;
goto &ExtUtils::Liblist::Kid::ext;
}
=back
=head2 Methods
Those methods which override default MM_Unix methods are marked
"(override)", while methods unique to MM_VMS are marked "(specific)".
For overridden methods, documentation is limited to an explanation
of why this method overrides the MM_Unix method; see the ExtUtils::MM_Unix
documentation for more details.
=over 4
=item guess_name (override)
Try to determine name of extension being built. We begin with the name
of the current directory. Since VMS filenames are case-insensitive,
however, we look for a F<.pm> file whose name matches that of the current
directory (presumably the 'main' F<.pm> file for this extension), and try
to find a C<package> statement from which to obtain the Mixed::Case
package name.
=cut
sub guess_name {
my($self) = @_;
my($defname,$defpm,@pm,%xs);
local *PM;
$defname = basename(fileify($ENV{'DEFAULT'}));
$defname =~ s![\d\-_]*\.dir.*$!!; # Clip off .dir;1 suffix, and package version
$defpm = $defname;
# Fallback in case for some reason a user has copied the files for an
# extension into a working directory whose name doesn't reflect the
# extension's name. We'll use the name of a unique .pm file, or the
# first .pm file with a matching .xs file.
if (not -e "${defpm}.pm") {
@pm = glob('*.pm');
s/.pm$// for @pm;
if (@pm == 1) { ($defpm = $pm[0]) =~ s/.pm$//; }
elsif (@pm) {
%xs = map { s/.xs$//; ($_,1) } glob('*.xs'); ## no critic
if (keys %xs) {
foreach my $pm (@pm) {
$defpm = $pm, last if exists $xs{$pm};
}
}
}
}
if (open(my $pm, '<', "${defpm}.pm")){
while (<$pm>) {
if (/^\s*package\s+([^;]+)/i) {
$defname = $1;
last;
}
}
print "Warning (non-fatal): Couldn't find package name in ${defpm}.pm;\n\t",
"defaulting package name to $defname\n"
if eof($pm);
close $pm;
}
else {
print "Warning (non-fatal): Couldn't find ${defpm}.pm;\n\t",
"defaulting package name to $defname\n";
}
$defname =~ s#[\d.\-_]+$##;
$defname;
}
=item find_perl (override)
Use VMS file specification syntax and CLI commands to find and
invoke Perl images.
=cut
sub find_perl {
my($self, $ver, $names, $dirs, $trace) = @_;
my($vmsfile,@sdirs,@snames,@cand);
my($rslt);
my($inabs) = 0;
local *TCF;
if( $self->{PERL_CORE} ) {
# Check in relative directories first, so we pick up the current
# version of Perl if we're running MakeMaker as part of the main build.
@sdirs = sort { my($absa) = $self->file_name_is_absolute($a);
my($absb) = $self->file_name_is_absolute($b);
if ($absa && $absb) { return $a cmp $b }
else { return $absa ? 1 : ($absb ? -1 : ($a cmp $b)); }
} @$dirs;
# Check miniperl before perl, and check names likely to contain
# version numbers before "generic" names, so we pick up an
# executable that's less likely to be from an old installation.
@snames = sort { my($ba) = $a =~ m!([^:>\]/]+)$!; # basename
my($bb) = $b =~ m!([^:>\]/]+)$!;
my($ahasdir) = (length($a) - length($ba) > 0);
my($bhasdir) = (length($b) - length($bb) > 0);
if ($ahasdir and not $bhasdir) { return 1; }
elsif ($bhasdir and not $ahasdir) { return -1; }
else { $bb =~ /\d/ <=> $ba =~ /\d/
or substr($ba,0,1) cmp substr($bb,0,1)
or length($bb) <=> length($ba) } } @$names;
}
else {
@sdirs = @$dirs;
@snames = @$names;
}
# Image names containing Perl version use '_' instead of '.' under VMS
s/\.(\d+)$/_$1/ for @snames;
if ($trace >= 2){
print "Looking for perl $ver by these names:\n";
print "\t@snames,\n";
print "in these dirs:\n";
print "\t@sdirs\n";
}
foreach my $dir (@sdirs){
next unless defined $dir; # $self->{PERL_SRC} may be undefined
$inabs++ if $self->file_name_is_absolute($dir);
if ($inabs == 1) {
# We've covered relative dirs; everything else is an absolute
# dir (probably an installed location). First, we'll try
# potential command names, to see whether we can avoid a long
# MCR expression.
foreach my $name (@snames) {
push(@cand,$name) if $name =~ /^[\w\-\$]+$/;
}
$inabs++; # Should happen above in next $dir, but just in case...
}
foreach my $name (@snames){
push @cand, ($name !~ m![/:>\]]!) ? $self->catfile($dir,$name)
: $self->fixpath($name,0);
}
}
foreach my $name (@cand) {
print "Checking $name\n" if $trace >= 2;
# If it looks like a potential command, try it without the MCR
if ($name =~ /^[\w\-\$]+$/) {
open(my $tcf, ">", "temp_mmvms.com")
or die('unable to open temp file');
print $tcf "\$ set message/nofacil/nosever/noident/notext\n";
print $tcf "\$ $name -e \"require $ver; print \"\"VER_OK\\n\"\"\"\n";
close $tcf;
$rslt = `\@temp_mmvms.com` ;
unlink('temp_mmvms.com');
if ($rslt =~ /VER_OK/) {
print "Using PERL=$name\n" if $trace;
return $name;
}
}
next unless $vmsfile = $self->maybe_command($name);
$vmsfile =~ s/;[\d\-]*$//; # Clip off version number; we can use a newer version as well
print "Executing $vmsfile\n" if ($trace >= 2);
open(my $tcf, '>', "temp_mmvms.com")
or die('unable to open temp file');
print $tcf "\$ set message/nofacil/nosever/noident/notext\n";
print $tcf "\$ mcr $vmsfile -e \"require $ver; print \"\"VER_OK\\n\"\"\" \n";
close $tcf;
$rslt = `\@temp_mmvms.com`;
unlink('temp_mmvms.com');
if ($rslt =~ /VER_OK/) {
print "Using PERL=MCR $vmsfile\n" if $trace;
return "MCR $vmsfile";
}
}
print "Unable to find a perl $ver (by these names: @$names, in these dirs: @$dirs)\n";
0; # false and not empty
}
=item _fixin_replace_shebang (override)
Helper routine for MM->fixin(), overridden because there's no such thing as an
actual shebang line that will be interpreted by the shell, so we just prepend
$Config{startperl} and preserve the shebang line argument for any switches it
may contain.
=cut
sub _fixin_replace_shebang {
my ( $self, $file, $line ) = @_;
my ( undef, $arg ) = split ' ', $line, 2;
return $Config{startperl} . "\n" . $Config{sharpbang} . "perl $arg\n";
}
=item maybe_command (override)
Follows VMS naming conventions for executable files.
If the name passed in doesn't exactly match an executable file,
appends F<.Exe> (or equivalent) to check for executable image, and F<.Com>
to check for DCL procedure. If this fails, checks directories in DCL$PATH
and finally F<Sys$System:> for an executable file having the name specified,
with or without the F<.Exe>-equivalent suffix.
=cut
sub maybe_command {
my($self,$file) = @_;
return $file if -x $file && ! -d _;
my(@dirs) = ('');
my(@exts) = ('',$Config{'exe_ext'},'.exe','.com');
if ($file !~ m![/:>\]]!) {
for (my $i = 0; defined $ENV{"DCL\$PATH;$i"}; $i++) {
my $dir = $ENV{"DCL\$PATH;$i"};
$dir .= ':' unless $dir =~ m%[\]:]$%;
push(@dirs,$dir);
}
push(@dirs,'Sys$System:');
foreach my $dir (@dirs) {
my $sysfile = "$dir$file";
foreach my $ext (@exts) {
return $file if -x "$sysfile$ext" && ! -d _;
}
}
}
return 0;
}
=item pasthru (override)
VMS has $(MMSQUALIFIERS) which is a listing of all the original command line
options. This is used in every invocation of make in the VMS Makefile so
PASTHRU should not be necessary. Using PASTHRU tends to blow commands past
the 256 character limit.
=cut
sub pasthru {
return "PASTHRU=\n";
}
=item pm_to_blib (override)
VMS wants a dot in every file so we can't have one called 'pm_to_blib',
it becomes 'pm_to_blib.' and MMS/K isn't smart enough to know that when
you have a target called 'pm_to_blib' it should look for 'pm_to_blib.'.
So in VMS its pm_to_blib.ts.
=cut
sub pm_to_blib {
my $self = shift;
my $make = $self->SUPER::pm_to_blib;
$make =~ s{^pm_to_blib :}{pm_to_blib.ts :}m;
$make =~ s{\$\(TOUCH\) pm_to_blib}{\$(TOUCH) pm_to_blib.ts};
$make = <<'MAKE' . $make;
# Dummy target to match Unix target name; we use pm_to_blib.ts as
# timestamp file to avoid repeated invocations under VMS
pm_to_blib : pm_to_blib.ts
$(NOECHO) $(NOOP)
MAKE
return $make;
}
=item perl_script (override)
If name passed in doesn't specify a readable file, appends F<.com> or
F<.pl> and tries again, since it's customary to have file types on all files
under VMS.
=cut
sub perl_script {
my($self,$file) = @_;
return $file if -r $file && ! -d _;
return "$file.com" if -r "$file.com";
return "$file.pl" if -r "$file.pl";
return '';
}
=item replace_manpage_separator
Use as separator a character which is legal in a VMS-syntax file name.
=cut
sub replace_manpage_separator {
my($self,$man) = @_;
$man = unixify($man);
$man =~ s#/+#__#g;
$man;
}
=item init_DEST
(override) Because of the difficulty concatenating VMS filepaths we
must pre-expand the DEST* variables.
=cut
sub init_DEST {
my $self = shift;
$self->SUPER::init_DEST;
# Expand DEST variables.
foreach my $var ($self->installvars) {
my $destvar = 'DESTINSTALL'.$var;
$self->{$destvar} = $self->eliminate_macros($self->{$destvar});
}
}
=item init_DIRFILESEP
No separator between a directory path and a filename on VMS.
=cut
sub init_DIRFILESEP {
my($self) = shift;
$self->{DIRFILESEP} = '';
return 1;
}
=item init_main (override)
=cut
sub init_main {
my($self) = shift;
$self->SUPER::init_main;
$self->{DEFINE} ||= '';
if ($self->{DEFINE} ne '') {
my(@terms) = split(/\s+/,$self->{DEFINE});
my(@defs,@udefs);
foreach my $def (@terms) {
next unless $def;
my $targ = \@defs;
if ($def =~ s/^-([DU])//) { # If it was a Unix-style definition
$targ = \@udefs if $1 eq 'U';
$def =~ s/='(.*)'$/=$1/; # then remove shell-protection ''
$def =~ s/^'(.*)'$/$1/; # from entire term or argument
}
if ($def =~ /=/) {
$def =~ s/"/""/g; # Protect existing " from DCL
$def = qq["$def"]; # and quote to prevent parsing of =
}
push @$targ, $def;
}
$self->{DEFINE} = '';
if (@defs) {
$self->{DEFINE} = '/Define=(' . join(',',@defs) . ')';
}
if (@udefs) {
$self->{DEFINE} .= '/Undef=(' . join(',',@udefs) . ')';
}
}
}
=item init_tools (override)
Provide VMS-specific forms of various utility commands.
Sets DEV_NULL to nothing because I don't know how to do it on VMS.
Changes EQUALIZE_TIMESTAMP to set revision date of target file to
one second later than source file, since MMK interprets precisely
equal revision dates for a source and target file as a sign that the
target needs to be updated.
=cut
sub init_tools {
my($self) = @_;
$self->{NOOP} = 'Continue';
$self->{NOECHO} ||= '@ ';
$self->{MAKEFILE} ||= $self->{FIRST_MAKEFILE} || 'Descrip.MMS';
$self->{FIRST_MAKEFILE} ||= $self->{MAKEFILE};
$self->{MAKE_APERL_FILE} ||= 'Makeaperl.MMS';
$self->{MAKEFILE_OLD} ||= $self->eliminate_macros('$(FIRST_MAKEFILE)_old');
#
# If an extension is not specified, then MMS/MMK assumes an
# an extension of .MMS. If there really is no extension,
# then a trailing "." needs to be appended to specify a
# a null extension.
#
$self->{MAKEFILE} .= '.' unless $self->{MAKEFILE} =~ m/\./;
$self->{FIRST_MAKEFILE} .= '.' unless $self->{FIRST_MAKEFILE} =~ m/\./;
$self->{MAKE_APERL_FILE} .= '.' unless $self->{MAKE_APERL_FILE} =~ m/\./;
$self->{MAKEFILE_OLD} .= '.' unless $self->{MAKEFILE_OLD} =~ m/\./;
$self->{MACROSTART} ||= '/Macro=(';
$self->{MACROEND} ||= ')';
$self->{USEMAKEFILE} ||= '/Descrip=';
$self->{EQUALIZE_TIMESTAMP} ||= '$(ABSPERLRUN) -we "open F,qq{>>$ARGV[1]};close F;utime(0,(stat($ARGV[0]))[9]+1,$ARGV[1])"';
$self->{MOD_INSTALL} ||=
$self->oneliner(<<'CODE', ['-MExtUtils::Install']);
install([ from_to => {split('\|', <STDIN>)}, verbose => '$(VERBINST)', uninstall_shadows => '$(UNINST)', dir_mode => '$(PERM_DIR)' ]);
CODE
$self->{UMASK_NULL} = '! ';
$self->SUPER::init_tools;
# Use the default shell
$self->{SHELL} ||= 'Posix';
# Redirection on VMS goes before the command, not after as on Unix.
# $(DEV_NULL) is used once and its not worth going nuts over making
# it work. However, Unix's DEV_NULL is quite wrong for VMS.
$self->{DEV_NULL} = '';
return;
}
=item init_platform (override)
Add PERL_VMS, MM_VMS_REVISION and MM_VMS_VERSION.
MM_VMS_REVISION is for backwards compatibility before MM_VMS had a
$VERSION.
=cut
sub init_platform {
my($self) = shift;
$self->{MM_VMS_REVISION} = $Revision;
$self->{MM_VMS_VERSION} = $VERSION;
$self->{PERL_VMS} = $self->catdir($self->{PERL_SRC}, 'VMS')
if $self->{PERL_SRC};
}
=item platform_constants
=cut
sub platform_constants {
my($self) = shift;
my $make_frag = '';
foreach my $macro (qw(PERL_VMS MM_VMS_REVISION MM_VMS_VERSION))
{
next unless defined $self->{$macro};
$make_frag .= "$macro = $self->{$macro}\n";
}
return $make_frag;
}
=item init_VERSION (override)
Override the *DEFINE_VERSION macros with VMS semantics. Translate the
MAKEMAKER filepath to VMS style.
=cut
sub init_VERSION {
my $self = shift;
$self->SUPER::init_VERSION;
$self->{DEFINE_VERSION} = '"$(VERSION_MACRO)=""$(VERSION)"""';
$self->{XS_DEFINE_VERSION} = '"$(XS_VERSION_MACRO)=""$(XS_VERSION)"""';
$self->{MAKEMAKER} = vmsify($INC{'ExtUtils/MakeMaker.pm'});
}
=item constants (override)
Fixes up numerous file and directory macros to insure VMS syntax
regardless of input syntax. Also makes lists of files
comma-separated.
=cut
sub constants {
my($self) = @_;
# Be kind about case for pollution
for (@ARGV) { $_ = uc($_) if /POLLUTE/i; }
# Cleanup paths for directories in MMS macros.
foreach my $macro ( qw [
INST_BIN INST_SCRIPT INST_LIB INST_ARCHLIB
PERL_LIB PERL_ARCHLIB
PERL_INC PERL_SRC ],
(map { 'INSTALL'.$_ } $self->installvars)
)
{
next unless defined $self->{$macro};
next if $macro =~ /MAN/ && $self->{$macro} eq 'none';
$self->{$macro} = $self->fixpath($self->{$macro},1);
}
# Cleanup paths for files in MMS macros.
foreach my $macro ( qw[LIBPERL_A FIRST_MAKEFILE MAKEFILE_OLD
MAKE_APERL_FILE MYEXTLIB] )
{
next unless defined $self->{$macro};
$self->{$macro} = $self->fixpath($self->{$macro},0);
}
# Fixup files for MMS macros
# XXX is this list complete?
for my $macro (qw/
FULLEXT VERSION_FROM
/ ) {
next unless defined $self->{$macro};
$self->{$macro} = $self->fixpath($self->{$macro},0);
}
for my $macro (qw/
OBJECT LDFROM
/ ) {
next unless defined $self->{$macro};
# Must expand macros before splitting on unescaped whitespace.
$self->{$macro} = $self->eliminate_macros($self->{$macro});
if ($self->{$macro} =~ /(?<!\^)\s/) {
$self->{$macro} =~ s/(\\)?\n+\s+/ /g;
$self->{$macro} = $self->wraplist(
map $self->fixpath($_,0), split /,?(?<!\^)\s+/, $self->{$macro}
);
}
else {
$self->{$macro} = $self->fixpath($self->{$macro},0);
}
}
for my $macro (qw/ XS MAN1PODS MAN3PODS PM /) {
# Where is the space coming from? --jhi
next unless $self ne " " && defined $self->{$macro};
my %tmp = ();
for my $key (keys %{$self->{$macro}}) {
$tmp{$self->fixpath($key,0)} =
$self->fixpath($self->{$macro}{$key},0);
}
$self->{$macro} = \%tmp;
}
for my $macro (qw/ C O_FILES H /) {
next unless defined $self->{$macro};
my @tmp = ();
for my $val (@{$self->{$macro}}) {
push(@tmp,$self->fixpath($val,0));
}
$self->{$macro} = \@tmp;
}
# mms/k does not define a $(MAKE) macro.
$self->{MAKE} = '$(MMS)$(MMSQUALIFIERS)';
return $self->SUPER::constants;
}
=item special_targets
Clear the default .SUFFIXES and put in our own list.
=cut
sub special_targets {
my $self = shift;
my $make_frag .= <<'MAKE_FRAG';
.SUFFIXES :
.SUFFIXES : $(OBJ_EXT) .c .cpp .cxx .xs
MAKE_FRAG
return $make_frag;
}
=item cflags (override)
Bypass shell script and produce qualifiers for CC directly (but warn
user if a shell script for this extension exists). Fold multiple
/Defines into one, since some C compilers pay attention to only one
instance of this qualifier on the command line.
=cut
sub cflags {
my($self,$libperl) = @_;
my($quals) = $self->{CCFLAGS} || $Config{'ccflags'};
my($definestr,$undefstr,$flagoptstr) = ('','','');
my($incstr) = '/Include=($(PERL_INC)';
my($name,$sys,@m);
( $name = $self->{NAME} . "_cflags" ) =~ s/:/_/g ;
print "Unix shell script ".$Config{"$self->{'BASEEXT'}_cflags"}.
" required to modify CC command for $self->{'BASEEXT'}\n"
if ($Config{$name});
if ($quals =~ / -[DIUOg]/) {
while ($quals =~ / -([Og])(\d*)\b/) {
my($type,$lvl) = ($1,$2);
$quals =~ s/ -$type$lvl\b\s*//;
if ($type eq 'g') { $flagoptstr = '/NoOptimize'; }
else { $flagoptstr = '/Optimize' . (defined($lvl) ? "=$lvl" : ''); }
}
while ($quals =~ / -([DIU])(\S+)/) {
my($type,$def) = ($1,$2);
$quals =~ s/ -$type$def\s*//;
$def =~ s/"/""/g;
if ($type eq 'D') { $definestr .= qq["$def",]; }
elsif ($type eq 'I') { $incstr .= ',' . $self->fixpath($def,1); }
else { $undefstr .= qq["$def",]; }
}
}
if (length $quals and $quals !~ m!/!) {
warn "MM_VMS: Ignoring unrecognized CCFLAGS elements \"$quals\"\n";
$quals = '';
}
$definestr .= q["PERL_POLLUTE",] if $self->{POLLUTE};
if (length $definestr) { chop($definestr); $quals .= "/Define=($definestr)"; }
if (length $undefstr) { chop($undefstr); $quals .= "/Undef=($undefstr)"; }
# Deal with $self->{DEFINE} here since some C compilers pay attention
# to only one /Define clause on command line, so we have to
# conflate the ones from $Config{'ccflags'} and $self->{DEFINE}
# ($self->{DEFINE} has already been VMSified in constants() above)
if ($self->{DEFINE}) { $quals .= $self->{DEFINE}; }
for my $type (qw(Def Undef)) {
my(@terms);
while ($quals =~ m:/${type}i?n?e?=([^/]+):ig) {
my $term = $1;
$term =~ s:^\((.+)\)$:$1:;
push @terms, $term;
}
if ($type eq 'Def') {
push @terms, qw[ $(DEFINE_VERSION) $(XS_DEFINE_VERSION) ];
}
if (@terms) {
$quals =~ s:/${type}i?n?e?=[^/]+::ig;
$quals .= "/${type}ine=(" . join(',',@terms) . ')';
}
}
$libperl or $libperl = $self->{LIBPERL_A} || "libperl.olb";
# Likewise with $self->{INC} and /Include
if ($self->{'INC'}) {
my(@includes) = split(/\s+/,$self->{INC});
foreach (@includes) {
s/^-I//;
$incstr .= ','.$self->fixpath($_,1);
}
}
$quals .= "$incstr)";
# $quals =~ s/,,/,/g; $quals =~ s/\(,/(/g;
$self->{CCFLAGS} = $quals;
$self->{PERLTYPE} ||= '';
$self->{OPTIMIZE} ||= $flagoptstr || $Config{'optimize'};
if ($self->{OPTIMIZE} !~ m!/!) {
if ($self->{OPTIMIZE} =~ m!-g!) { $self->{OPTIMIZE} = '/Debug/NoOptimize' }
elsif ($self->{OPTIMIZE} =~ /-O(\d*)/) {
$self->{OPTIMIZE} = '/Optimize' . (defined($1) ? "=$1" : '');
}
else {
warn "MM_VMS: Can't parse OPTIMIZE \"$self->{OPTIMIZE}\"; using default\n" if length $self->{OPTIMIZE};
$self->{OPTIMIZE} = '/Optimize';
}
}
return $self->{CFLAGS} = qq{
CCFLAGS = $self->{CCFLAGS}
OPTIMIZE = $self->{OPTIMIZE}
PERLTYPE = $self->{PERLTYPE}
};
}
=item const_cccmd (override)
Adds directives to point C preprocessor to the right place when
handling #include E<lt>sys/foo.hE<gt> directives. Also constructs CC
command line a bit differently than MM_Unix method.
=cut
sub const_cccmd {
my($self,$libperl) = @_;
my(@m);
return $self->{CONST_CCCMD} if $self->{CONST_CCCMD};
return '' unless $self->needs_linking();
if ($Config{'vms_cc_type'} eq 'gcc') {
push @m,'
.FIRST
',$self->{NOECHO},'If F$TrnLnm("Sys").eqs."" Then Define/NoLog SYS GNU_CC_Include:[VMS]';
}
elsif ($Config{'vms_cc_type'} eq 'vaxc') {
push @m,'
.FIRST
',$self->{NOECHO},'If F$TrnLnm("Sys").eqs."" .and. F$TrnLnm("VAXC$Include").eqs."" Then Define/NoLog SYS Sys$Library
',$self->{NOECHO},'If F$TrnLnm("Sys").eqs."" .and. F$TrnLnm("VAXC$Include").nes."" Then Define/NoLog SYS VAXC$Include';
}
else {
push @m,'
.FIRST
',$self->{NOECHO},'If F$TrnLnm("Sys").eqs."" .and. F$TrnLnm("DECC$System_Include").eqs."" Then Define/NoLog SYS ',
($Config{'archname'} eq 'VMS_AXP' ? 'Sys$Library' : 'DECC$Library_Include'),'
',$self->{NOECHO},'If F$TrnLnm("Sys").eqs."" .and. F$TrnLnm("DECC$System_Include").nes."" Then Define/NoLog SYS DECC$System_Include';
}
push(@m, "\n\nCCCMD = $Config{'cc'} \$(CCFLAGS)\$(OPTIMIZE)\n");
$self->{CONST_CCCMD} = join('',@m);
}
=item tools_other (override)
Throw in some dubious extra macros for Makefile args.
Also keep around the old $(SAY) macro in case somebody's using it.
=cut
sub tools_other {
my($self) = @_;
# XXX Are these necessary? Does anyone override them? They're longer
# than just typing the literal string.
my $extra_tools = <<'EXTRA_TOOLS';
# Just in case anyone is using the old macro.
USEMACROS = $(MACROSTART)
SAY = $(ECHO)
EXTRA_TOOLS
return $self->SUPER::tools_other . $extra_tools;
}
=item init_dist (override)
VMSish defaults for some values.
macro description default
ZIPFLAGS flags to pass to ZIP -Vu
COMPRESS compression command to gzip
use for tarfiles
SUFFIX suffix to put on -gz
compressed files
SHAR shar command to use vms_share
DIST_DEFAULT default target to use to tardist
create a distribution
DISTVNAME Use VERSION_SYM instead of $(DISTNAME)-$(VERSION_SYM)
VERSION for the name
=cut
sub init_dist {
my($self) = @_;
$self->{ZIPFLAGS} ||= '-Vu';
$self->{COMPRESS} ||= 'gzip';
$self->{SUFFIX} ||= '-gz';
$self->{SHAR} ||= 'vms_share';
$self->{DIST_DEFAULT} ||= 'zipdist';
$self->SUPER::init_dist;
$self->{DISTVNAME} = "$self->{DISTNAME}-$self->{VERSION_SYM}"
unless $self->{ARGS}{DISTVNAME};
return;
}
=item c_o (override)
Use VMS syntax on command line. In particular, $(DEFINE) and
$(PERL_INC) have been pulled into $(CCCMD). Also use MM[SK] macros.
=cut
sub c_o {
my($self) = @_;
return '' unless $self->needs_linking();
'
.c$(OBJ_EXT) :
$(CCCMD) $(CCCDLFLAGS) $(MMS$TARGET_NAME).c
.cpp$(OBJ_EXT) :
$(CCCMD) $(CCCDLFLAGS) $(MMS$TARGET_NAME).cpp
.cxx$(OBJ_EXT) :
$(CCCMD) $(CCCDLFLAGS) $(MMS$TARGET_NAME).cxx
';
}
=item xs_c (override)
Use MM[SK] macros.
=cut
sub xs_c {
my($self) = @_;
return '' unless $self->needs_linking();
'
.xs.c :
$(XSUBPPRUN) $(XSPROTOARG) $(XSUBPPARGS) $(MMS$TARGET_NAME).xs >$(MMS$TARGET)
';
}
=item xs_o (override)
Use MM[SK] macros, and VMS command line for C compiler.
=cut
sub xs_o { # many makes are too dumb to use xs_c then c_o
my($self) = @_;
return '' unless $self->needs_linking();
'
.xs$(OBJ_EXT) :
$(XSUBPPRUN) $(XSPROTOARG) $(XSUBPPARGS) $(MMS$TARGET_NAME).xs >$(MMS$TARGET_NAME).c
$(CCCMD) $(CCCDLFLAGS) $(MMS$TARGET_NAME).c
';
}
=item dlsyms (override)
Create VMS linker options files specifying universal symbols for this
extension's shareable image, and listing other shareable images or
libraries to which it should be linked.
=cut
sub dlsyms {
my($self,%attribs) = @_;
return '' unless $self->needs_linking();
my($funcs) = $attribs{DL_FUNCS} || $self->{DL_FUNCS} || {};
my($vars) = $attribs{DL_VARS} || $self->{DL_VARS} || [];
my($funclist) = $attribs{FUNCLIST} || $self->{FUNCLIST} || [];
my(@m);
unless ($self->{SKIPHASH}{'dynamic'}) {
push(@m,'
dynamic :: $(INST_ARCHAUTODIR)$(BASEEXT).opt
$(NOECHO) $(NOOP)
');
}
push(@m,'
static :: $(INST_ARCHAUTODIR)$(BASEEXT).opt
$(NOECHO) $(NOOP)
') unless $self->{SKIPHASH}{'static'};
push @m,'
$(INST_ARCHAUTODIR)$(BASEEXT).opt : $(BASEEXT).opt
$(CP) $(MMS$SOURCE) $(MMS$TARGET)
$(BASEEXT).opt : Makefile.PL
$(PERLRUN) -e "use ExtUtils::Mksymlists;" -
',qq[-e "Mksymlists('NAME' => '$self->{NAME}', 'DL_FUNCS' => ],
neatvalue($funcs),q[, 'DL_VARS' => ],neatvalue($vars),
q[, 'FUNCLIST' => ],neatvalue($funclist),qq[)"\n];
push @m, ' $(PERL) -e "print ""$(INST_STATIC)/Include=';
if ($self->{OBJECT} =~ /\bBASEEXT\b/ or
$self->{OBJECT} =~ /\b$self->{BASEEXT}\b/i) {
push @m, ($Config{d_vms_case_sensitive_symbols}
? uc($self->{BASEEXT}) :'$(BASEEXT)');
}
else { # We don't have a "main" object file, so pull 'em all in
# Upcase module names if linker is being case-sensitive
my($upcase) = $Config{d_vms_case_sensitive_symbols};
my(@omods) = split ' ', $self->eliminate_macros($self->{OBJECT});
for (@omods) {
s/\.[^.]*$//; # Trim off file type
s[\$\(\w+_EXT\)][]; # even as a macro
s/.*[:>\/\]]//; # Trim off dir spec
$_ = uc if $upcase;
};
my(@lines);
my $tmp = shift @omods;
foreach my $elt (@omods) {
$tmp .= ",$elt";
if (length($tmp) > 80) { push @lines, $tmp; $tmp = ''; }
}
push @lines, $tmp;
push @m, '(', join( qq[, -\\n\\t"";" >>\$(MMS\$TARGET)\n\t\$(PERL) -e "print ""], @lines),')';
}
push @m, '\n$(INST_STATIC)/Library\n"";" >>$(MMS$TARGET)',"\n";
if (length $self->{LDLOADLIBS}) {
my($line) = '';
foreach my $lib (split ' ', $self->{LDLOADLIBS}) {
$lib =~ s%\$%\\\$%g; # Escape '$' in VMS filespecs
if (length($line) + length($lib) > 160) {
push @m, "\t\$(PERL) -e \"print qq{$line}\" >>\$(MMS\$TARGET)\n";
$line = $lib . '\n';
}
else { $line .= $lib . '\n'; }
}
push @m, "\t\$(PERL) -e \"print qq{$line}\" >>\$(MMS\$TARGET)\n" if $line;
}
join('',@m);
}
=item dynamic_lib (override)
Use VMS Link command.
=cut
sub dynamic_lib {
my($self, %attribs) = @_;
return '' unless $self->needs_linking(); #might be because of a subdir
return '' unless $self->has_link_code();
my($otherldflags) = $attribs{OTHERLDFLAGS} || "";
my($inst_dynamic_dep) = $attribs{INST_DYNAMIC_DEP} || "";
my $shr = $Config{'dbgprefix'} . 'PerlShr';
my(@m);
push @m,"
OTHERLDFLAGS = $otherldflags
INST_DYNAMIC_DEP = $inst_dynamic_dep
";
push @m, '
$(INST_DYNAMIC) : $(INST_STATIC) $(PERL_INC)perlshr_attr.opt $(INST_ARCHAUTODIR)$(DFSEP).exists $(EXPORT_LIST) $(PERL_ARCHIVE) $(INST_DYNAMIC_DEP)
If F$TrnLNm("',$shr,'").eqs."" Then Define/NoLog/User ',"$shr Sys\$Share:$shr.$Config{'dlext'}",'
Link $(LDFLAGS) /Shareable=$(MMS$TARGET)$(OTHERLDFLAGS) $(BASEEXT).opt/Option,$(PERL_INC)perlshr_attr.opt/Option
';
join('',@m);
}
=item static_lib (override)
Use VMS commands to manipulate object library.
=cut
sub static_lib {
my($self) = @_;
return '' unless $self->needs_linking();
return '
$(INST_STATIC) :
$(NOECHO) $(NOOP)
' unless ($self->{OBJECT} or @{$self->{C} || []} or $self->{MYEXTLIB});
my(@m);
push @m,'
# Rely on suffix rule for update action
$(OBJECT) : $(INST_ARCHAUTODIR)$(DFSEP).exists
$(INST_STATIC) : $(OBJECT) $(MYEXTLIB)
';
# If this extension has its own library (eg SDBM_File)
# then copy that to $(INST_STATIC) and add $(OBJECT) into it.
push(@m, "\t",'$(CP) $(MYEXTLIB) $(MMS$TARGET)',"\n") if $self->{MYEXTLIB};
push(@m,"\t",'If F$Search("$(MMS$TARGET)").eqs."" Then Library/Object/Create $(MMS$TARGET)',"\n");
# if there was a library to copy, then we can't use MMS$SOURCE_LIST,
# 'cause it's a library and you can't stick them in other libraries.
# In that case, we use $OBJECT instead and hope for the best
if ($self->{MYEXTLIB}) {
push(@m,"\t",'Library/Object/Replace $(MMS$TARGET) $(OBJECT)',"\n");
} else {
push(@m,"\t",'Library/Object/Replace $(MMS$TARGET) $(MMS$SOURCE_LIST)',"\n");
}
push @m, "\t\$(NOECHO) \$(PERL) -e 1 >\$(INST_ARCHAUTODIR)extralibs.ld\n";
foreach my $lib (split ' ', $self->{EXTRALIBS}) {
push(@m,"\t",'$(NOECHO) $(PERL) -e "print qq{',$lib,'\n}" >>$(INST_ARCHAUTODIR)extralibs.ld',"\n");
}
join('',@m);
}
=item extra_clean_files
Clean up some OS specific files. Plus the temp file used to shorten
a lot of commands. And the name mangler database.
=cut
sub extra_clean_files {
return qw(
*.Map *.Dmp *.Lis *.cpp *.$(DLEXT) *.Opt $(BASEEXT).bso
.MM_Tmp cxx_repository
);
}
=item zipfile_target
=item tarfile_target
=item shdist_target
Syntax for invoking shar, tar and zip differs from that for Unix.
=cut
sub zipfile_target {
my($self) = shift;
return <<'MAKE_FRAG';
$(DISTVNAME).zip : distdir
$(PREOP)
$(ZIP) "$(ZIPFLAGS)" $(MMS$TARGET) [.$(DISTVNAME)...]*.*;
$(RM_RF) $(DISTVNAME)
$(POSTOP)
MAKE_FRAG
}
sub tarfile_target {
my($self) = shift;
return <<'MAKE_FRAG';
$(DISTVNAME).tar$(SUFFIX) : distdir
$(PREOP)
$(TO_UNIX)
$(TAR) "$(TARFLAGS)" $(DISTVNAME).tar [.$(DISTVNAME)...]
$(RM_RF) $(DISTVNAME)
$(COMPRESS) $(DISTVNAME).tar
$(POSTOP)
MAKE_FRAG
}
sub shdist_target {
my($self) = shift;
return <<'MAKE_FRAG';
shdist : distdir
$(PREOP)
$(SHAR) [.$(DISTVNAME)...]*.*; $(DISTVNAME).share
$(RM_RF) $(DISTVNAME)
$(POSTOP)
MAKE_FRAG
}
# --- Test and Installation Sections ---
=item install (override)
Work around DCL's 255 character limit several times,and use
VMS-style command line quoting in a few cases.
=cut
sub install {
my($self, %attribs) = @_;
my(@m);
push @m, q[
install :: all pure_install doc_install
$(NOECHO) $(NOOP)
install_perl :: all pure_perl_install doc_perl_install
$(NOECHO) $(NOOP)
install_site :: all pure_site_install doc_site_install
$(NOECHO) $(NOOP)
install_vendor :: all pure_vendor_install doc_vendor_install
$(NOECHO) $(NOOP)
pure_install :: pure_$(INSTALLDIRS)_install
$(NOECHO) $(NOOP)
doc_install :: doc_$(INSTALLDIRS)_install
$(NOECHO) $(NOOP)
pure__install : pure_site_install
$(NOECHO) $(ECHO) "INSTALLDIRS not defined, defaulting to INSTALLDIRS=site"
doc__install : doc_site_install
$(NOECHO) $(ECHO) "INSTALLDIRS not defined, defaulting to INSTALLDIRS=site"
# This hack brought to you by DCL's 255-character command line limit
pure_perl_install ::
];
push @m,
q[ $(NOECHO) $(PERLRUN) "-MFile::Spec" -e "print 'read|'.File::Spec->catfile('$(PERL_ARCHLIB)','auto','$(FULLEXT)','.packlist').'|'" >.MM_tmp
$(NOECHO) $(PERLRUN) "-MFile::Spec" -e "print 'write|'.File::Spec->catfile('$(DESTINSTALLARCHLIB)','auto','$(FULLEXT)','.packlist').'|'" >>.MM_tmp
] unless $self->{NO_PACKLIST};
push @m,
q[ $(NOECHO) $(ECHO_N) "$(INST_LIB)|$(DESTINSTALLPRIVLIB)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_ARCHLIB)|$(DESTINSTALLARCHLIB)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_BIN)|$(DESTINSTALLBIN)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_SCRIPT)|$(DESTINSTALLSCRIPT)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_MAN1DIR) $(DESTINSTALLMAN1DIR) " >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_MAN3DIR)|$(DESTINSTALLMAN3DIR)" >>.MM_tmp
$(NOECHO) $(MOD_INSTALL) <.MM_tmp
$(NOECHO) $(RM_F) .MM_tmp
$(NOECHO) $(WARN_IF_OLD_PACKLIST) "].$self->catfile($self->{SITEARCHEXP},'auto',$self->{FULLEXT},'.packlist').q["
# Likewise
pure_site_install ::
];
push @m,
q[ $(NOECHO) $(PERLRUN) "-MFile::Spec" -e "print 'read|'.File::Spec->catfile('$(SITEARCHEXP)','auto','$(FULLEXT)','.packlist').'|'" >.MM_tmp
$(NOECHO) $(PERLRUN) "-MFile::Spec" -e "print 'write|'.File::Spec->catfile('$(DESTINSTALLSITEARCH)','auto','$(FULLEXT)','.packlist').'|'" >>.MM_tmp
] unless $self->{NO_PACKLIST};
push @m,
q[ $(NOECHO) $(ECHO_N) "$(INST_LIB)|$(DESTINSTALLSITELIB)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_ARCHLIB)|$(DESTINSTALLSITEARCH)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_BIN)|$(DESTINSTALLSITEBIN)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_SCRIPT)|$(DESTINSTALLSCRIPT)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_MAN1DIR)|$(DESTINSTALLSITEMAN1DIR)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_MAN3DIR)|$(DESTINSTALLSITEMAN3DIR)" >>.MM_tmp
$(NOECHO) $(MOD_INSTALL) <.MM_tmp
$(NOECHO) $(RM_F) .MM_tmp
$(NOECHO) $(WARN_IF_OLD_PACKLIST) "].$self->catfile($self->{PERL_ARCHLIB},'auto',$self->{FULLEXT},'.packlist').q["
pure_vendor_install ::
];
push @m,
q[ $(NOECHO) $(PERLRUN) "-MFile::Spec" -e "print 'read|'.File::Spec->catfile('$(VENDORARCHEXP)','auto','$(FULLEXT)','.packlist').'|'" >.MM_tmp
$(NOECHO) $(PERLRUN) "-MFile::Spec" -e "print 'write|'.File::Spec->catfile('$(DESTINSTALLVENDORARCH)','auto','$(FULLEXT)','.packlist').'|'" >>.MM_tmp
] unless $self->{NO_PACKLIST};
push @m,
q[ $(NOECHO) $(ECHO_N) "$(INST_LIB)|$(DESTINSTALLVENDORLIB)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_ARCHLIB)|$(DESTINSTALLVENDORARCH)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_BIN)|$(DESTINSTALLVENDORBIN)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_SCRIPT)|$(DESTINSTALLSCRIPT)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_MAN1DIR)|$(DESTINSTALLVENDORMAN1DIR)|" >>.MM_tmp
$(NOECHO) $(ECHO_N) "$(INST_MAN3DIR)|$(DESTINSTALLVENDORMAN3DIR)" >>.MM_tmp
$(NOECHO) $(MOD_INSTALL) <.MM_tmp
$(NOECHO) $(RM_F) .MM_tmp
];
push @m, q[
# Ditto
doc_perl_install ::
$(NOECHO) $(NOOP)
# And again
doc_site_install ::
$(NOECHO) $(NOOP)
doc_vendor_install ::
$(NOECHO) $(NOOP)
] if $self->{NO_PERLLOCAL};
push @m, q[
# Ditto
doc_perl_install ::
$(NOECHO) $(ECHO) "Appending installation info to ].$self->catfile($self->{DESTINSTALLARCHLIB}, 'perllocal.pod').q["
$(NOECHO) $(MKPATH) $(DESTINSTALLARCHLIB)
$(NOECHO) $(ECHO_N) "installed into|$(INSTALLPRIVLIB)|" >.MM_tmp
$(NOECHO) $(ECHO_N) "LINKTYPE|$(LINKTYPE)|VERSION|$(VERSION)|EXE_FILES|$(EXE_FILES) " >>.MM_tmp
$(NOECHO) $(DOC_INSTALL) "Module" "$(NAME)" <.MM_tmp >>].$self->catfile($self->{DESTINSTALLARCHLIB},'perllocal.pod').q[
$(NOECHO) $(RM_F) .MM_tmp
# And again
doc_site_install ::
$(NOECHO) $(ECHO) "Appending installation info to ].$self->catfile($self->{DESTINSTALLARCHLIB}, 'perllocal.pod').q["
$(NOECHO) $(MKPATH) $(DESTINSTALLARCHLIB)
$(NOECHO) $(ECHO_N) "installed into|$(INSTALLSITELIB)|" >.MM_tmp
$(NOECHO) $(ECHO_N) "LINKTYPE|$(LINKTYPE)|VERSION|$(VERSION)|EXE_FILES|$(EXE_FILES) " >>.MM_tmp
$(NOECHO) $(DOC_INSTALL) "Module" "$(NAME)" <.MM_tmp >>].$self->catfile($self->{DESTINSTALLARCHLIB},'perllocal.pod').q[
$(NOECHO) $(RM_F) .MM_tmp
doc_vendor_install ::
$(NOECHO) $(ECHO) "Appending installation info to ].$self->catfile($self->{DESTINSTALLARCHLIB}, 'perllocal.pod').q["
$(NOECHO) $(MKPATH) $(DESTINSTALLARCHLIB)
$(NOECHO) $(ECHO_N) "installed into|$(INSTALLVENDORLIB)|" >.MM_tmp
$(NOECHO) $(ECHO_N) "LINKTYPE|$(LINKTYPE)|VERSION|$(VERSION)|EXE_FILES|$(EXE_FILES) " >>.MM_tmp
$(NOECHO) $(DOC_INSTALL) "Module" "$(NAME)" <.MM_tmp >>].$self->catfile($self->{DESTINSTALLARCHLIB},'perllocal.pod').q[
$(NOECHO) $(RM_F) .MM_tmp
] unless $self->{NO_PERLLOCAL};
push @m, q[
uninstall :: uninstall_from_$(INSTALLDIRS)dirs
$(NOECHO) $(NOOP)
uninstall_from_perldirs ::
$(NOECHO) $(UNINSTALL) ].$self->catfile($self->{PERL_ARCHLIB},'auto',$self->{FULLEXT},'.packlist').q[
uninstall_from_sitedirs ::
$(NOECHO) $(UNINSTALL) ].$self->catfile($self->{SITEARCHEXP},'auto',$self->{FULLEXT},'.packlist').q[
uninstall_from_vendordirs ::
$(NOECHO) $(UNINSTALL) ].$self->catfile($self->{VENDORARCHEXP},'auto',$self->{FULLEXT},'.packlist').q[
];
join('',@m);
}
=item perldepend (override)
Use VMS-style syntax for files; it's cheaper to just do it directly here
than to have the MM_Unix method call C<catfile> repeatedly. Also, if
we have to rebuild Config.pm, use MM[SK] to do it.
=cut
sub perldepend {
my($self) = @_;
my(@m);
if ($self->{OBJECT}) {
# Need to add an object file dependency on the perl headers.
# this is very important for XS modules in perl.git development.
push @m, $self->_perl_header_files_fragment(""); # empty separator on VMS as its in the $(PERL_INC)
}
if ($self->{PERL_SRC}) {
my(@macros);
my($mmsquals) = '$(USEMAKEFILE)[.vms]$(FIRST_MAKEFILE)';
push(@macros,'__AXP__=1') if $Config{'archname'} eq 'VMS_AXP';
push(@macros,'DECC=1') if $Config{'vms_cc_type'} eq 'decc';
push(@macros,'GNUC=1') if $Config{'vms_cc_type'} eq 'gcc';
push(@macros,'SOCKET=1') if $Config{'d_has_sockets'};
push(@macros,qq["CC=$Config{'cc'}"]) if $Config{'cc'} =~ m!/!;
$mmsquals .= '$(USEMACROS)' . join(',',@macros) . '$(MACROEND)' if @macros;
push(@m,q[
# Check for unpropagated config.sh changes. Should never happen.
# We do NOT just update config.h because that is not sufficient.
# An out of date config.h is not fatal but complains loudly!
$(PERL_INC)config.h : $(PERL_SRC)config.sh
$(NOOP)
$(PERL_ARCHLIB)Config.pm : $(PERL_SRC)config.sh
$(NOECHO) Write Sys$Error "$(PERL_ARCHLIB)Config.pm may be out of date with config.h or genconfig.pl"
olddef = F$Environment("Default")
Set Default $(PERL_SRC)
$(MMS)],$mmsquals,);
if ($self->{PERL_ARCHLIB} =~ m|\[-| && $self->{PERL_SRC} =~ m|(\[-+)|) {
my($prefix,$target) = ($1,$self->fixpath('$(PERL_ARCHLIB)Config.pm',0));
$target =~ s/\Q$prefix/[/;
push(@m," $target");
}
else { push(@m,' $(MMS$TARGET)'); }
push(@m,q[
Set Default 'olddef'
]);
}
push(@m, join(" ", map($self->fixpath($_,0),values %{$self->{XS}}))." : \$(XSUBPPDEPS)\n")
if %{$self->{XS}};
join('',@m);
}
=item makeaperl (override)
Undertake to build a new set of Perl images using VMS commands. Since
VMS does dynamic loading, it's not necessary to statically link each
extension into the Perl image, so this isn't the normal build path.
Consequently, it hasn't really been tested, and may well be incomplete.
=cut
our %olbs; # needs to be localized
sub makeaperl {
my($self, %attribs) = @_;
my($makefilename, $searchdirs, $static, $extra, $perlinc, $target, $tmpdir, $libperl) =
@attribs{qw(MAKE DIRS STAT EXTRA INCL TARGET TMP LIBPERL)};
my(@m);
push @m, "
# --- MakeMaker makeaperl section ---
MAP_TARGET = $target
";
return join '', @m if $self->{PARENT};
my($dir) = join ":", @{$self->{DIR}};
unless ($self->{MAKEAPERL}) {
push @m, q{
$(MAKE_APERL_FILE) : $(FIRST_MAKEFILE)
$(NOECHO) $(ECHO) "Writing ""$(MMS$TARGET)"" for this $(MAP_TARGET)"
$(NOECHO) $(PERLRUNINST) \
Makefile.PL DIR=}, $dir, q{ \
FIRST_MAKEFILE=$(MAKE_APERL_FILE) LINKTYPE=static \
MAKEAPERL=1 NORECURS=1 };
push @m, map(q[ \\\n\t\t"$_"], @ARGV),q{
$(MAP_TARGET) :: $(MAKE_APERL_FILE)
$(MAKE)$(USEMAKEFILE)$(MAKE_APERL_FILE) static $(MMS$TARGET)
};
push @m, "\n";
return join '', @m;
}
my($linkcmd,@optlibs,@staticpkgs,$extralist,$targdir,$libperldir,%libseen);
local($_);
# The front matter of the linkcommand...
$linkcmd = join ' ', $Config{'ld'},
grep($_, @Config{qw(large split ldflags ccdlflags)});
$linkcmd =~ s/\s+/ /g;
# Which *.olb files could we make use of...
local(%olbs); # XXX can this be lexical?
$olbs{$self->{INST_ARCHAUTODIR}} = "$self->{BASEEXT}\$(LIB_EXT)";
require File::Find;
File::Find::find(sub {
return unless m/\Q$self->{LIB_EXT}\E$/;
return if m/^libperl/;
if( exists $self->{INCLUDE_EXT} ){
my $found = 0;
(my $xx = $File::Find::name) =~ s,.*?/auto/,,;
$xx =~ s,/?$_,,;
$xx =~ s,/,::,g;
# Throw away anything not explicitly marked for inclusion.
# DynaLoader is implied.
foreach my $incl ((@{$self->{INCLUDE_EXT}},'DynaLoader')){
if( $xx eq $incl ){
$found++;
last;
}
}
return unless $found;
}
elsif( exists $self->{EXCLUDE_EXT} ){
(my $xx = $File::Find::name) =~ s,.*?/auto/,,;
$xx =~ s,/?$_,,;
$xx =~ s,/,::,g;
# Throw away anything explicitly marked for exclusion
foreach my $excl (@{$self->{EXCLUDE_EXT}}){
return if( $xx eq $excl );
}
}
$olbs{$ENV{DEFAULT}} = $_;
}, grep( -d $_, @{$searchdirs || []}));
# We trust that what has been handed in as argument will be buildable
$static = [] unless $static;
@olbs{@{$static}} = (1) x @{$static};
$extra = [] unless $extra && ref $extra eq 'ARRAY';
# Sort the object libraries in inverse order of
# filespec length to try to insure that dependent extensions
# will appear before their parents, so the linker will
# search the parent library to resolve references.
# (e.g. Intuit::DWIM will precede Intuit, so unresolved
# references from [.intuit.dwim]dwim.obj can be found
# in [.intuit]intuit.olb).
for (sort { length($a) <=> length($b) } keys %olbs) {
next unless $olbs{$_} =~ /\Q$self->{LIB_EXT}\E$/;
my($dir) = $self->fixpath($_,1);
my($extralibs) = $dir . "extralibs.ld";
my($extopt) = $dir . $olbs{$_};
$extopt =~ s/$self->{LIB_EXT}$/.opt/;
push @optlibs, "$dir$olbs{$_}";
# Get external libraries this extension will need
if (-f $extralibs ) {
my %seenthis;
open my $list, "<", $extralibs or warn $!,next;
while (<$list>) {
chomp;
# Include a library in the link only once, unless it's mentioned
# multiple times within a single extension's options file, in which
# case we assume the builder needed to search it again later in the
# link.
my $skip = exists($libseen{$_}) && !exists($seenthis{$_});
$libseen{$_}++; $seenthis{$_}++;
next if $skip;
push @$extra,$_;
}
}
# Get full name of extension for ExtUtils::Miniperl
if (-f $extopt) {
open my $opt, '<', $extopt or die $!;
while (<$opt>) {
next unless /(?:UNIVERSAL|VECTOR)=boot_([\w_]+)/;
my $pkg = $1;
$pkg =~ s#__*#::#g;
push @staticpkgs,$pkg;
}
}
}
# Place all of the external libraries after all of the Perl extension
# libraries in the final link, in order to maximize the opportunity
# for XS code from multiple extensions to resolve symbols against the
# same external library while only including that library once.
push @optlibs, @$extra;
$target = "Perl$Config{'exe_ext'}" unless $target;
my $shrtarget;
($shrtarget,$targdir) = fileparse($target);
$shrtarget =~ s/^([^.]*)/$1Shr/;
$shrtarget = $targdir . $shrtarget;
$target = "Perlshr.$Config{'dlext'}" unless $target;
$tmpdir = "[]" unless $tmpdir;
$tmpdir = $self->fixpath($tmpdir,1);
if (@optlibs) { $extralist = join(' ',@optlibs); }
else { $extralist = ''; }
# Let ExtUtils::Liblist find the necessary libs for us (but skip PerlShr)
# that's what we're building here).
push @optlibs, grep { !/PerlShr/i } split ' ', +($self->ext())[2];
if ($libperl) {
unless (-f $libperl || -f ($libperl = $self->catfile($Config{'installarchlib'},'CORE',$libperl))) {
print "Warning: $libperl not found\n";
undef $libperl;
}
}
unless ($libperl) {
if (defined $self->{PERL_SRC}) {
$libperl = $self->catfile($self->{PERL_SRC},"libperl$self->{LIB_EXT}");
} elsif (-f ($libperl = $self->catfile($Config{'installarchlib'},'CORE',"libperl$self->{LIB_EXT}")) ) {
} else {
print "Warning: $libperl not found
If you're going to build a static perl binary, make sure perl is installed
otherwise ignore this warning\n";
}
}
$libperldir = $self->fixpath((fileparse($libperl))[1],1);
push @m, '
# Fill in the target you want to produce if it\'s not perl
MAP_TARGET = ',$self->fixpath($target,0),'
MAP_SHRTARGET = ',$self->fixpath($shrtarget,0),"
MAP_LINKCMD = $linkcmd
MAP_PERLINC = ", $perlinc ? map('"$_" ',@{$perlinc}) : '',"
MAP_EXTRA = $extralist
MAP_LIBPERL = ",$self->fixpath($libperl,0),'
';
push @m,"\n${tmpdir}Makeaperl.Opt : \$(MAP_EXTRA)\n";
foreach (@optlibs) {
push @m,' $(NOECHO) $(PERL) -e "print q{',$_,'}" >>$(MMS$TARGET)',"\n";
}
push @m,"\n${tmpdir}PerlShr.Opt :\n\t";
push @m,'$(NOECHO) $(PERL) -e "print q{$(MAP_SHRTARGET)}" >$(MMS$TARGET)',"\n";
push @m,'
$(MAP_SHRTARGET) : $(MAP_LIBPERL) Makeaperl.Opt ',"${libperldir}Perlshr_Attr.Opt",'
$(MAP_LINKCMD)/Shareable=$(MMS$TARGET) $(MAP_LIBPERL), Makeaperl.Opt/Option ',"${libperldir}Perlshr_Attr.Opt/Option",'
$(MAP_TARGET) : $(MAP_SHRTARGET) ',"${tmpdir}perlmain\$(OBJ_EXT) ${tmpdir}PerlShr.Opt",'
$(MAP_LINKCMD) ',"${tmpdir}perlmain\$(OBJ_EXT)",', PerlShr.Opt/Option
$(NOECHO) $(ECHO) "To install the new ""$(MAP_TARGET)"" binary, say"
$(NOECHO) $(ECHO) " $(MAKE)$(USEMAKEFILE)$(FIRST_MAKEFILE) inst_perl $(USEMACROS)MAP_TARGET=$(MAP_TARGET)$(ENDMACRO)"
$(NOECHO) $(ECHO) "To remove the intermediate files, say
$(NOECHO) $(ECHO) " $(MAKE)$(USEMAKEFILE)$(FIRST_MAKEFILE) map_clean"
';
push @m,"\n${tmpdir}perlmain.c : \$(FIRST_MAKEFILE)\n\t\$(NOECHO) \$(PERL) -e 1 >${tmpdir}Writemain.tmp\n";
push @m, "# More from the 255-char line length limit\n";
foreach (@staticpkgs) {
push @m,' $(NOECHO) $(PERL) -e "print q{',$_,qq[}" >>${tmpdir}Writemain.tmp\n];
}
push @m, sprintf <<'MAKE_FRAG', $tmpdir, $tmpdir;
$(NOECHO) $(PERL) $(MAP_PERLINC) -ane "use ExtUtils::Miniperl; writemain(@F)" %sWritemain.tmp >$(MMS$TARGET)
$(NOECHO) $(RM_F) %sWritemain.tmp
MAKE_FRAG
push @m, q[
# Still more from the 255-char line length limit
doc_inst_perl :
$(NOECHO) $(MKPATH) $(DESTINSTALLARCHLIB)
$(NOECHO) $(ECHO) "Perl binary $(MAP_TARGET)|" >.MM_tmp
$(NOECHO) $(ECHO) "MAP_STATIC|$(MAP_STATIC)|" >>.MM_tmp
$(NOECHO) $(PERL) -pl040 -e " " ].$self->catfile('$(INST_ARCHAUTODIR)','extralibs.all'),q[ >>.MM_tmp
$(NOECHO) $(ECHO) -e "MAP_LIBPERL|$(MAP_LIBPERL)|" >>.MM_tmp
$(NOECHO) $(DOC_INSTALL) <.MM_tmp >>].$self->catfile('$(DESTINSTALLARCHLIB)','perllocal.pod').q[
$(NOECHO) $(RM_F) .MM_tmp
];
push @m, "
inst_perl : pure_inst_perl doc_inst_perl
\$(NOECHO) \$(NOOP)
pure_inst_perl : \$(MAP_TARGET)
$self->{CP} \$(MAP_SHRTARGET) ",$self->fixpath($Config{'installbin'},1),"
$self->{CP} \$(MAP_TARGET) ",$self->fixpath($Config{'installbin'},1),"
clean :: map_clean
\$(NOECHO) \$(NOOP)
map_clean :
\$(RM_F) ${tmpdir}perlmain\$(OBJ_EXT) ${tmpdir}perlmain.c \$(FIRST_MAKEFILE)
\$(RM_F) ${tmpdir}Makeaperl.Opt ${tmpdir}PerlShr.Opt \$(MAP_TARGET)
";
join '', @m;
}
# --- Output postprocessing section ---
=item maketext_filter (override)
Insure that colons marking targets are preceded by space, in order
to distinguish the target delimiter from a colon appearing as
part of a filespec.
=cut
sub maketext_filter {
my($self, $text) = @_;
$text =~ s/^([^\s:=]+)(:+\s)/$1 $2/mg;
return $text;
}
=item prefixify (override)
prefixifying on VMS is simple. Each should simply be:
perl_root:[some.dir]
which can just be converted to:
volume:[your.prefix.some.dir]
otherwise you get the default layout.
In effect, your search prefix is ignored and $Config{vms_prefix} is
used instead.
=cut
sub prefixify {
my($self, $var, $sprefix, $rprefix, $default) = @_;
# Translate $(PERLPREFIX) to a real path.
$rprefix = $self->eliminate_macros($rprefix);
$rprefix = vmspath($rprefix) if $rprefix;
$sprefix = vmspath($sprefix) if $sprefix;
$default = vmsify($default)
unless $default =~ /\[.*\]/;
(my $var_no_install = $var) =~ s/^install//;
my $path = $self->{uc $var} ||
$ExtUtils::MM_Unix::Config_Override{lc $var} ||
$Config{lc $var} || $Config{lc $var_no_install};
if( !$path ) {
warn " no Config found for $var.\n" if $Verbose >= 2;
$path = $self->_prefixify_default($rprefix, $default);
}
elsif( !$self->{ARGS}{PREFIX} || !$self->file_name_is_absolute($path) ) {
# do nothing if there's no prefix or if its relative
}
elsif( $sprefix eq $rprefix ) {
warn " no new prefix.\n" if $Verbose >= 2;
}
else {
warn " prefixify $var => $path\n" if $Verbose >= 2;
warn " from $sprefix to $rprefix\n" if $Verbose >= 2;
my($path_vol, $path_dirs) = $self->splitpath( $path );
if( $path_vol eq $Config{vms_prefix}.':' ) {
warn " $Config{vms_prefix}: seen\n" if $Verbose >= 2;
$path_dirs =~ s{^\[}{\[.} unless $path_dirs =~ m{^\[\.};
$path = $self->_catprefix($rprefix, $path_dirs);
}
else {
$path = $self->_prefixify_default($rprefix, $default);
}
}
print " now $path\n" if $Verbose >= 2;
return $self->{uc $var} = $path;
}
sub _prefixify_default {
my($self, $rprefix, $default) = @_;
warn " cannot prefix, using default.\n" if $Verbose >= 2;
if( !$default ) {
warn "No default!\n" if $Verbose >= 1;
return;
}
if( !$rprefix ) {
warn "No replacement prefix!\n" if $Verbose >= 1;
return '';
}
return $self->_catprefix($rprefix, $default);
}
sub _catprefix {
my($self, $rprefix, $default) = @_;
my($rvol, $rdirs) = $self->splitpath($rprefix);
if( $rvol ) {
return $self->catpath($rvol,
$self->catdir($rdirs, $default),
''
)
}
else {
return $self->catdir($rdirs, $default);
}
}
=item cd
=cut
sub cd {
my($self, $dir, @cmds) = @_;
$dir = vmspath($dir);
my $cmd = join "\n\t", map "$_", @cmds;
# No leading tab makes it look right when embedded
my $make_frag = sprintf <<'MAKE_FRAG', $dir, $cmd;
startdir = F$Environment("Default")
Set Default %s
%s
Set Default 'startdir'
MAKE_FRAG
# No trailing newline makes this easier to embed
chomp $make_frag;
return $make_frag;
}
=item oneliner
=cut
sub oneliner {
my($self, $cmd, $switches) = @_;
$switches = [] unless defined $switches;
# Strip leading and trailing newlines
$cmd =~ s{^\n+}{};
$cmd =~ s{\n+$}{};
$cmd = $self->quote_literal($cmd);
$cmd = $self->escape_newlines($cmd);
# Switches must be quoted else they will be lowercased.
$switches = join ' ', map { qq{"$_"} } @$switches;
return qq{\$(ABSPERLRUN) $switches -e $cmd "--"};
}
=item B<echo>
perl trips up on "<foo>" thinking it's an input redirect. So we use the
native Write command instead. Besides, its faster.
=cut
sub echo {
my($self, $text, $file, $opts) = @_;
# Compatibility with old options
if( !ref $opts ) {
my $append = $opts;
$opts = { append => $append || 0 };
}
my $opencmd = $opts->{append} ? 'Open/Append' : 'Open/Write';
$opts->{allow_variables} = 0 unless defined $opts->{allow_variables};
my $ql_opts = { allow_variables => $opts->{allow_variables} };
my @cmds = ("\$(NOECHO) $opencmd MMECHOFILE $file ");
push @cmds, map { '$(NOECHO) Write MMECHOFILE '.$self->quote_literal($_, $ql_opts) }
split /\n/, $text;
push @cmds, '$(NOECHO) Close MMECHOFILE';
return @cmds;
}
=item quote_literal
=cut
sub quote_literal {
my($self, $text, $opts) = @_;
$opts->{allow_variables} = 1 unless defined $opts->{allow_variables};
# I believe this is all we should need.
$text =~ s{"}{""}g;
$text = $opts->{allow_variables}
? $self->escape_dollarsigns($text) : $self->escape_all_dollarsigns($text);
return qq{"$text"};
}
=item escape_dollarsigns
Quote, don't escape.
=cut
sub escape_dollarsigns {
my($self, $text) = @_;
# Quote dollar signs which are not starting a variable
$text =~ s{\$ (?!\() }{"\$"}gx;
return $text;
}
=item escape_all_dollarsigns
Quote, don't escape.
=cut
sub escape_all_dollarsigns {
my($self, $text) = @_;
# Quote dollar signs
$text =~ s{\$}{"\$\"}gx;
return $text;
}
=item escape_newlines
=cut
sub escape_newlines {
my($self, $text) = @_;
$text =~ s{\n}{-\n}g;
return $text;
}
=item max_exec_len
256 characters.
=cut
sub max_exec_len {
my $self = shift;
return $self->{_MAX_EXEC_LEN} ||= 256;
}
=item init_linker
=cut
sub init_linker {
my $self = shift;
$self->{EXPORT_LIST} ||= '$(BASEEXT).opt';
my $shr = $Config{dbgprefix} . 'PERLSHR';
if ($self->{PERL_SRC}) {
$self->{PERL_ARCHIVE} ||=
$self->catfile($self->{PERL_SRC}, "$shr.$Config{'dlext'}");
}
else {
$self->{PERL_ARCHIVE} ||=
$ENV{$shr} ? $ENV{$shr} : "Sys\$Share:$shr.$Config{'dlext'}";
}
$self->{PERL_ARCHIVEDEP} ||= '';
$self->{PERL_ARCHIVE_AFTER} ||= '';
}
=item catdir (override)
=item catfile (override)
Eliminate the macros in the output to the MMS/MMK file.
(File::Spec::VMS used to do this for us, but it's being removed)
=cut
sub catdir {
my $self = shift;
# Process the macros on VMS MMS/MMK
my @args = map { m{\$\(} ? $self->eliminate_macros($_) : $_ } @_;
my $dir = $self->SUPER::catdir(@args);
# Fix up the directory and force it to VMS format.
$dir = $self->fixpath($dir, 1);
return $dir;
}
sub catfile {
my $self = shift;
# Process the macros on VMS MMS/MMK
my @args = map { m{\$\(} ? $self->eliminate_macros($_) : $_ } @_;
my $file = $self->SUPER::catfile(@args);
$file = vmsify($file);
return $file
}
=item eliminate_macros
Expands MM[KS]/Make macros in a text string, using the contents of
identically named elements of C<%$self>, and returns the result
as a file specification in Unix syntax.
NOTE: This is the canonical version of the method. The version in
File::Spec::VMS is deprecated.
=cut
sub eliminate_macros {
my($self,$path) = @_;
return '' unless $path;
$self = {} unless ref $self;
my($npath) = unixify($path);
# sometimes unixify will return a string with an off-by-one trailing null
$npath =~ s{\0$}{};
my($complex) = 0;
my($head,$macro,$tail);
# perform m##g in scalar context so it acts as an iterator
while ($npath =~ m#(.*?)\$\((\S+?)\)(.*)#gs) {
if (defined $self->{$2}) {
($head,$macro,$tail) = ($1,$2,$3);
if (ref $self->{$macro}) {
if (ref $self->{$macro} eq 'ARRAY') {
$macro = join ' ', @{$self->{$macro}};
}
else {
print "Note: can't expand macro \$($macro) containing ",ref($self->{$macro}),
"\n\t(using MMK-specific deferred substitutuon; MMS will break)\n";
$macro = "\cB$macro\cB";
$complex = 1;
}
}
else { ($macro = unixify($self->{$macro})) =~ s#/\Z(?!\n)##; }
$npath = "$head$macro$tail";
}
}
if ($complex) { $npath =~ s#\cB(.*?)\cB#\${$1}#gs; }
$npath;
}
=item fixpath
my $path = $mm->fixpath($path);
my $path = $mm->fixpath($path, $is_dir);
Catchall routine to clean up problem MM[SK]/Make macros. Expands macros
in any directory specification, in order to avoid juxtaposing two
VMS-syntax directories when MM[SK] is run. Also expands expressions which
are all macro, so that we can tell how long the expansion is, and avoid
overrunning DCL's command buffer when MM[KS] is running.
fixpath() checks to see whether the result matches the name of a
directory in the current default directory and returns a directory or
file specification accordingly. C<$is_dir> can be set to true to
force fixpath() to consider the path to be a directory or false to force
it to be a file.
NOTE: This is the canonical version of the method. The version in
File::Spec::VMS is deprecated.
=cut
sub fixpath {
my($self,$path,$force_path) = @_;
return '' unless $path;
$self = bless {}, $self unless ref $self;
my($fixedpath,$prefix,$name);
if ($path =~ m#^\$\([^\)]+\)\Z(?!\n)#s || $path =~ m#[/:>\]]#) {
if ($force_path or $path =~ /(?:DIR\)|\])\Z(?!\n)/) {
$fixedpath = vmspath($self->eliminate_macros($path));
}
else {
$fixedpath = vmsify($self->eliminate_macros($path));
}
}
elsif ((($prefix,$name) = ($path =~ m#^\$\(([^\)]+)\)(.+)#s)) && $self->{$prefix}) {
my($vmspre) = $self->eliminate_macros("\$($prefix)");
# is it a dir or just a name?
$vmspre = ($vmspre =~ m|/| or $prefix =~ /DIR\Z(?!\n)/) ? vmspath($vmspre) : '';
$fixedpath = ($vmspre ? $vmspre : $self->{$prefix}) . $name;
$fixedpath = vmspath($fixedpath) if $force_path;
}
else {
$fixedpath = $path;
$fixedpath = vmspath($fixedpath) if $force_path;
}
# No hints, so we try to guess
if (!defined($force_path) and $fixedpath !~ /[:>(.\]]/) {
$fixedpath = vmspath($fixedpath) if -d $fixedpath;
}
# Trim off root dirname if it's had other dirs inserted in front of it.
$fixedpath =~ s/\.000000([\]>])/$1/;
# Special case for VMS absolute directory specs: these will have had device
# prepended during trip through Unix syntax in eliminate_macros(), since
# Unix syntax has no way to express "absolute from the top of this device's
# directory tree".
if ($path =~ /^[\[>][^.\-]/) { $fixedpath =~ s/^[^\[<]+//; }
return $fixedpath;
}
=item os_flavor
VMS is VMS.
=cut
sub os_flavor {
return('VMS');
}
=item is_make_type (override)
None of the make types being checked for is viable on VMS,
plus our $self->{MAKE} is an unexpanded (and unexpandable)
macro whose value is known only to the make utility itself.
=cut
sub is_make_type {
my($self, $type) = @_;
return 0;
}
=back
=head1 AUTHOR
Original author Charles Bailey F<bailey@newman.upenn.edu>
Maintained by Michael G Schwern F<schwern@pobox.com>
See L<ExtUtils::MakeMaker> for patching and contact information.
=cut
1;
| 29.321531 | 150 | 0.586143 |
ed3cf38f3eda56a42bc25a2aa8764b85d43f5831 | 1,797 | pl | Perl | simulations/DTN_one/toolkit/transimsParser.pl | suryakiran-kanna/Delay-tolerant-networks | cfbb0c383a222fe04853a3093867bcad58ca1e89 | [
"Apache-2.0"
]
| 1 | 2020-08-09T16:25:41.000Z | 2020-08-09T16:25:41.000Z | simulations/DTN_one/toolkit/transimsParser.pl | suryakiran-kanna/Delay-tolerant-networks | cfbb0c383a222fe04853a3093867bcad58ca1e89 | [
"Apache-2.0"
]
| null | null | null | simulations/DTN_one/toolkit/transimsParser.pl | suryakiran-kanna/Delay-tolerant-networks | cfbb0c383a222fe04853a3093867bcad58ca1e89 | [
"Apache-2.0"
]
| null | null | null | #! /usr/local/bin/perl
package Toolkit;
# Transims vehicle shapshot file parser
use strict;
use warnings;
use Common; # parseArgs and debug methods
parseArgs("Transims vehicle shapshot parser");
# (minTime, maxTime, minX, maxX, minY, maxY, minZ, maxZ)
my @limits;
my %initLocs;
my $header = <INFILE>;
my $firstLine = <INFILE>;
my ($x, $y, $z, $time, $id) = parseLine($firstLine);
initMinMax(0,$time);
initMinMax(1, $x);
initMinMax(2, $y);
initMinMax(3, $z);
$initLocs{$id} = [$x, $y, $z];
while(<INFILE>) {
($x, $y, $z, $time, $id) = parseLine($_);
if (not defined($x)) {
debug("Invalid line '$_'");
next;
}
$initLocs{$id} = [$x, $y, $z] unless $initLocs{$id};
upMinMax(0,$time);
upMinMax(1,$x);
upMinMax(2,$y);
upMinMax(3,$z);
}
print OUTFILE "@limits\n";
seek(INFILE,0,0) or die "Can't seek input file";
$header = <INFILE>;
while ( my ($k, $v) = each %initLocs) {
print OUTFILE "$limits[0] $k @$v\n";
}
while (<INFILE>) {
my ($x, $y, $z, $time, $id) = parseLine($_);
next unless defined $x;
if ($time > $limits[0]) { # min time location are already there
print OUTFILE "$time $id $x $y $z\n";
}
}
sub initMinMax {
my $index = shift;
my $val = shift;
$index *= 2;
$limits[$index] = $val;
$limits[$index+1] = $val;
}
sub upMinMax {
my $index = shift;
my $val = shift;
$index *= 2;
if ($val < $limits[$index]) { # update min
#print "up min at $index $limits[$index] to $val\n";
$limits[$index] = $val;
}
if ($val > $limits[$index+1]) { # update max
#print "up max at $index $limits[$index+1] to $val\n";
$limits[$index+1] = $val;
}
}
sub parseLine {
my $line = shift;
my @data = split(/\s+/, $line);
return ($data[4],$data[9],$data[5],$data[11], $data[3]);
}
| 20.191011 | 67 | 0.568169 |
ed341264fe74ff222a2f460e80a2fc8b7ff97d76 | 1,189 | pm | Perl | src/GaIA/pkgs/perl/ActivePerl-5.8.7.815-i686-linux-2.2.17-gcc-211909/perl/lib/site_perl/5.8.7/Archive/Zip/MockFileHandle.pm | uninth/UNItools | c8b1fbfd5d3753b5b14fa19033e39737dedefc00 | [
"BSD-3-Clause"
]
| null | null | null | src/GaIA/pkgs/perl/ActivePerl-5.8.7.815-i686-linux-2.2.17-gcc-211909/perl/lib/site_perl/5.8.7/Archive/Zip/MockFileHandle.pm | uninth/UNItools | c8b1fbfd5d3753b5b14fa19033e39737dedefc00 | [
"BSD-3-Clause"
]
| null | null | null | src/GaIA/pkgs/perl/ActivePerl-5.8.7.815-i686-linux-2.2.17-gcc-211909/perl/lib/site_perl/5.8.7/Archive/Zip/MockFileHandle.pm | uninth/UNItools | c8b1fbfd5d3753b5b14fa19033e39737dedefc00 | [
"BSD-3-Clause"
]
| 1 | 2021-06-08T15:59:26.000Z | 2021-06-08T15:59:26.000Z | # Output file handle that calls a custom write routine
# Ned Konz, March 2000
# This is provided to help with writing zip files
# when you have to process them a chunk at a time.
#
# See the examples.
#
# $Revision: 1.4 $
use strict;
package Archive::Zip::MockFileHandle;
sub new
{
my $class = shift || __PACKAGE__;
$class = ref($class) || $class;
my $self = bless( {
'position' => 0,
'size' => 0
}, $class );
return $self;
}
sub eof
{
my $self = shift;
return $self->{'position'} >= $self->{'size'};
}
# Copy given buffer to me
sub print
{
my $self = shift;
my $bytes = join('', @_);
my $bytesWritten = $self->writeHook($bytes);
if ($self->{'position'} + $bytesWritten > $self->{'size'})
{
$self->{'size'} = $self->{'position'} + $bytesWritten
}
$self->{'position'} += $bytesWritten;
return $bytesWritten;
}
# Called on each write.
# Override in subclasses.
# Return number of bytes written (0 on error).
sub writeHook
{
my $self = shift;
my $bytes = shift;
return length($bytes);
}
sub binmode { 1 }
sub close { 1 }
sub clearerr { 1 }
# I'm write-only!
sub read { 0 }
sub tell { return shift->{'position'} }
sub opened { 1 }
# vim: ts=4 sw=4
1;
| 17.231884 | 59 | 0.622372 |
ed359868892ed19bdd7c077807d44f315f7121ed | 706 | pl | Perl | xclib/examples/convert_format.pl | sushantsondhi/pyxclib | ecdfab6b72f9a02892eee617f45bef73c928ca81 | [
"MIT"
]
| 4 | 2019-07-11T14:43:22.000Z | 2019-08-08T19:12:53.000Z | xclib/examples/convert_format.pl | sushantsondhi/pyxclib | ecdfab6b72f9a02892eee617f45bef73c928ca81 | [
"MIT"
]
| null | null | null | xclib/examples/convert_format.pl | sushantsondhi/pyxclib | ecdfab6b72f9a02892eee617f45bef73c928ca81 | [
"MIT"
]
| null | null | null | my $inpfile;
open($inpfile,"<",$ARGV[0]);
my $ftfile;
open($ftfile,">",$ARGV[1]);
my $lblfile;
open($lblfile,">",$ARGV[2]);
my $ctr = 0;
while(<$inpfile>)
{
chomp($_);
if($ctr==0)
{
my @items = split(" ",$_);
$num_inst = $items[0];
$num_ft = $items[1];
$num_lbl = $items[2];
print $ftfile "$num_inst $num_ft\n";
print $lblfile "$num_inst $num_lbl\n";
}
else
{
my @items = split(" ",$_,2);
if($_ =~ /^ .*/)
{
print $lblfile "\n";
print $ftfile $items[0]."\n";
}
else
{
my @lbls = split(",",$items[0]);
print $lblfile join(" ",map {"$_:1"} @lbls)."\n";
print $ftfile $items[1]."\n";
}
}
$ctr++;
}
close($inpfile);
close($ftfile);
close($lblfile); | 15.021277 | 52 | 0.515581 |
73ec0e19351019057fa70ada6bef1d26ba4e3a6b | 4,191 | pm | Perl | crs-scripts/lib/CRS/Tracker/Client.pm | derchrisuk/crs-scripts | a264b5692e6bcdb649df1859a14290aeb9da0ad7 | [
"Apache-2.0"
]
| 3 | 2017-11-11T16:54:45.000Z | 2017-12-15T16:25:18.000Z | crs-scripts/lib/CRS/Tracker/Client.pm | derchrisuk/crs-scripts | a264b5692e6bcdb649df1859a14290aeb9da0ad7 | [
"Apache-2.0"
]
| 6 | 2017-11-12T11:40:16.000Z | 2020-08-05T15:42:24.000Z | crs-scripts/lib/CRS/Tracker/Client.pm | derchrisuk/crs-scripts | a264b5692e6bcdb649df1859a14290aeb9da0ad7 | [
"Apache-2.0"
]
| 4 | 2017-12-12T16:42:30.000Z | 2020-10-19T04:03:53.000Z | # CRS::Tracker::Client
#
# Copyright (c) 2017 Peter Große <pegro@fem-net.de>, all rights reserved
# This program is free software; you can redistribute it and/or
# modify it under the same terms as Perl itself.
package CRS::Tracker::Client;
=head1 NAME
CRS::Tracker::Client - Client for interacting with the Congress Recording System Tracker via XML-RPC
=head1 VERSION
Version 0.5
=cut
our $VERSION = '0.5';
=head1 SYNOPSIS
Generic usage
use CRS::Tracker::Client;
my $rpc = CRS::Tracker::Client->new( $uri, $worker_group_token, $secret );
Call a remote method
my $states = $rpc->getVersion();
=head1 DESCRIPTION
CRS::Tracker::Client is a library for interacting with the CRS Tracker via XML-RPC with automatic encoding
of all arguments
=head1 METHODS
=head2 new ($url, $worker_group_token, $secret)
Create CRS::Tracker::Client object.
=cut
use strict;
use warnings;
use XML::RPC::Fast;
use vars qw($AUTOLOAD);
use Data::Dumper;
use Net::Domain qw(hostname hostfqdn);
use Digest::SHA qw(hmac_sha256_hex);
use URI::Escape qw(uri_escape);
use IO::Socket::SSL;
use URI::Escape;
use constant PREFIX => 'C3TT.';
# Number of repetitions to perform when the communication with the tracker raises an exception
# E.g.: the client will wait 10s after a fail before retrying (10 * 6 = 1 minute)
use constant REMOTE_CALL_TRIES => 180;
use constant REMOTE_CALL_SLEEP => 10;
sub new {
my $prog = shift;
my $self;
$self->{url} = shift;
$self->{token} = shift;
$self->{secret} = shift;
if (!defined($self->{url})) {
if (!defined($ENV{'CRS_TRACKER'})) {
die "no credentials given as parameter or via environment!";
}
($self->{secret}, $self->{token}, $self->{url}) = ($ENV{'CRS_SECRET'}, $ENV{'CRS_TOKEN'}, $ENV{'CRS_TRACKER'});
}
# create remote handle
$self->{remote} = XML::RPC::Fast->new($self->{url}.'?group='.$self->{token}.'&hostname='.hostfqdn, ua => 'LWP', timeout => 30);
bless $self;
my $version = $self->getVersion();
die "be future compatible - tracker RPC API version is $version!\nI'd be more happy with '4.0'.\n" unless ($version eq '4.0');
return $self;
}
sub AUTOLOAD {
my $name = $AUTOLOAD;
$name =~ s/.*://;
if($name eq 'DESTROY') {
return;
}
my $self = shift;
if(!defined $self->{remote}) {
print "No RPC available.";
exit 1;
}
my @args = @_;
#####################
# generate signature
#####################
# assemble static part of signature arguments
# 1. URL 2. method name 3. worker group token 4. hostname
my @signature_args = (uri_escape_utf8($self->{url}), PREFIX.$name, $self->{token}, hostfqdn);
# include method arguments if any given
if(defined $args[0]) {
foreach my $arg (@args) {
push(@signature_args, (ref($arg) eq 'HASH') ? hash_serialize($arg) : uri_escape_utf8($arg));
}
}
# generate hash over url escaped line containing a concatenation of above signature arguments
my $signature = hmac_sha256_hex(join('%26',@signature_args), $self->{secret});
# add signature as additional parameter
push(@args,$signature);
##############
# remote call
##############
my $nLoop = REMOTE_CALL_TRIES;
while($nLoop-- > 0) {
my $r;
eval {
$r = $self->{remote}->call(PREFIX.$name, @args);
};
if($@) {
print "\n!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!\n";
print "$@";
print "!!!!!!!!!!!!!! sleeping ".REMOTE_CALL_SLEEP." s !!!!!!!!!!!!!!\n";
sleep(REMOTE_CALL_SLEEP);
print "\nretrying $nLoop more times, enabling SSL debugging";
$Net::SSLeay::trace = 2;
}
else {
$Net::SSLeay::trace = 0;
return $r;
}
}
print "\ngiving up with\n";
die $@
}
sub hash_serialize {
my($data) = @_;
my $result = "";
for my $key (keys %$data) {
$result .= '&' if length $result;
$result .= '%5B' . uri_escape_utf8($key) . '%5D=' . uri_escape_utf8($data->{$key});
}
return $result;
}
1;
| 24.652941 | 131 | 0.581723 |
ed06f61bfe3d42b132c4975c9ecea6d4e8005506 | 1,963 | pm | Perl | lib/App/Git/Workflow/Command/ResetTo.pm | ivanwills/git-workflow-tools | db38de0eb80924a469994c627e77fc8e5232c868 | [
"Artistic-1.0"
]
| 4 | 2017-01-03T20:19:39.000Z | 2021-09-02T13:54:40.000Z | lib/App/Git/Workflow/Command/ResetTo.pm | ivanwills/git-workflow-tools | db38de0eb80924a469994c627e77fc8e5232c868 | [
"Artistic-1.0"
]
| 6 | 2015-02-01T16:08:26.000Z | 2021-01-03T08:09:56.000Z | lib/App/Git/Workflow/Command/ResetTo.pm | ivanwills/git-workflow-tools | db38de0eb80924a469994c627e77fc8e5232c868 | [
"Artistic-1.0"
]
| 2 | 2015-06-25T04:28:49.000Z | 2021-01-02T21:04:19.000Z | package App::Git::Workflow::Command::ResetTo;
# Created on: 2014-03-11 20:58:59
# Create by: Ivan Wills
# $Id$
# $Revision$, $HeadURL$, $Date$
# $Revision$, $Source$, $Date$
use strict;
use warnings;
use version;
use English qw/ -no_match_vars /;
use Term::ANSIColor qw/colored/;
use App::Git::Workflow;
use App::Git::Workflow::Command qw/get_options/;
our $VERSION = version->new(1.1.15);
our $workflow = App::Git::Workflow->new;
our ($name) = $PROGRAM_NAME =~ m{^.*/(.*?)$}mxs;
our %option;
sub run {
get_options(
\%option,
'colour|color|c',
'insensitive|i',
);
}
1;
__DATA__
=head1 NAME
git-reset-to - Help reset-to many commits
=head1 VERSION
This documentation refers to git-reset-to version 1.1.15
=head1 SYNOPSIS
git-reset-to [option]
OPTIONS:
-v --verbose Show more detailed option
--version Prints the version information
--help Prints this help information
--man Prints the full documentation for git-reset-to
=head1 DESCRIPTION
Short hand for running
C<git commit --reset-to>
Over more than one commit in the history
=head1 SUBROUTINES/METHODS
=head2 C<run ()>
Executes the git workflow command
=head1 DIAGNOSTICS
=head1 CONFIGURATION AND ENVIRONMENT
=head1 DEPENDENCIES
=head1 INCOMPATIBILITIES
=head1 BUGS AND LIMITATIONS
There are no known bugs in this module.
Please report problems to Ivan Wills (ivan.wills@gmail.com).
Patches are welcome.
=head1 AUTHOR
Ivan Wills - (ivan.wills@gmail.com)
=head1 LICENSE AND COPYRIGHT
Copyright (c) 2014 Ivan Wills (14 Mullion Close, Hornsby Heights, NSW Australia 2077).
All rights reserved.
This module is free software; you can redistribute it and/or modify it under
the same terms as Perl itself. See L<perlartistic>. This program is
distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY;
without even the implied warranty of MERCHANTABILITY or FITNESS FOR A
PARTICULAR PURPOSE.
=cut
| 19.63 | 86 | 0.717269 |
73f0b61c96307b5aad2795e9f8377276cc794ecc | 473,320 | pm | Perl | worker/deps/openssl/config/archs/darwin-i386-cc/no-asm/configdata.pm | sandeepk-e/mediasoup | 110e4aa97b5168b0c52947aaa1633787e6ee8783 | [
"0BSD"
]
| 6 | 2021-02-02T19:56:10.000Z | 2021-07-12T14:54:52.000Z | worker/deps/openssl/config/archs/darwin-i386-cc/no-asm/configdata.pm | sandeepk-e/mediasoup | 110e4aa97b5168b0c52947aaa1633787e6ee8783 | [
"0BSD"
]
| 116 | 2021-05-29T16:32:51.000Z | 2021-08-13T16:05:29.000Z | worker/deps/openssl/config/archs/darwin-i386-cc/no-asm/configdata.pm | sandeepk-e/mediasoup | 110e4aa97b5168b0c52947aaa1633787e6ee8783 | [
"0BSD"
]
| 3 | 2021-04-09T03:13:47.000Z | 2021-04-10T13:52:32.000Z | #! /usr/bin/env perl
package configdata;
use strict;
use warnings;
use Exporter;
#use vars qw(@ISA @EXPORT);
our @ISA = qw(Exporter);
our @EXPORT = qw(%config %target %disabled %withargs %unified_info @disablables);
our %config = (
AR => "ar",
ARFLAGS => [ "r" ],
CC => "cc",
CFLAGS => [ "-O3 -fomit-frame-pointer" ],
CPPDEFINES => [ ],
CPPFLAGS => [ ],
CPPINCLUDES => [ ],
CXXFLAGS => [ ],
HASHBANGPERL => "/usr/bin/env perl",
LDFLAGS => [ ],
LDLIBS => [ ],
PERL => "/usr/bin/perl",
RANLIB => "ranlib -c",
RC => "windres",
RCFLAGS => [ ],
b32 => "1",
b64 => "0",
b64l => "0",
bn_ll => "1",
build_file => "Makefile",
build_file_templates => [ "Configurations/common0.tmpl", "Configurations/unix-Makefile.tmpl", "Configurations/common.tmpl" ],
build_infos => [ "./build.info", "crypto/build.info", "ssl/build.info", "engines/build.info", "apps/build.info", "test/build.info", "util/build.info", "tools/build.info", "fuzz/build.info", "crypto/objects/build.info", "crypto/md4/build.info", "crypto/md5/build.info", "crypto/sha/build.info", "crypto/mdc2/build.info", "crypto/hmac/build.info", "crypto/ripemd/build.info", "crypto/whrlpool/build.info", "crypto/poly1305/build.info", "crypto/blake2/build.info", "crypto/siphash/build.info", "crypto/sm3/build.info", "crypto/des/build.info", "crypto/aes/build.info", "crypto/rc2/build.info", "crypto/rc4/build.info", "crypto/idea/build.info", "crypto/aria/build.info", "crypto/bf/build.info", "crypto/cast/build.info", "crypto/camellia/build.info", "crypto/seed/build.info", "crypto/sm4/build.info", "crypto/chacha/build.info", "crypto/modes/build.info", "crypto/bn/build.info", "crypto/ec/build.info", "crypto/rsa/build.info", "crypto/dsa/build.info", "crypto/dh/build.info", "crypto/sm2/build.info", "crypto/dso/build.info", "crypto/engine/build.info", "crypto/buffer/build.info", "crypto/bio/build.info", "crypto/stack/build.info", "crypto/lhash/build.info", "crypto/rand/build.info", "crypto/err/build.info", "crypto/evp/build.info", "crypto/asn1/build.info", "crypto/pem/build.info", "crypto/x509/build.info", "crypto/x509v3/build.info", "crypto/conf/build.info", "crypto/txt_db/build.info", "crypto/pkcs7/build.info", "crypto/pkcs12/build.info", "crypto/ocsp/build.info", "crypto/ui/build.info", "crypto/cms/build.info", "crypto/ts/build.info", "crypto/srp/build.info", "crypto/cmac/build.info", "crypto/ct/build.info", "crypto/async/build.info", "crypto/kdf/build.info", "crypto/store/build.info", "test/ossl_shim/build.info" ],
build_type => "release",
builddir => ".",
cflags => [ ],
conf_files => [ "Configurations/00-base-templates.conf", "Configurations/10-main.conf" ],
cppflags => [ ],
cxxflags => [ ],
defines => [ "NDEBUG" ],
dirs => [ "crypto", "ssl", "engines", "apps", "test", "util", "tools", "fuzz" ],
dynamic_engines => "0",
engdirs => [ ],
ex_libs => [ ],
export_var_as_fn => "0",
includes => [ ],
lflags => [ ],
lib_defines => [ "OPENSSL_PIC" ],
libdir => "",
major => "1",
makedepprog => "\$(CROSS_COMPILE)cc",
minor => "1.1",
openssl_algorithm_defines => [ "OPENSSL_NO_COMP", "OPENSSL_NO_MD2", "OPENSSL_NO_RC5" ],
openssl_api_defines => [ ],
openssl_other_defines => [ "OPENSSL_RAND_SEED_OS", "OPENSSL_NO_AFALGENG", "OPENSSL_NO_ASAN", "OPENSSL_NO_ASM", "OPENSSL_NO_CRYPTO_MDEBUG", "OPENSSL_NO_CRYPTO_MDEBUG_BACKTRACE", "OPENSSL_NO_DEVCRYPTOENG", "OPENSSL_NO_EC_NISTP_64_GCC_128", "OPENSSL_NO_EGD", "OPENSSL_NO_EXTERNAL_TESTS", "OPENSSL_NO_FUZZ_AFL", "OPENSSL_NO_FUZZ_LIBFUZZER", "OPENSSL_NO_HEARTBEATS", "OPENSSL_NO_MSAN", "OPENSSL_NO_SCTP", "OPENSSL_NO_SSL3", "OPENSSL_NO_SSL3_METHOD", "OPENSSL_NO_UBSAN", "OPENSSL_NO_UNIT_TEST", "OPENSSL_NO_WEAK_SSL_CIPHERS", "OPENSSL_NO_DYNAMIC_ENGINE" ],
openssl_sys_defines => [ "OPENSSL_SYS_MACOSX" ],
openssl_thread_defines => [ "OPENSSL_THREADS" ],
openssldir => "",
options => "enable-ssl-trace no-afalgeng no-asan no-asm no-buildtest-c++ no-comp no-crypto-mdebug no-crypto-mdebug-backtrace no-devcryptoeng no-dynamic-engine no-ec_nistp_64_gcc_128 no-egd no-external-tests no-fuzz-afl no-fuzz-libfuzzer no-heartbeats no-md2 no-msan no-rc5 no-sctp no-shared no-ssl3 no-ssl3-method no-ubsan no-unit-test no-weak-ssl-ciphers no-zlib no-zlib-dynamic",
perl_archname => "x86_64-linux-gnu-thread-multi",
perl_cmd => "/usr/bin/perl",
perl_version => "5.30.0",
perlargv => [ "no-comp", "no-shared", "no-afalgeng", "enable-ssl-trace", "no-asm", "darwin-i386-cc" ],
perlenv => {
"AR" => undef,
"ARFLAGS" => undef,
"AS" => undef,
"ASFLAGS" => undef,
"BUILDFILE" => undef,
"CC" => undef,
"CFLAGS" => undef,
"CPP" => undef,
"CPPDEFINES" => undef,
"CPPFLAGS" => undef,
"CPPINCLUDES" => undef,
"CROSS_COMPILE" => undef,
"CXX" => undef,
"CXXFLAGS" => undef,
"HASHBANGPERL" => undef,
"LD" => undef,
"LDFLAGS" => undef,
"LDLIBS" => undef,
"MT" => undef,
"MTFLAGS" => undef,
"OPENSSL_LOCAL_CONFIG_DIR" => undef,
"PERL" => undef,
"RANLIB" => undef,
"RC" => undef,
"RCFLAGS" => undef,
"RM" => undef,
"WINDRES" => undef,
"__CNF_CFLAGS" => undef,
"__CNF_CPPDEFINES" => undef,
"__CNF_CPPFLAGS" => undef,
"__CNF_CPPINCLUDES" => undef,
"__CNF_CXXFLAGS" => undef,
"__CNF_LDFLAGS" => undef,
"__CNF_LDLIBS" => undef,
},
prefix => "",
processor => "",
rc4_int => "unsigned int",
sdirs => [ "objects", "md4", "md5", "sha", "mdc2", "hmac", "ripemd", "whrlpool", "poly1305", "blake2", "siphash", "sm3", "des", "aes", "rc2", "rc4", "idea", "aria", "bf", "cast", "camellia", "seed", "sm4", "chacha", "modes", "bn", "ec", "rsa", "dsa", "dh", "sm2", "dso", "engine", "buffer", "bio", "stack", "lhash", "rand", "err", "evp", "asn1", "pem", "x509", "x509v3", "conf", "txt_db", "pkcs7", "pkcs12", "ocsp", "ui", "cms", "ts", "srp", "cmac", "ct", "async", "kdf", "store" ],
shlib_major => "81",
shlib_minor => "1.1",
shlib_version_history => "",
shlib_version_number => "81.1.1",
sourcedir => ".",
target => "darwin-i386-cc",
tdirs => [ "ossl_shim" ],
version => "1.1.1k+quic",
version_num => "0x101010bfL",
);
our %target = (
AR => "ar",
ARFLAGS => "r",
CC => "cc",
CFLAGS => "-O3 -fomit-frame-pointer",
HASHBANGPERL => "/usr/bin/env perl",
RANLIB => "ranlib -c",
RC => "windres",
_conf_fname_int => [ "Configurations/00-base-templates.conf", "Configurations/00-base-templates.conf", "Configurations/10-main.conf", "Configurations/10-main.conf", "Configurations/shared-info.pl" ],
aes_asm_src => "aes_core.c aes_cbc.c",
aes_obj => "aes_core.o aes_cbc.o",
apps_aux_src => "",
apps_init_src => "",
apps_obj => "",
bf_asm_src => "bf_enc.c",
bf_obj => "bf_enc.o",
bn_asm_src => "bn_asm.c",
bn_obj => "bn_asm.o",
bn_ops => "BN_LLONG RC4_INT",
build_file => "Makefile",
build_scheme => [ "unified", "unix" ],
cast_asm_src => "c_enc.c",
cast_obj => "c_enc.o",
cflags => "-arch i386",
chacha_asm_src => "chacha_enc.c",
chacha_obj => "chacha_enc.o",
cmll_asm_src => "camellia.c cmll_misc.c cmll_cbc.c",
cmll_obj => "camellia.o cmll_misc.o cmll_cbc.o",
cppflags => "-D_REENTRANT",
cpuid_asm_src => "mem_clr.c",
cpuid_obj => "mem_clr.o",
defines => [ ],
des_asm_src => "des_enc.c fcrypt_b.c",
des_obj => "des_enc.o fcrypt_b.o",
disable => [ ],
dso_extension => ".dylib",
dso_scheme => "dlfcn",
ec_asm_src => "",
ec_obj => "",
enable => [ ],
exe_extension => "",
includes => [ ],
keccak1600_asm_src => "keccak1600.c",
keccak1600_obj => "keccak1600.o",
lflags => "-Wl,-search_paths_first",
lib_cflags => "",
lib_cppflags => "-DL_ENDIAN",
lib_defines => [ ],
md5_asm_src => "",
md5_obj => "",
modes_asm_src => "",
modes_obj => "",
module_cflags => "-fPIC",
module_cxxflags => "",
module_ldflags => "-bundle",
padlock_asm_src => "",
padlock_obj => "",
perlasm_scheme => "macosx",
poly1305_asm_src => "",
poly1305_obj => "",
rc4_asm_src => "rc4_enc.c rc4_skey.c",
rc4_obj => "rc4_enc.o rc4_skey.o",
rc5_asm_src => "rc5_enc.c",
rc5_obj => "rc5_enc.o",
rmd160_asm_src => "",
rmd160_obj => "",
shared_cflag => "-fPIC",
shared_defines => [ ],
shared_extension => ".\$(SHLIB_VERSION_NUMBER).dylib",
shared_extension_simple => ".dylib",
shared_ldflag => "-dynamiclib -current_version \$(SHLIB_VERSION_NUMBER) -compatibility_version \$(SHLIB_VERSION_NUMBER)",
shared_rcflag => "",
shared_sonameflag => "-install_name \$(INSTALLTOP)/\$(LIBDIR)/",
shared_target => "darwin-shared",
sys_id => "MACOSX",
template => "1",
thread_defines => [ ],
thread_scheme => "pthreads",
unistd => "<unistd.h>",
uplink_aux_src => "",
uplink_obj => "",
wp_asm_src => "wp_block.c",
wp_obj => "wp_block.o",
);
our %available_protocols = (
tls => [ "ssl3", "tls1", "tls1_1", "tls1_2", "tls1_3" ],
dtls => [ "dtls1", "dtls1_2" ],
);
our @disablables = (
"afalgeng",
"aria",
"asan",
"asm",
"async",
"autoalginit",
"autoerrinit",
"autoload-config",
"bf",
"blake2",
"buildtest-c\\+\\+",
"camellia",
"capieng",
"cast",
"chacha",
"cmac",
"cms",
"comp",
"crypto-mdebug",
"crypto-mdebug-backtrace",
"ct",
"deprecated",
"des",
"devcryptoeng",
"dgram",
"dh",
"dsa",
"dso",
"dtls",
"dynamic-engine",
"ec",
"ec2m",
"ecdh",
"ecdsa",
"ec_nistp_64_gcc_128",
"egd",
"engine",
"err",
"external-tests",
"filenames",
"fuzz-libfuzzer",
"fuzz-afl",
"gost",
"heartbeats",
"hw(-.+)?",
"idea",
"makedepend",
"md2",
"md4",
"mdc2",
"msan",
"multiblock",
"nextprotoneg",
"pinshared",
"ocb",
"ocsp",
"pic",
"poly1305",
"posix-io",
"psk",
"quic",
"rc2",
"rc4",
"rc5",
"rdrand",
"rfc3779",
"rmd160",
"scrypt",
"sctp",
"seed",
"shared",
"siphash",
"sm2",
"sm3",
"sm4",
"sock",
"srp",
"srtp",
"sse2",
"ssl",
"ssl-trace",
"static-engine",
"stdio",
"tests",
"threads",
"tls",
"ts",
"ubsan",
"ui-console",
"unit-test",
"whirlpool",
"weak-ssl-ciphers",
"zlib",
"zlib-dynamic",
"ssl3",
"ssl3-method",
"tls1",
"tls1-method",
"tls1_1",
"tls1_1-method",
"tls1_2",
"tls1_2-method",
"tls1_3",
"dtls1",
"dtls1-method",
"dtls1_2",
"dtls1_2-method",
);
our %disabled = (
"afalgeng" => "option",
"asan" => "default",
"asm" => "option",
"buildtest-c++" => "default",
"comp" => "option",
"crypto-mdebug" => "default",
"crypto-mdebug-backtrace" => "default",
"devcryptoeng" => "default",
"dynamic-engine" => "cascade",
"ec_nistp_64_gcc_128" => "default",
"egd" => "default",
"external-tests" => "default",
"fuzz-afl" => "default",
"fuzz-libfuzzer" => "default",
"heartbeats" => "default",
"md2" => "default",
"msan" => "default",
"rc5" => "default",
"sctp" => "default",
"shared" => "option",
"ssl3" => "default",
"ssl3-method" => "default",
"ubsan" => "default",
"unit-test" => "default",
"weak-ssl-ciphers" => "default",
"zlib" => "default",
"zlib-dynamic" => "default",
);
our %withargs = (
);
our %unified_info = (
"depends" =>
{
"" =>
[
"include/crypto/bn_conf.h",
"include/crypto/dso_conf.h",
"include/openssl/opensslconf.h",
],
"apps/asn1pars.o" =>
[
"apps/progs.h",
],
"apps/ca.o" =>
[
"apps/progs.h",
],
"apps/ciphers.o" =>
[
"apps/progs.h",
],
"apps/cms.o" =>
[
"apps/progs.h",
],
"apps/crl.o" =>
[
"apps/progs.h",
],
"apps/crl2p7.o" =>
[
"apps/progs.h",
],
"apps/dgst.o" =>
[
"apps/progs.h",
],
"apps/dhparam.o" =>
[
"apps/progs.h",
],
"apps/dsa.o" =>
[
"apps/progs.h",
],
"apps/dsaparam.o" =>
[
"apps/progs.h",
],
"apps/ec.o" =>
[
"apps/progs.h",
],
"apps/ecparam.o" =>
[
"apps/progs.h",
],
"apps/enc.o" =>
[
"apps/progs.h",
],
"apps/engine.o" =>
[
"apps/progs.h",
],
"apps/errstr.o" =>
[
"apps/progs.h",
],
"apps/gendsa.o" =>
[
"apps/progs.h",
],
"apps/genpkey.o" =>
[
"apps/progs.h",
],
"apps/genrsa.o" =>
[
"apps/progs.h",
],
"apps/nseq.o" =>
[
"apps/progs.h",
],
"apps/ocsp.o" =>
[
"apps/progs.h",
],
"apps/openssl" =>
[
"apps/libapps.a",
"libssl",
],
"apps/openssl.o" =>
[
"apps/progs.h",
],
"apps/passwd.o" =>
[
"apps/progs.h",
],
"apps/pkcs12.o" =>
[
"apps/progs.h",
],
"apps/pkcs7.o" =>
[
"apps/progs.h",
],
"apps/pkcs8.o" =>
[
"apps/progs.h",
],
"apps/pkey.o" =>
[
"apps/progs.h",
],
"apps/pkeyparam.o" =>
[
"apps/progs.h",
],
"apps/pkeyutl.o" =>
[
"apps/progs.h",
],
"apps/prime.o" =>
[
"apps/progs.h",
],
"apps/progs.h" =>
[
"configdata.pm",
],
"apps/rand.o" =>
[
"apps/progs.h",
],
"apps/rehash.o" =>
[
"apps/progs.h",
],
"apps/req.o" =>
[
"apps/progs.h",
],
"apps/rsa.o" =>
[
"apps/progs.h",
],
"apps/rsautl.o" =>
[
"apps/progs.h",
],
"apps/s_client.o" =>
[
"apps/progs.h",
],
"apps/s_server.o" =>
[
"apps/progs.h",
],
"apps/s_time.o" =>
[
"apps/progs.h",
],
"apps/sess_id.o" =>
[
"apps/progs.h",
],
"apps/smime.o" =>
[
"apps/progs.h",
],
"apps/speed.o" =>
[
"apps/progs.h",
],
"apps/spkac.o" =>
[
"apps/progs.h",
],
"apps/srp.o" =>
[
"apps/progs.h",
],
"apps/storeutl.o" =>
[
"apps/progs.h",
],
"apps/ts.o" =>
[
"apps/progs.h",
],
"apps/verify.o" =>
[
"apps/progs.h",
],
"apps/version.o" =>
[
"apps/progs.h",
],
"apps/x509.o" =>
[
"apps/progs.h",
],
"crypto/aes/aes-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/aes/aesni-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/aes/aest4-sparcv9.S" =>
[
"crypto/perlasm/sparcv9_modes.pl",
],
"crypto/aes/vpaes-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/bf/bf-586.s" =>
[
"crypto/perlasm/cbc.pl",
"crypto/perlasm/x86asm.pl",
],
"crypto/bn/bn-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/bn/co-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/bn/x86-gf2m.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/bn/x86-mont.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/buildinf.h" =>
[
"configdata.pm",
],
"crypto/camellia/cmll-x86.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/camellia/cmllt4-sparcv9.S" =>
[
"crypto/perlasm/sparcv9_modes.pl",
],
"crypto/cast/cast-586.s" =>
[
"crypto/perlasm/cbc.pl",
"crypto/perlasm/x86asm.pl",
],
"crypto/cversion.o" =>
[
"crypto/buildinf.h",
],
"crypto/des/crypt586.s" =>
[
"crypto/perlasm/cbc.pl",
"crypto/perlasm/x86asm.pl",
],
"crypto/des/des-586.s" =>
[
"crypto/perlasm/cbc.pl",
"crypto/perlasm/x86asm.pl",
],
"crypto/rc4/rc4-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/ripemd/rmd-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/sha/sha1-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/sha/sha256-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/sha/sha512-586.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/whrlpool/wp-mmx.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"crypto/x86cpuid.s" =>
[
"crypto/perlasm/x86asm.pl",
],
"fuzz/asn1-test" =>
[
"libcrypto",
"libssl",
],
"fuzz/asn1parse-test" =>
[
"libcrypto",
],
"fuzz/bignum-test" =>
[
"libcrypto",
],
"fuzz/bndiv-test" =>
[
"libcrypto",
],
"fuzz/client-test" =>
[
"libcrypto",
"libssl",
],
"fuzz/cms-test" =>
[
"libcrypto",
],
"fuzz/conf-test" =>
[
"libcrypto",
],
"fuzz/crl-test" =>
[
"libcrypto",
],
"fuzz/ct-test" =>
[
"libcrypto",
],
"fuzz/server-test" =>
[
"libcrypto",
"libssl",
],
"fuzz/x509-test" =>
[
"libcrypto",
],
"include/crypto/bn_conf.h" =>
[
"configdata.pm",
],
"include/crypto/dso_conf.h" =>
[
"configdata.pm",
],
"include/openssl/opensslconf.h" =>
[
"configdata.pm",
],
"libssl" =>
[
"libcrypto",
],
"test/aborttest" =>
[
"libcrypto",
],
"test/afalgtest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/asn1_decode_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/asn1_encode_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/asn1_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/asn1_string_table_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/asn1_time_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/asynciotest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/asynctest" =>
[
"libcrypto",
],
"test/bad_dtls_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/bftest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/bio_callback_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/bio_enc_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/bio_memleak_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/bioprinttest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/bntest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/buildtest_c_aes" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_asn1" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_asn1t" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_async" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_bio" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_blowfish" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_bn" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_buffer" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_camellia" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_cast" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_cmac" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_cms" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_conf" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_conf_api" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_crypto" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ct" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_des" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_dh" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_dsa" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_dtls1" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_e_os2" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ebcdic" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ec" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ecdh" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ecdsa" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_engine" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_evp" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_hmac" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_idea" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_kdf" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_lhash" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_md4" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_md5" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_mdc2" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_modes" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_obj_mac" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_objects" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ocsp" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_opensslv" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ossl_typ" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_pem" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_pem2" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_pkcs12" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_pkcs7" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_rand" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_rand_drbg" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_rc2" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_rc4" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ripemd" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_rsa" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_safestack" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_seed" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_sha" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_srp" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_srtp" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ssl" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ssl2" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_stack" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_store" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_symhacks" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_tls1" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ts" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_txt_db" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_ui" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_whrlpool" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_x509" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_x509_vfy" =>
[
"libcrypto",
"libssl",
],
"test/buildtest_c_x509v3" =>
[
"libcrypto",
"libssl",
],
"test/casttest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/chacha_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/cipher_overhead_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/cipherbytes_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/cipherlist_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/ciphername_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/clienthellotest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/cmactest" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/cmsapitest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/conf_include_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/constant_time_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/crltest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/ct_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/ctype_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/curve448_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/d2i_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/danetest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/destest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/dhtest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/drbg_cavs_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/drbgtest" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/dsa_no_digest_size_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/dsatest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/dtls_mtu_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/dtlstest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/dtlsv1listentest" =>
[
"libssl",
"test/libtestutil.a",
],
"test/ec_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/ecdsatest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/ecstresstest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/ectest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/enginetest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/errtest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/evp_extra_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/evp_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/exdatatest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/exptest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/fatalerrtest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/gmdifftest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/gosttest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/hmactest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/ideatest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/igetest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/lhash_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/libtestutil.a" =>
[
"libcrypto",
],
"test/md2test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/mdc2_internal_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/mdc2test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/memleaktest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/modes_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/ocspapitest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/packettest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/pbelutest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/pemtest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/pkey_meth_kdf_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/pkey_meth_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/poly1305_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/rc2test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/rc4test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/rc5test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/rdrand_sanitytest" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/recordlentest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/rsa_mp_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/rsa_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/sanitytest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/secmemtest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/servername_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/siphash_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/sm2_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/sm4_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/srptest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/ssl_cert_table_internal_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/ssl_ctx_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/ssl_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/ssl_test_ctx_test" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/sslapitest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/sslbuffertest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/sslcorrupttest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/ssltest_old" =>
[
"libcrypto",
"libssl",
],
"test/stack_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/sysdefaulttest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/test_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/threadstest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/time_offset_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/tls13ccstest" =>
[
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/tls13encryptiontest" =>
[
"libcrypto",
"libssl.a",
"test/libtestutil.a",
],
"test/uitest" =>
[
"apps/libapps.a",
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"test/v3ext" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/v3nametest" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/verify_extra_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/versions" =>
[
"libcrypto",
],
"test/wpackettest" =>
[
"libcrypto",
"libssl.a",
"test/libtestutil.a",
],
"test/x509_check_cert_pkey_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/x509_dup_cert_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/x509_internal_test" =>
[
"libcrypto.a",
"test/libtestutil.a",
],
"test/x509_time_test" =>
[
"libcrypto",
"test/libtestutil.a",
],
"test/x509aux" =>
[
"libcrypto",
"test/libtestutil.a",
],
},
"dirinfo" =>
{
"apps" =>
{
"products" =>
{
"bin" =>
[
"apps/openssl",
],
"lib" =>
[
"apps/libapps.a",
],
"script" =>
[
"apps/CA.pl",
"apps/tsget.pl",
],
},
},
"crypto" =>
{
"deps" =>
[
"crypto/cpt_err.o",
"crypto/cryptlib.o",
"crypto/ctype.o",
"crypto/cversion.o",
"crypto/ebcdic.o",
"crypto/ex_data.o",
"crypto/getenv.o",
"crypto/init.o",
"crypto/mem.o",
"crypto/mem_clr.o",
"crypto/mem_dbg.o",
"crypto/mem_sec.o",
"crypto/o_dir.o",
"crypto/o_fips.o",
"crypto/o_fopen.o",
"crypto/o_init.o",
"crypto/o_str.o",
"crypto/o_time.o",
"crypto/threads_none.o",
"crypto/threads_pthread.o",
"crypto/threads_win.o",
"crypto/uid.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/aes" =>
{
"deps" =>
[
"crypto/aes/aes_cbc.o",
"crypto/aes/aes_cfb.o",
"crypto/aes/aes_core.o",
"crypto/aes/aes_ecb.o",
"crypto/aes/aes_ige.o",
"crypto/aes/aes_misc.o",
"crypto/aes/aes_ofb.o",
"crypto/aes/aes_wrap.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/aria" =>
{
"deps" =>
[
"crypto/aria/aria.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/asn1" =>
{
"deps" =>
[
"crypto/asn1/a_bitstr.o",
"crypto/asn1/a_d2i_fp.o",
"crypto/asn1/a_digest.o",
"crypto/asn1/a_dup.o",
"crypto/asn1/a_gentm.o",
"crypto/asn1/a_i2d_fp.o",
"crypto/asn1/a_int.o",
"crypto/asn1/a_mbstr.o",
"crypto/asn1/a_object.o",
"crypto/asn1/a_octet.o",
"crypto/asn1/a_print.o",
"crypto/asn1/a_sign.o",
"crypto/asn1/a_strex.o",
"crypto/asn1/a_strnid.o",
"crypto/asn1/a_time.o",
"crypto/asn1/a_type.o",
"crypto/asn1/a_utctm.o",
"crypto/asn1/a_utf8.o",
"crypto/asn1/a_verify.o",
"crypto/asn1/ameth_lib.o",
"crypto/asn1/asn1_err.o",
"crypto/asn1/asn1_gen.o",
"crypto/asn1/asn1_item_list.o",
"crypto/asn1/asn1_lib.o",
"crypto/asn1/asn1_par.o",
"crypto/asn1/asn_mime.o",
"crypto/asn1/asn_moid.o",
"crypto/asn1/asn_mstbl.o",
"crypto/asn1/asn_pack.o",
"crypto/asn1/bio_asn1.o",
"crypto/asn1/bio_ndef.o",
"crypto/asn1/d2i_pr.o",
"crypto/asn1/d2i_pu.o",
"crypto/asn1/evp_asn1.o",
"crypto/asn1/f_int.o",
"crypto/asn1/f_string.o",
"crypto/asn1/i2d_pr.o",
"crypto/asn1/i2d_pu.o",
"crypto/asn1/n_pkey.o",
"crypto/asn1/nsseq.o",
"crypto/asn1/p5_pbe.o",
"crypto/asn1/p5_pbev2.o",
"crypto/asn1/p5_scrypt.o",
"crypto/asn1/p8_pkey.o",
"crypto/asn1/t_bitst.o",
"crypto/asn1/t_pkey.o",
"crypto/asn1/t_spki.o",
"crypto/asn1/tasn_dec.o",
"crypto/asn1/tasn_enc.o",
"crypto/asn1/tasn_fre.o",
"crypto/asn1/tasn_new.o",
"crypto/asn1/tasn_prn.o",
"crypto/asn1/tasn_scn.o",
"crypto/asn1/tasn_typ.o",
"crypto/asn1/tasn_utl.o",
"crypto/asn1/x_algor.o",
"crypto/asn1/x_bignum.o",
"crypto/asn1/x_info.o",
"crypto/asn1/x_int64.o",
"crypto/asn1/x_long.o",
"crypto/asn1/x_pkey.o",
"crypto/asn1/x_sig.o",
"crypto/asn1/x_spki.o",
"crypto/asn1/x_val.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/async" =>
{
"deps" =>
[
"crypto/async/async.o",
"crypto/async/async_err.o",
"crypto/async/async_wait.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/async/arch" =>
{
"deps" =>
[
"crypto/async/arch/async_null.o",
"crypto/async/arch/async_posix.o",
"crypto/async/arch/async_win.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/bf" =>
{
"deps" =>
[
"crypto/bf/bf_cfb64.o",
"crypto/bf/bf_ecb.o",
"crypto/bf/bf_enc.o",
"crypto/bf/bf_ofb64.o",
"crypto/bf/bf_skey.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/bio" =>
{
"deps" =>
[
"crypto/bio/b_addr.o",
"crypto/bio/b_dump.o",
"crypto/bio/b_print.o",
"crypto/bio/b_sock.o",
"crypto/bio/b_sock2.o",
"crypto/bio/bf_buff.o",
"crypto/bio/bf_lbuf.o",
"crypto/bio/bf_nbio.o",
"crypto/bio/bf_null.o",
"crypto/bio/bio_cb.o",
"crypto/bio/bio_err.o",
"crypto/bio/bio_lib.o",
"crypto/bio/bio_meth.o",
"crypto/bio/bss_acpt.o",
"crypto/bio/bss_bio.o",
"crypto/bio/bss_conn.o",
"crypto/bio/bss_dgram.o",
"crypto/bio/bss_fd.o",
"crypto/bio/bss_file.o",
"crypto/bio/bss_log.o",
"crypto/bio/bss_mem.o",
"crypto/bio/bss_null.o",
"crypto/bio/bss_sock.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/blake2" =>
{
"deps" =>
[
"crypto/blake2/blake2b.o",
"crypto/blake2/blake2s.o",
"crypto/blake2/m_blake2b.o",
"crypto/blake2/m_blake2s.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/bn" =>
{
"deps" =>
[
"crypto/bn/bn_add.o",
"crypto/bn/bn_asm.o",
"crypto/bn/bn_blind.o",
"crypto/bn/bn_const.o",
"crypto/bn/bn_ctx.o",
"crypto/bn/bn_depr.o",
"crypto/bn/bn_dh.o",
"crypto/bn/bn_div.o",
"crypto/bn/bn_err.o",
"crypto/bn/bn_exp.o",
"crypto/bn/bn_exp2.o",
"crypto/bn/bn_gcd.o",
"crypto/bn/bn_gf2m.o",
"crypto/bn/bn_intern.o",
"crypto/bn/bn_kron.o",
"crypto/bn/bn_lib.o",
"crypto/bn/bn_mod.o",
"crypto/bn/bn_mont.o",
"crypto/bn/bn_mpi.o",
"crypto/bn/bn_mul.o",
"crypto/bn/bn_nist.o",
"crypto/bn/bn_prime.o",
"crypto/bn/bn_print.o",
"crypto/bn/bn_rand.o",
"crypto/bn/bn_recp.o",
"crypto/bn/bn_shift.o",
"crypto/bn/bn_sqr.o",
"crypto/bn/bn_sqrt.o",
"crypto/bn/bn_srp.o",
"crypto/bn/bn_word.o",
"crypto/bn/bn_x931p.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/buffer" =>
{
"deps" =>
[
"crypto/buffer/buf_err.o",
"crypto/buffer/buffer.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/camellia" =>
{
"deps" =>
[
"crypto/camellia/camellia.o",
"crypto/camellia/cmll_cbc.o",
"crypto/camellia/cmll_cfb.o",
"crypto/camellia/cmll_ctr.o",
"crypto/camellia/cmll_ecb.o",
"crypto/camellia/cmll_misc.o",
"crypto/camellia/cmll_ofb.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/cast" =>
{
"deps" =>
[
"crypto/cast/c_cfb64.o",
"crypto/cast/c_ecb.o",
"crypto/cast/c_enc.o",
"crypto/cast/c_ofb64.o",
"crypto/cast/c_skey.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/chacha" =>
{
"deps" =>
[
"crypto/chacha/chacha_enc.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/cmac" =>
{
"deps" =>
[
"crypto/cmac/cm_ameth.o",
"crypto/cmac/cm_pmeth.o",
"crypto/cmac/cmac.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/cms" =>
{
"deps" =>
[
"crypto/cms/cms_asn1.o",
"crypto/cms/cms_att.o",
"crypto/cms/cms_cd.o",
"crypto/cms/cms_dd.o",
"crypto/cms/cms_enc.o",
"crypto/cms/cms_env.o",
"crypto/cms/cms_err.o",
"crypto/cms/cms_ess.o",
"crypto/cms/cms_io.o",
"crypto/cms/cms_kari.o",
"crypto/cms/cms_lib.o",
"crypto/cms/cms_pwri.o",
"crypto/cms/cms_sd.o",
"crypto/cms/cms_smime.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/conf" =>
{
"deps" =>
[
"crypto/conf/conf_api.o",
"crypto/conf/conf_def.o",
"crypto/conf/conf_err.o",
"crypto/conf/conf_lib.o",
"crypto/conf/conf_mall.o",
"crypto/conf/conf_mod.o",
"crypto/conf/conf_sap.o",
"crypto/conf/conf_ssl.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/ct" =>
{
"deps" =>
[
"crypto/ct/ct_b64.o",
"crypto/ct/ct_err.o",
"crypto/ct/ct_log.o",
"crypto/ct/ct_oct.o",
"crypto/ct/ct_policy.o",
"crypto/ct/ct_prn.o",
"crypto/ct/ct_sct.o",
"crypto/ct/ct_sct_ctx.o",
"crypto/ct/ct_vfy.o",
"crypto/ct/ct_x509v3.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/des" =>
{
"deps" =>
[
"crypto/des/cbc_cksm.o",
"crypto/des/cbc_enc.o",
"crypto/des/cfb64ede.o",
"crypto/des/cfb64enc.o",
"crypto/des/cfb_enc.o",
"crypto/des/des_enc.o",
"crypto/des/ecb3_enc.o",
"crypto/des/ecb_enc.o",
"crypto/des/fcrypt.o",
"crypto/des/fcrypt_b.o",
"crypto/des/ofb64ede.o",
"crypto/des/ofb64enc.o",
"crypto/des/ofb_enc.o",
"crypto/des/pcbc_enc.o",
"crypto/des/qud_cksm.o",
"crypto/des/rand_key.o",
"crypto/des/set_key.o",
"crypto/des/str2key.o",
"crypto/des/xcbc_enc.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/dh" =>
{
"deps" =>
[
"crypto/dh/dh_ameth.o",
"crypto/dh/dh_asn1.o",
"crypto/dh/dh_check.o",
"crypto/dh/dh_depr.o",
"crypto/dh/dh_err.o",
"crypto/dh/dh_gen.o",
"crypto/dh/dh_kdf.o",
"crypto/dh/dh_key.o",
"crypto/dh/dh_lib.o",
"crypto/dh/dh_meth.o",
"crypto/dh/dh_pmeth.o",
"crypto/dh/dh_prn.o",
"crypto/dh/dh_rfc5114.o",
"crypto/dh/dh_rfc7919.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/dsa" =>
{
"deps" =>
[
"crypto/dsa/dsa_ameth.o",
"crypto/dsa/dsa_asn1.o",
"crypto/dsa/dsa_depr.o",
"crypto/dsa/dsa_err.o",
"crypto/dsa/dsa_gen.o",
"crypto/dsa/dsa_key.o",
"crypto/dsa/dsa_lib.o",
"crypto/dsa/dsa_meth.o",
"crypto/dsa/dsa_ossl.o",
"crypto/dsa/dsa_pmeth.o",
"crypto/dsa/dsa_prn.o",
"crypto/dsa/dsa_sign.o",
"crypto/dsa/dsa_vrf.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/dso" =>
{
"deps" =>
[
"crypto/dso/dso_dl.o",
"crypto/dso/dso_dlfcn.o",
"crypto/dso/dso_err.o",
"crypto/dso/dso_lib.o",
"crypto/dso/dso_openssl.o",
"crypto/dso/dso_vms.o",
"crypto/dso/dso_win32.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/ec" =>
{
"deps" =>
[
"crypto/ec/curve25519.o",
"crypto/ec/ec2_oct.o",
"crypto/ec/ec2_smpl.o",
"crypto/ec/ec_ameth.o",
"crypto/ec/ec_asn1.o",
"crypto/ec/ec_check.o",
"crypto/ec/ec_curve.o",
"crypto/ec/ec_cvt.o",
"crypto/ec/ec_err.o",
"crypto/ec/ec_key.o",
"crypto/ec/ec_kmeth.o",
"crypto/ec/ec_lib.o",
"crypto/ec/ec_mult.o",
"crypto/ec/ec_oct.o",
"crypto/ec/ec_pmeth.o",
"crypto/ec/ec_print.o",
"crypto/ec/ecdh_kdf.o",
"crypto/ec/ecdh_ossl.o",
"crypto/ec/ecdsa_ossl.o",
"crypto/ec/ecdsa_sign.o",
"crypto/ec/ecdsa_vrf.o",
"crypto/ec/eck_prn.o",
"crypto/ec/ecp_mont.o",
"crypto/ec/ecp_nist.o",
"crypto/ec/ecp_nistp224.o",
"crypto/ec/ecp_nistp256.o",
"crypto/ec/ecp_nistp521.o",
"crypto/ec/ecp_nistputil.o",
"crypto/ec/ecp_oct.o",
"crypto/ec/ecp_smpl.o",
"crypto/ec/ecx_meth.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/ec/curve448" =>
{
"deps" =>
[
"crypto/ec/curve448/curve448.o",
"crypto/ec/curve448/curve448_tables.o",
"crypto/ec/curve448/eddsa.o",
"crypto/ec/curve448/f_generic.o",
"crypto/ec/curve448/scalar.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/ec/curve448/arch_32" =>
{
"deps" =>
[
"crypto/ec/curve448/arch_32/f_impl.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/engine" =>
{
"deps" =>
[
"crypto/engine/eng_all.o",
"crypto/engine/eng_cnf.o",
"crypto/engine/eng_ctrl.o",
"crypto/engine/eng_dyn.o",
"crypto/engine/eng_err.o",
"crypto/engine/eng_fat.o",
"crypto/engine/eng_init.o",
"crypto/engine/eng_lib.o",
"crypto/engine/eng_list.o",
"crypto/engine/eng_openssl.o",
"crypto/engine/eng_pkey.o",
"crypto/engine/eng_rdrand.o",
"crypto/engine/eng_table.o",
"crypto/engine/tb_asnmth.o",
"crypto/engine/tb_cipher.o",
"crypto/engine/tb_dh.o",
"crypto/engine/tb_digest.o",
"crypto/engine/tb_dsa.o",
"crypto/engine/tb_eckey.o",
"crypto/engine/tb_pkmeth.o",
"crypto/engine/tb_rand.o",
"crypto/engine/tb_rsa.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/err" =>
{
"deps" =>
[
"crypto/err/err.o",
"crypto/err/err_all.o",
"crypto/err/err_prn.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/evp" =>
{
"deps" =>
[
"crypto/evp/bio_b64.o",
"crypto/evp/bio_enc.o",
"crypto/evp/bio_md.o",
"crypto/evp/bio_ok.o",
"crypto/evp/c_allc.o",
"crypto/evp/c_alld.o",
"crypto/evp/cmeth_lib.o",
"crypto/evp/digest.o",
"crypto/evp/e_aes.o",
"crypto/evp/e_aes_cbc_hmac_sha1.o",
"crypto/evp/e_aes_cbc_hmac_sha256.o",
"crypto/evp/e_aria.o",
"crypto/evp/e_bf.o",
"crypto/evp/e_camellia.o",
"crypto/evp/e_cast.o",
"crypto/evp/e_chacha20_poly1305.o",
"crypto/evp/e_des.o",
"crypto/evp/e_des3.o",
"crypto/evp/e_idea.o",
"crypto/evp/e_null.o",
"crypto/evp/e_old.o",
"crypto/evp/e_rc2.o",
"crypto/evp/e_rc4.o",
"crypto/evp/e_rc4_hmac_md5.o",
"crypto/evp/e_rc5.o",
"crypto/evp/e_seed.o",
"crypto/evp/e_sm4.o",
"crypto/evp/e_xcbc_d.o",
"crypto/evp/encode.o",
"crypto/evp/evp_cnf.o",
"crypto/evp/evp_enc.o",
"crypto/evp/evp_err.o",
"crypto/evp/evp_key.o",
"crypto/evp/evp_lib.o",
"crypto/evp/evp_pbe.o",
"crypto/evp/evp_pkey.o",
"crypto/evp/m_md2.o",
"crypto/evp/m_md4.o",
"crypto/evp/m_md5.o",
"crypto/evp/m_md5_sha1.o",
"crypto/evp/m_mdc2.o",
"crypto/evp/m_null.o",
"crypto/evp/m_ripemd.o",
"crypto/evp/m_sha1.o",
"crypto/evp/m_sha3.o",
"crypto/evp/m_sigver.o",
"crypto/evp/m_wp.o",
"crypto/evp/names.o",
"crypto/evp/p5_crpt.o",
"crypto/evp/p5_crpt2.o",
"crypto/evp/p_dec.o",
"crypto/evp/p_enc.o",
"crypto/evp/p_lib.o",
"crypto/evp/p_open.o",
"crypto/evp/p_seal.o",
"crypto/evp/p_sign.o",
"crypto/evp/p_verify.o",
"crypto/evp/pbe_scrypt.o",
"crypto/evp/pmeth_fn.o",
"crypto/evp/pmeth_gn.o",
"crypto/evp/pmeth_lib.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/hmac" =>
{
"deps" =>
[
"crypto/hmac/hm_ameth.o",
"crypto/hmac/hm_pmeth.o",
"crypto/hmac/hmac.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/idea" =>
{
"deps" =>
[
"crypto/idea/i_cbc.o",
"crypto/idea/i_cfb64.o",
"crypto/idea/i_ecb.o",
"crypto/idea/i_ofb64.o",
"crypto/idea/i_skey.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/kdf" =>
{
"deps" =>
[
"crypto/kdf/hkdf.o",
"crypto/kdf/kdf_err.o",
"crypto/kdf/scrypt.o",
"crypto/kdf/tls1_prf.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/lhash" =>
{
"deps" =>
[
"crypto/lhash/lh_stats.o",
"crypto/lhash/lhash.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/md4" =>
{
"deps" =>
[
"crypto/md4/md4_dgst.o",
"crypto/md4/md4_one.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/md5" =>
{
"deps" =>
[
"crypto/md5/md5_dgst.o",
"crypto/md5/md5_one.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/mdc2" =>
{
"deps" =>
[
"crypto/mdc2/mdc2_one.o",
"crypto/mdc2/mdc2dgst.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/modes" =>
{
"deps" =>
[
"crypto/modes/cbc128.o",
"crypto/modes/ccm128.o",
"crypto/modes/cfb128.o",
"crypto/modes/ctr128.o",
"crypto/modes/cts128.o",
"crypto/modes/gcm128.o",
"crypto/modes/ocb128.o",
"crypto/modes/ofb128.o",
"crypto/modes/wrap128.o",
"crypto/modes/xts128.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/objects" =>
{
"deps" =>
[
"crypto/objects/o_names.o",
"crypto/objects/obj_dat.o",
"crypto/objects/obj_err.o",
"crypto/objects/obj_lib.o",
"crypto/objects/obj_xref.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/ocsp" =>
{
"deps" =>
[
"crypto/ocsp/ocsp_asn.o",
"crypto/ocsp/ocsp_cl.o",
"crypto/ocsp/ocsp_err.o",
"crypto/ocsp/ocsp_ext.o",
"crypto/ocsp/ocsp_ht.o",
"crypto/ocsp/ocsp_lib.o",
"crypto/ocsp/ocsp_prn.o",
"crypto/ocsp/ocsp_srv.o",
"crypto/ocsp/ocsp_vfy.o",
"crypto/ocsp/v3_ocsp.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/pem" =>
{
"deps" =>
[
"crypto/pem/pem_all.o",
"crypto/pem/pem_err.o",
"crypto/pem/pem_info.o",
"crypto/pem/pem_lib.o",
"crypto/pem/pem_oth.o",
"crypto/pem/pem_pk8.o",
"crypto/pem/pem_pkey.o",
"crypto/pem/pem_sign.o",
"crypto/pem/pem_x509.o",
"crypto/pem/pem_xaux.o",
"crypto/pem/pvkfmt.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/pkcs12" =>
{
"deps" =>
[
"crypto/pkcs12/p12_add.o",
"crypto/pkcs12/p12_asn.o",
"crypto/pkcs12/p12_attr.o",
"crypto/pkcs12/p12_crpt.o",
"crypto/pkcs12/p12_crt.o",
"crypto/pkcs12/p12_decr.o",
"crypto/pkcs12/p12_init.o",
"crypto/pkcs12/p12_key.o",
"crypto/pkcs12/p12_kiss.o",
"crypto/pkcs12/p12_mutl.o",
"crypto/pkcs12/p12_npas.o",
"crypto/pkcs12/p12_p8d.o",
"crypto/pkcs12/p12_p8e.o",
"crypto/pkcs12/p12_sbag.o",
"crypto/pkcs12/p12_utl.o",
"crypto/pkcs12/pk12err.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/pkcs7" =>
{
"deps" =>
[
"crypto/pkcs7/bio_pk7.o",
"crypto/pkcs7/pk7_asn1.o",
"crypto/pkcs7/pk7_attr.o",
"crypto/pkcs7/pk7_doit.o",
"crypto/pkcs7/pk7_lib.o",
"crypto/pkcs7/pk7_mime.o",
"crypto/pkcs7/pk7_smime.o",
"crypto/pkcs7/pkcs7err.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/poly1305" =>
{
"deps" =>
[
"crypto/poly1305/poly1305.o",
"crypto/poly1305/poly1305_ameth.o",
"crypto/poly1305/poly1305_pmeth.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/rand" =>
{
"deps" =>
[
"crypto/rand/drbg_ctr.o",
"crypto/rand/drbg_lib.o",
"crypto/rand/rand_egd.o",
"crypto/rand/rand_err.o",
"crypto/rand/rand_lib.o",
"crypto/rand/rand_unix.o",
"crypto/rand/rand_vms.o",
"crypto/rand/rand_win.o",
"crypto/rand/randfile.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/rc2" =>
{
"deps" =>
[
"crypto/rc2/rc2_cbc.o",
"crypto/rc2/rc2_ecb.o",
"crypto/rc2/rc2_skey.o",
"crypto/rc2/rc2cfb64.o",
"crypto/rc2/rc2ofb64.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/rc4" =>
{
"deps" =>
[
"crypto/rc4/rc4_enc.o",
"crypto/rc4/rc4_skey.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/ripemd" =>
{
"deps" =>
[
"crypto/ripemd/rmd_dgst.o",
"crypto/ripemd/rmd_one.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/rsa" =>
{
"deps" =>
[
"crypto/rsa/rsa_ameth.o",
"crypto/rsa/rsa_asn1.o",
"crypto/rsa/rsa_chk.o",
"crypto/rsa/rsa_crpt.o",
"crypto/rsa/rsa_depr.o",
"crypto/rsa/rsa_err.o",
"crypto/rsa/rsa_gen.o",
"crypto/rsa/rsa_lib.o",
"crypto/rsa/rsa_meth.o",
"crypto/rsa/rsa_mp.o",
"crypto/rsa/rsa_none.o",
"crypto/rsa/rsa_oaep.o",
"crypto/rsa/rsa_ossl.o",
"crypto/rsa/rsa_pk1.o",
"crypto/rsa/rsa_pmeth.o",
"crypto/rsa/rsa_prn.o",
"crypto/rsa/rsa_pss.o",
"crypto/rsa/rsa_saos.o",
"crypto/rsa/rsa_sign.o",
"crypto/rsa/rsa_ssl.o",
"crypto/rsa/rsa_x931.o",
"crypto/rsa/rsa_x931g.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/seed" =>
{
"deps" =>
[
"crypto/seed/seed.o",
"crypto/seed/seed_cbc.o",
"crypto/seed/seed_cfb.o",
"crypto/seed/seed_ecb.o",
"crypto/seed/seed_ofb.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/sha" =>
{
"deps" =>
[
"crypto/sha/keccak1600.o",
"crypto/sha/sha1_one.o",
"crypto/sha/sha1dgst.o",
"crypto/sha/sha256.o",
"crypto/sha/sha512.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/siphash" =>
{
"deps" =>
[
"crypto/siphash/siphash.o",
"crypto/siphash/siphash_ameth.o",
"crypto/siphash/siphash_pmeth.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/sm2" =>
{
"deps" =>
[
"crypto/sm2/sm2_crypt.o",
"crypto/sm2/sm2_err.o",
"crypto/sm2/sm2_pmeth.o",
"crypto/sm2/sm2_sign.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/sm3" =>
{
"deps" =>
[
"crypto/sm3/m_sm3.o",
"crypto/sm3/sm3.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/sm4" =>
{
"deps" =>
[
"crypto/sm4/sm4.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/srp" =>
{
"deps" =>
[
"crypto/srp/srp_lib.o",
"crypto/srp/srp_vfy.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/stack" =>
{
"deps" =>
[
"crypto/stack/stack.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/store" =>
{
"deps" =>
[
"crypto/store/loader_file.o",
"crypto/store/store_err.o",
"crypto/store/store_init.o",
"crypto/store/store_lib.o",
"crypto/store/store_register.o",
"crypto/store/store_strings.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/ts" =>
{
"deps" =>
[
"crypto/ts/ts_asn1.o",
"crypto/ts/ts_conf.o",
"crypto/ts/ts_err.o",
"crypto/ts/ts_lib.o",
"crypto/ts/ts_req_print.o",
"crypto/ts/ts_req_utils.o",
"crypto/ts/ts_rsp_print.o",
"crypto/ts/ts_rsp_sign.o",
"crypto/ts/ts_rsp_utils.o",
"crypto/ts/ts_rsp_verify.o",
"crypto/ts/ts_verify_ctx.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/txt_db" =>
{
"deps" =>
[
"crypto/txt_db/txt_db.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/ui" =>
{
"deps" =>
[
"crypto/ui/ui_err.o",
"crypto/ui/ui_lib.o",
"crypto/ui/ui_null.o",
"crypto/ui/ui_openssl.o",
"crypto/ui/ui_util.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/whrlpool" =>
{
"deps" =>
[
"crypto/whrlpool/wp_block.o",
"crypto/whrlpool/wp_dgst.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/x509" =>
{
"deps" =>
[
"crypto/x509/by_dir.o",
"crypto/x509/by_file.o",
"crypto/x509/t_crl.o",
"crypto/x509/t_req.o",
"crypto/x509/t_x509.o",
"crypto/x509/x509_att.o",
"crypto/x509/x509_cmp.o",
"crypto/x509/x509_d2.o",
"crypto/x509/x509_def.o",
"crypto/x509/x509_err.o",
"crypto/x509/x509_ext.o",
"crypto/x509/x509_lu.o",
"crypto/x509/x509_meth.o",
"crypto/x509/x509_obj.o",
"crypto/x509/x509_r2x.o",
"crypto/x509/x509_req.o",
"crypto/x509/x509_set.o",
"crypto/x509/x509_trs.o",
"crypto/x509/x509_txt.o",
"crypto/x509/x509_v3.o",
"crypto/x509/x509_vfy.o",
"crypto/x509/x509_vpm.o",
"crypto/x509/x509cset.o",
"crypto/x509/x509name.o",
"crypto/x509/x509rset.o",
"crypto/x509/x509spki.o",
"crypto/x509/x509type.o",
"crypto/x509/x_all.o",
"crypto/x509/x_attrib.o",
"crypto/x509/x_crl.o",
"crypto/x509/x_exten.o",
"crypto/x509/x_name.o",
"crypto/x509/x_pubkey.o",
"crypto/x509/x_req.o",
"crypto/x509/x_x509.o",
"crypto/x509/x_x509a.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"crypto/x509v3" =>
{
"deps" =>
[
"crypto/x509v3/pcy_cache.o",
"crypto/x509v3/pcy_data.o",
"crypto/x509v3/pcy_lib.o",
"crypto/x509v3/pcy_map.o",
"crypto/x509v3/pcy_node.o",
"crypto/x509v3/pcy_tree.o",
"crypto/x509v3/v3_addr.o",
"crypto/x509v3/v3_admis.o",
"crypto/x509v3/v3_akey.o",
"crypto/x509v3/v3_akeya.o",
"crypto/x509v3/v3_alt.o",
"crypto/x509v3/v3_asid.o",
"crypto/x509v3/v3_bcons.o",
"crypto/x509v3/v3_bitst.o",
"crypto/x509v3/v3_conf.o",
"crypto/x509v3/v3_cpols.o",
"crypto/x509v3/v3_crld.o",
"crypto/x509v3/v3_enum.o",
"crypto/x509v3/v3_extku.o",
"crypto/x509v3/v3_genn.o",
"crypto/x509v3/v3_ia5.o",
"crypto/x509v3/v3_info.o",
"crypto/x509v3/v3_int.o",
"crypto/x509v3/v3_lib.o",
"crypto/x509v3/v3_ncons.o",
"crypto/x509v3/v3_pci.o",
"crypto/x509v3/v3_pcia.o",
"crypto/x509v3/v3_pcons.o",
"crypto/x509v3/v3_pku.o",
"crypto/x509v3/v3_pmaps.o",
"crypto/x509v3/v3_prn.o",
"crypto/x509v3/v3_purp.o",
"crypto/x509v3/v3_skey.o",
"crypto/x509v3/v3_sxnet.o",
"crypto/x509v3/v3_tlsf.o",
"crypto/x509v3/v3_utl.o",
"crypto/x509v3/v3err.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"engines" =>
{
"deps" =>
[
"engines/e_capi.o",
"engines/e_padlock.o",
],
"products" =>
{
"lib" =>
[
"libcrypto",
],
},
},
"fuzz" =>
{
"products" =>
{
"bin" =>
[
"fuzz/asn1-test",
"fuzz/asn1parse-test",
"fuzz/bignum-test",
"fuzz/bndiv-test",
"fuzz/client-test",
"fuzz/cms-test",
"fuzz/conf-test",
"fuzz/crl-test",
"fuzz/ct-test",
"fuzz/server-test",
"fuzz/x509-test",
],
},
},
"ssl" =>
{
"deps" =>
[
"ssl/bio_ssl.o",
"ssl/d1_lib.o",
"ssl/d1_msg.o",
"ssl/d1_srtp.o",
"ssl/methods.o",
"ssl/packet.o",
"ssl/pqueue.o",
"ssl/s3_cbc.o",
"ssl/s3_enc.o",
"ssl/s3_lib.o",
"ssl/s3_msg.o",
"ssl/ssl_asn1.o",
"ssl/ssl_cert.o",
"ssl/ssl_ciph.o",
"ssl/ssl_conf.o",
"ssl/ssl_err.o",
"ssl/ssl_init.o",
"ssl/ssl_lib.o",
"ssl/ssl_mcnf.o",
"ssl/ssl_quic.o",
"ssl/ssl_rsa.o",
"ssl/ssl_sess.o",
"ssl/ssl_stat.o",
"ssl/ssl_txt.o",
"ssl/ssl_utst.o",
"ssl/t1_enc.o",
"ssl/t1_lib.o",
"ssl/t1_trce.o",
"ssl/tls13_enc.o",
"ssl/tls_srp.o",
],
"products" =>
{
"lib" =>
[
"libssl",
],
},
},
"ssl/record" =>
{
"deps" =>
[
"ssl/record/dtls1_bitmap.o",
"ssl/record/rec_layer_d1.o",
"ssl/record/rec_layer_s3.o",
"ssl/record/ssl3_buffer.o",
"ssl/record/ssl3_record.o",
"ssl/record/ssl3_record_tls13.o",
],
"products" =>
{
"lib" =>
[
"libssl",
],
},
},
"ssl/statem" =>
{
"deps" =>
[
"ssl/statem/extensions.o",
"ssl/statem/extensions_clnt.o",
"ssl/statem/extensions_cust.o",
"ssl/statem/extensions_srvr.o",
"ssl/statem/statem.o",
"ssl/statem/statem_clnt.o",
"ssl/statem/statem_dtls.o",
"ssl/statem/statem_lib.o",
"ssl/statem/statem_quic.o",
"ssl/statem/statem_srvr.o",
],
"products" =>
{
"lib" =>
[
"libssl",
],
},
},
"test/testutil" =>
{
"deps" =>
[
"test/testutil/basic_output.o",
"test/testutil/cb.o",
"test/testutil/driver.o",
"test/testutil/format_output.o",
"test/testutil/main.o",
"test/testutil/output_helpers.o",
"test/testutil/random.o",
"test/testutil/stanza.o",
"test/testutil/tap_bio.o",
"test/testutil/test_cleanup.o",
"test/testutil/tests.o",
"test/testutil/testutil_init.o",
],
"products" =>
{
"lib" =>
[
"test/libtestutil.a",
],
},
},
"tools" =>
{
"products" =>
{
"script" =>
[
"tools/c_rehash",
],
},
},
"util" =>
{
"products" =>
{
"script" =>
[
"util/shlib_wrap.sh",
],
},
},
},
"engines" =>
[
],
"extra" =>
[
"crypto/alphacpuid.pl",
"crypto/arm64cpuid.pl",
"crypto/armv4cpuid.pl",
"crypto/ia64cpuid.S",
"crypto/pariscid.pl",
"crypto/ppccpuid.pl",
"crypto/x86_64cpuid.pl",
"crypto/x86cpuid.pl",
"ms/applink.c",
"ms/uplink-x86.pl",
"ms/uplink.c",
],
"generate" =>
{
"apps/progs.h" =>
[
"apps/progs.pl",
"\$(APPS_OPENSSL)",
],
"crypto/aes/aes-586.s" =>
[
"crypto/aes/asm/aes-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/aes/aes-armv4.S" =>
[
"crypto/aes/asm/aes-armv4.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aes-ia64.s" =>
[
"crypto/aes/asm/aes-ia64.S",
],
"crypto/aes/aes-mips.S" =>
[
"crypto/aes/asm/aes-mips.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aes-parisc.s" =>
[
"crypto/aes/asm/aes-parisc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aes-ppc.s" =>
[
"crypto/aes/asm/aes-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aes-s390x.S" =>
[
"crypto/aes/asm/aes-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aes-sparcv9.S" =>
[
"crypto/aes/asm/aes-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aes-x86_64.s" =>
[
"crypto/aes/asm/aes-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aesfx-sparcv9.S" =>
[
"crypto/aes/asm/aesfx-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aesni-mb-x86_64.s" =>
[
"crypto/aes/asm/aesni-mb-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aesni-sha1-x86_64.s" =>
[
"crypto/aes/asm/aesni-sha1-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aesni-sha256-x86_64.s" =>
[
"crypto/aes/asm/aesni-sha256-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aesni-x86.s" =>
[
"crypto/aes/asm/aesni-x86.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/aes/aesni-x86_64.s" =>
[
"crypto/aes/asm/aesni-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aesp8-ppc.s" =>
[
"crypto/aes/asm/aesp8-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aest4-sparcv9.S" =>
[
"crypto/aes/asm/aest4-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/aesv8-armx.S" =>
[
"crypto/aes/asm/aesv8-armx.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/bsaes-armv7.S" =>
[
"crypto/aes/asm/bsaes-armv7.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/bsaes-x86_64.s" =>
[
"crypto/aes/asm/bsaes-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/vpaes-armv8.S" =>
[
"crypto/aes/asm/vpaes-armv8.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/vpaes-ppc.s" =>
[
"crypto/aes/asm/vpaes-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/aes/vpaes-x86.s" =>
[
"crypto/aes/asm/vpaes-x86.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/aes/vpaes-x86_64.s" =>
[
"crypto/aes/asm/vpaes-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/alphacpuid.s" =>
[
"crypto/alphacpuid.pl",
],
"crypto/arm64cpuid.S" =>
[
"crypto/arm64cpuid.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/armv4cpuid.S" =>
[
"crypto/armv4cpuid.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bf/bf-586.s" =>
[
"crypto/bf/asm/bf-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/bn/alpha-mont.S" =>
[
"crypto/bn/asm/alpha-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/armv4-gf2m.S" =>
[
"crypto/bn/asm/armv4-gf2m.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/armv4-mont.S" =>
[
"crypto/bn/asm/armv4-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/armv8-mont.S" =>
[
"crypto/bn/asm/armv8-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/bn-586.s" =>
[
"crypto/bn/asm/bn-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/bn/bn-ia64.s" =>
[
"crypto/bn/asm/ia64.S",
],
"crypto/bn/bn-mips.S" =>
[
"crypto/bn/asm/mips.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/bn-ppc.s" =>
[
"crypto/bn/asm/ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/co-586.s" =>
[
"crypto/bn/asm/co-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/bn/ia64-mont.s" =>
[
"crypto/bn/asm/ia64-mont.pl",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/bn/mips-mont.S" =>
[
"crypto/bn/asm/mips-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/parisc-mont.s" =>
[
"crypto/bn/asm/parisc-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/ppc-mont.s" =>
[
"crypto/bn/asm/ppc-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/ppc64-mont.s" =>
[
"crypto/bn/asm/ppc64-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/rsaz-avx2.s" =>
[
"crypto/bn/asm/rsaz-avx2.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/rsaz-x86_64.s" =>
[
"crypto/bn/asm/rsaz-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/s390x-gf2m.s" =>
[
"crypto/bn/asm/s390x-gf2m.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/s390x-mont.S" =>
[
"crypto/bn/asm/s390x-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/sparct4-mont.S" =>
[
"crypto/bn/asm/sparct4-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/sparcv9-gf2m.S" =>
[
"crypto/bn/asm/sparcv9-gf2m.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/sparcv9-mont.S" =>
[
"crypto/bn/asm/sparcv9-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/sparcv9a-mont.S" =>
[
"crypto/bn/asm/sparcv9a-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/vis3-mont.S" =>
[
"crypto/bn/asm/vis3-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/x86-gf2m.s" =>
[
"crypto/bn/asm/x86-gf2m.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/bn/x86-mont.s" =>
[
"crypto/bn/asm/x86-mont.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/bn/x86_64-gf2m.s" =>
[
"crypto/bn/asm/x86_64-gf2m.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/x86_64-mont.s" =>
[
"crypto/bn/asm/x86_64-mont.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/bn/x86_64-mont5.s" =>
[
"crypto/bn/asm/x86_64-mont5.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/buildinf.h" =>
[
"util/mkbuildinf.pl",
"\"\$(CC)",
"\$(LIB_CFLAGS)",
"\$(CPPFLAGS_Q)\"",
"\"\$(PLATFORM)\"",
],
"crypto/camellia/cmll-x86.s" =>
[
"crypto/camellia/asm/cmll-x86.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/camellia/cmll-x86_64.s" =>
[
"crypto/camellia/asm/cmll-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/camellia/cmllt4-sparcv9.S" =>
[
"crypto/camellia/asm/cmllt4-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/cast/cast-586.s" =>
[
"crypto/cast/asm/cast-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/chacha/chacha-armv4.S" =>
[
"crypto/chacha/asm/chacha-armv4.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/chacha/chacha-armv8.S" =>
[
"crypto/chacha/asm/chacha-armv8.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/chacha/chacha-ppc.s" =>
[
"crypto/chacha/asm/chacha-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/chacha/chacha-s390x.S" =>
[
"crypto/chacha/asm/chacha-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/chacha/chacha-x86.s" =>
[
"crypto/chacha/asm/chacha-x86.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/chacha/chacha-x86_64.s" =>
[
"crypto/chacha/asm/chacha-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/des/crypt586.s" =>
[
"crypto/des/asm/crypt586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/des/des-586.s" =>
[
"crypto/des/asm/des-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/des/des_enc-sparc.S" =>
[
"crypto/des/asm/des_enc.m4",
],
"crypto/des/dest4-sparcv9.S" =>
[
"crypto/des/asm/dest4-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ec/ecp_nistz256-armv4.S" =>
[
"crypto/ec/asm/ecp_nistz256-armv4.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ec/ecp_nistz256-armv8.S" =>
[
"crypto/ec/asm/ecp_nistz256-armv8.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ec/ecp_nistz256-avx2.s" =>
[
"crypto/ec/asm/ecp_nistz256-avx2.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ec/ecp_nistz256-ppc64.s" =>
[
"crypto/ec/asm/ecp_nistz256-ppc64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ec/ecp_nistz256-sparcv9.S" =>
[
"crypto/ec/asm/ecp_nistz256-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ec/ecp_nistz256-x86.s" =>
[
"crypto/ec/asm/ecp_nistz256-x86.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/ec/ecp_nistz256-x86_64.s" =>
[
"crypto/ec/asm/ecp_nistz256-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ec/x25519-ppc64.s" =>
[
"crypto/ec/asm/x25519-ppc64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ec/x25519-x86_64.s" =>
[
"crypto/ec/asm/x25519-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ia64cpuid.s" =>
[
"crypto/ia64cpuid.S",
],
"crypto/md5/md5-586.s" =>
[
"crypto/md5/asm/md5-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/md5/md5-sparcv9.S" =>
[
"crypto/md5/asm/md5-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/md5/md5-x86_64.s" =>
[
"crypto/md5/asm/md5-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/aesni-gcm-x86_64.s" =>
[
"crypto/modes/asm/aesni-gcm-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/ghash-alpha.S" =>
[
"crypto/modes/asm/ghash-alpha.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/ghash-armv4.S" =>
[
"crypto/modes/asm/ghash-armv4.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/ghash-ia64.s" =>
[
"crypto/modes/asm/ghash-ia64.pl",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/modes/ghash-parisc.s" =>
[
"crypto/modes/asm/ghash-parisc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/ghash-s390x.S" =>
[
"crypto/modes/asm/ghash-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/ghash-sparcv9.S" =>
[
"crypto/modes/asm/ghash-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/ghash-x86.s" =>
[
"crypto/modes/asm/ghash-x86.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/modes/ghash-x86_64.s" =>
[
"crypto/modes/asm/ghash-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/ghashp8-ppc.s" =>
[
"crypto/modes/asm/ghashp8-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/modes/ghashv8-armx.S" =>
[
"crypto/modes/asm/ghashv8-armx.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/pariscid.s" =>
[
"crypto/pariscid.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/poly1305/poly1305-armv4.S" =>
[
"crypto/poly1305/asm/poly1305-armv4.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/poly1305/poly1305-armv8.S" =>
[
"crypto/poly1305/asm/poly1305-armv8.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/poly1305/poly1305-mips.S" =>
[
"crypto/poly1305/asm/poly1305-mips.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/poly1305/poly1305-ppc.s" =>
[
"crypto/poly1305/asm/poly1305-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/poly1305/poly1305-ppcfp.s" =>
[
"crypto/poly1305/asm/poly1305-ppcfp.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/poly1305/poly1305-s390x.S" =>
[
"crypto/poly1305/asm/poly1305-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/poly1305/poly1305-sparcv9.S" =>
[
"crypto/poly1305/asm/poly1305-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/poly1305/poly1305-x86.s" =>
[
"crypto/poly1305/asm/poly1305-x86.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/poly1305/poly1305-x86_64.s" =>
[
"crypto/poly1305/asm/poly1305-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ppccpuid.s" =>
[
"crypto/ppccpuid.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/rc4/rc4-586.s" =>
[
"crypto/rc4/asm/rc4-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/rc4/rc4-md5-x86_64.s" =>
[
"crypto/rc4/asm/rc4-md5-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/rc4/rc4-parisc.s" =>
[
"crypto/rc4/asm/rc4-parisc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/rc4/rc4-s390x.s" =>
[
"crypto/rc4/asm/rc4-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/rc4/rc4-x86_64.s" =>
[
"crypto/rc4/asm/rc4-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/ripemd/rmd-586.s" =>
[
"crypto/ripemd/asm/rmd-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/s390xcpuid.S" =>
[
"crypto/s390xcpuid.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/keccak1600-armv4.S" =>
[
"crypto/sha/asm/keccak1600-armv4.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/keccak1600-armv8.S" =>
[
"crypto/sha/asm/keccak1600-armv8.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/keccak1600-ppc64.s" =>
[
"crypto/sha/asm/keccak1600-ppc64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/keccak1600-s390x.S" =>
[
"crypto/sha/asm/keccak1600-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/keccak1600-x86_64.s" =>
[
"crypto/sha/asm/keccak1600-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-586.s" =>
[
"crypto/sha/asm/sha1-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/sha/sha1-alpha.S" =>
[
"crypto/sha/asm/sha1-alpha.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-armv4-large.S" =>
[
"crypto/sha/asm/sha1-armv4-large.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-armv8.S" =>
[
"crypto/sha/asm/sha1-armv8.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-ia64.s" =>
[
"crypto/sha/asm/sha1-ia64.pl",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/sha/sha1-mb-x86_64.s" =>
[
"crypto/sha/asm/sha1-mb-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-mips.S" =>
[
"crypto/sha/asm/sha1-mips.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-parisc.s" =>
[
"crypto/sha/asm/sha1-parisc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-ppc.s" =>
[
"crypto/sha/asm/sha1-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-s390x.S" =>
[
"crypto/sha/asm/sha1-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-sparcv9.S" =>
[
"crypto/sha/asm/sha1-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha1-x86_64.s" =>
[
"crypto/sha/asm/sha1-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-586.s" =>
[
"crypto/sha/asm/sha256-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/sha/sha256-armv4.S" =>
[
"crypto/sha/asm/sha256-armv4.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-armv8.S" =>
[
"crypto/sha/asm/sha512-armv8.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-ia64.s" =>
[
"crypto/sha/asm/sha512-ia64.pl",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/sha/sha256-mb-x86_64.s" =>
[
"crypto/sha/asm/sha256-mb-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-mips.S" =>
[
"crypto/sha/asm/sha512-mips.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-parisc.s" =>
[
"crypto/sha/asm/sha512-parisc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-ppc.s" =>
[
"crypto/sha/asm/sha512-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-s390x.S" =>
[
"crypto/sha/asm/sha512-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-sparcv9.S" =>
[
"crypto/sha/asm/sha512-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256-x86_64.s" =>
[
"crypto/sha/asm/sha512-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha256p8-ppc.s" =>
[
"crypto/sha/asm/sha512p8-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512-586.s" =>
[
"crypto/sha/asm/sha512-586.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/sha/sha512-armv4.S" =>
[
"crypto/sha/asm/sha512-armv4.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512-armv8.S" =>
[
"crypto/sha/asm/sha512-armv8.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512-ia64.s" =>
[
"crypto/sha/asm/sha512-ia64.pl",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
],
"crypto/sha/sha512-mips.S" =>
[
"crypto/sha/asm/sha512-mips.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512-parisc.s" =>
[
"crypto/sha/asm/sha512-parisc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512-ppc.s" =>
[
"crypto/sha/asm/sha512-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512-s390x.S" =>
[
"crypto/sha/asm/sha512-s390x.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512-sparcv9.S" =>
[
"crypto/sha/asm/sha512-sparcv9.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512-x86_64.s" =>
[
"crypto/sha/asm/sha512-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/sha/sha512p8-ppc.s" =>
[
"crypto/sha/asm/sha512p8-ppc.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/uplink-ia64.s" =>
[
"ms/uplink-ia64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/uplink-x86.s" =>
[
"ms/uplink-x86.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/uplink-x86_64.s" =>
[
"ms/uplink-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/whrlpool/wp-mmx.s" =>
[
"crypto/whrlpool/asm/wp-mmx.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"crypto/whrlpool/wp-x86_64.s" =>
[
"crypto/whrlpool/asm/wp-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/x86_64cpuid.s" =>
[
"crypto/x86_64cpuid.pl",
"\$(PERLASM_SCHEME)",
],
"crypto/x86cpuid.s" =>
[
"crypto/x86cpuid.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"engines/e_padlock-x86.s" =>
[
"engines/asm/e_padlock-x86.pl",
"\$(PERLASM_SCHEME)",
"\$(LIB_CFLAGS)",
"\$(LIB_CPPFLAGS)",
"\$(PROCESSOR)",
],
"engines/e_padlock-x86_64.s" =>
[
"engines/asm/e_padlock-x86_64.pl",
"\$(PERLASM_SCHEME)",
],
"include/crypto/bn_conf.h" =>
[
"include/crypto/bn_conf.h.in",
],
"include/crypto/dso_conf.h" =>
[
"include/crypto/dso_conf.h.in",
],
"include/openssl/opensslconf.h" =>
[
"include/openssl/opensslconf.h.in",
],
"test/buildtest_aes.c" =>
[
"test/generate_buildtest.pl",
"aes",
],
"test/buildtest_asn1.c" =>
[
"test/generate_buildtest.pl",
"asn1",
],
"test/buildtest_asn1t.c" =>
[
"test/generate_buildtest.pl",
"asn1t",
],
"test/buildtest_async.c" =>
[
"test/generate_buildtest.pl",
"async",
],
"test/buildtest_bio.c" =>
[
"test/generate_buildtest.pl",
"bio",
],
"test/buildtest_blowfish.c" =>
[
"test/generate_buildtest.pl",
"blowfish",
],
"test/buildtest_bn.c" =>
[
"test/generate_buildtest.pl",
"bn",
],
"test/buildtest_buffer.c" =>
[
"test/generate_buildtest.pl",
"buffer",
],
"test/buildtest_camellia.c" =>
[
"test/generate_buildtest.pl",
"camellia",
],
"test/buildtest_cast.c" =>
[
"test/generate_buildtest.pl",
"cast",
],
"test/buildtest_cmac.c" =>
[
"test/generate_buildtest.pl",
"cmac",
],
"test/buildtest_cms.c" =>
[
"test/generate_buildtest.pl",
"cms",
],
"test/buildtest_conf.c" =>
[
"test/generate_buildtest.pl",
"conf",
],
"test/buildtest_conf_api.c" =>
[
"test/generate_buildtest.pl",
"conf_api",
],
"test/buildtest_crypto.c" =>
[
"test/generate_buildtest.pl",
"crypto",
],
"test/buildtest_ct.c" =>
[
"test/generate_buildtest.pl",
"ct",
],
"test/buildtest_des.c" =>
[
"test/generate_buildtest.pl",
"des",
],
"test/buildtest_dh.c" =>
[
"test/generate_buildtest.pl",
"dh",
],
"test/buildtest_dsa.c" =>
[
"test/generate_buildtest.pl",
"dsa",
],
"test/buildtest_dtls1.c" =>
[
"test/generate_buildtest.pl",
"dtls1",
],
"test/buildtest_e_os2.c" =>
[
"test/generate_buildtest.pl",
"e_os2",
],
"test/buildtest_ebcdic.c" =>
[
"test/generate_buildtest.pl",
"ebcdic",
],
"test/buildtest_ec.c" =>
[
"test/generate_buildtest.pl",
"ec",
],
"test/buildtest_ecdh.c" =>
[
"test/generate_buildtest.pl",
"ecdh",
],
"test/buildtest_ecdsa.c" =>
[
"test/generate_buildtest.pl",
"ecdsa",
],
"test/buildtest_engine.c" =>
[
"test/generate_buildtest.pl",
"engine",
],
"test/buildtest_evp.c" =>
[
"test/generate_buildtest.pl",
"evp",
],
"test/buildtest_hmac.c" =>
[
"test/generate_buildtest.pl",
"hmac",
],
"test/buildtest_idea.c" =>
[
"test/generate_buildtest.pl",
"idea",
],
"test/buildtest_kdf.c" =>
[
"test/generate_buildtest.pl",
"kdf",
],
"test/buildtest_lhash.c" =>
[
"test/generate_buildtest.pl",
"lhash",
],
"test/buildtest_md4.c" =>
[
"test/generate_buildtest.pl",
"md4",
],
"test/buildtest_md5.c" =>
[
"test/generate_buildtest.pl",
"md5",
],
"test/buildtest_mdc2.c" =>
[
"test/generate_buildtest.pl",
"mdc2",
],
"test/buildtest_modes.c" =>
[
"test/generate_buildtest.pl",
"modes",
],
"test/buildtest_obj_mac.c" =>
[
"test/generate_buildtest.pl",
"obj_mac",
],
"test/buildtest_objects.c" =>
[
"test/generate_buildtest.pl",
"objects",
],
"test/buildtest_ocsp.c" =>
[
"test/generate_buildtest.pl",
"ocsp",
],
"test/buildtest_opensslv.c" =>
[
"test/generate_buildtest.pl",
"opensslv",
],
"test/buildtest_ossl_typ.c" =>
[
"test/generate_buildtest.pl",
"ossl_typ",
],
"test/buildtest_pem.c" =>
[
"test/generate_buildtest.pl",
"pem",
],
"test/buildtest_pem2.c" =>
[
"test/generate_buildtest.pl",
"pem2",
],
"test/buildtest_pkcs12.c" =>
[
"test/generate_buildtest.pl",
"pkcs12",
],
"test/buildtest_pkcs7.c" =>
[
"test/generate_buildtest.pl",
"pkcs7",
],
"test/buildtest_rand.c" =>
[
"test/generate_buildtest.pl",
"rand",
],
"test/buildtest_rand_drbg.c" =>
[
"test/generate_buildtest.pl",
"rand_drbg",
],
"test/buildtest_rc2.c" =>
[
"test/generate_buildtest.pl",
"rc2",
],
"test/buildtest_rc4.c" =>
[
"test/generate_buildtest.pl",
"rc4",
],
"test/buildtest_ripemd.c" =>
[
"test/generate_buildtest.pl",
"ripemd",
],
"test/buildtest_rsa.c" =>
[
"test/generate_buildtest.pl",
"rsa",
],
"test/buildtest_safestack.c" =>
[
"test/generate_buildtest.pl",
"safestack",
],
"test/buildtest_seed.c" =>
[
"test/generate_buildtest.pl",
"seed",
],
"test/buildtest_sha.c" =>
[
"test/generate_buildtest.pl",
"sha",
],
"test/buildtest_srp.c" =>
[
"test/generate_buildtest.pl",
"srp",
],
"test/buildtest_srtp.c" =>
[
"test/generate_buildtest.pl",
"srtp",
],
"test/buildtest_ssl.c" =>
[
"test/generate_buildtest.pl",
"ssl",
],
"test/buildtest_ssl2.c" =>
[
"test/generate_buildtest.pl",
"ssl2",
],
"test/buildtest_stack.c" =>
[
"test/generate_buildtest.pl",
"stack",
],
"test/buildtest_store.c" =>
[
"test/generate_buildtest.pl",
"store",
],
"test/buildtest_symhacks.c" =>
[
"test/generate_buildtest.pl",
"symhacks",
],
"test/buildtest_tls1.c" =>
[
"test/generate_buildtest.pl",
"tls1",
],
"test/buildtest_ts.c" =>
[
"test/generate_buildtest.pl",
"ts",
],
"test/buildtest_txt_db.c" =>
[
"test/generate_buildtest.pl",
"txt_db",
],
"test/buildtest_ui.c" =>
[
"test/generate_buildtest.pl",
"ui",
],
"test/buildtest_whrlpool.c" =>
[
"test/generate_buildtest.pl",
"whrlpool",
],
"test/buildtest_x509.c" =>
[
"test/generate_buildtest.pl",
"x509",
],
"test/buildtest_x509_vfy.c" =>
[
"test/generate_buildtest.pl",
"x509_vfy",
],
"test/buildtest_x509v3.c" =>
[
"test/generate_buildtest.pl",
"x509v3",
],
},
"includes" =>
{
"apps/app_rand.o" =>
[
".",
"include",
],
"apps/apps.o" =>
[
".",
"include",
],
"apps/asn1pars.o" =>
[
".",
"include",
"apps",
],
"apps/bf_prefix.o" =>
[
".",
"include",
],
"apps/ca.o" =>
[
".",
"include",
"apps",
],
"apps/ciphers.o" =>
[
".",
"include",
"apps",
],
"apps/cms.o" =>
[
".",
"include",
"apps",
],
"apps/crl.o" =>
[
".",
"include",
"apps",
],
"apps/crl2p7.o" =>
[
".",
"include",
"apps",
],
"apps/dgst.o" =>
[
".",
"include",
"apps",
],
"apps/dhparam.o" =>
[
".",
"include",
"apps",
],
"apps/dsa.o" =>
[
".",
"include",
"apps",
],
"apps/dsaparam.o" =>
[
".",
"include",
"apps",
],
"apps/ec.o" =>
[
".",
"include",
"apps",
],
"apps/ecparam.o" =>
[
".",
"include",
"apps",
],
"apps/enc.o" =>
[
".",
"include",
"apps",
],
"apps/engine.o" =>
[
".",
"include",
"apps",
],
"apps/errstr.o" =>
[
".",
"include",
"apps",
],
"apps/gendsa.o" =>
[
".",
"include",
"apps",
],
"apps/genpkey.o" =>
[
".",
"include",
"apps",
],
"apps/genrsa.o" =>
[
".",
"include",
"apps",
],
"apps/nseq.o" =>
[
".",
"include",
"apps",
],
"apps/ocsp.o" =>
[
".",
"include",
"apps",
],
"apps/openssl.o" =>
[
".",
"include",
"apps",
],
"apps/opt.o" =>
[
".",
"include",
],
"apps/passwd.o" =>
[
".",
"include",
"apps",
],
"apps/pkcs12.o" =>
[
".",
"include",
"apps",
],
"apps/pkcs7.o" =>
[
".",
"include",
"apps",
],
"apps/pkcs8.o" =>
[
".",
"include",
"apps",
],
"apps/pkey.o" =>
[
".",
"include",
"apps",
],
"apps/pkeyparam.o" =>
[
".",
"include",
"apps",
],
"apps/pkeyutl.o" =>
[
".",
"include",
"apps",
],
"apps/prime.o" =>
[
".",
"include",
"apps",
],
"apps/progs.h" =>
[
".",
],
"apps/rand.o" =>
[
".",
"include",
"apps",
],
"apps/rehash.o" =>
[
".",
"include",
"apps",
],
"apps/req.o" =>
[
".",
"include",
"apps",
],
"apps/rsa.o" =>
[
".",
"include",
"apps",
],
"apps/rsautl.o" =>
[
".",
"include",
"apps",
],
"apps/s_cb.o" =>
[
".",
"include",
],
"apps/s_client.o" =>
[
".",
"include",
"apps",
],
"apps/s_server.o" =>
[
".",
"include",
"apps",
],
"apps/s_socket.o" =>
[
".",
"include",
],
"apps/s_time.o" =>
[
".",
"include",
"apps",
],
"apps/sess_id.o" =>
[
".",
"include",
"apps",
],
"apps/smime.o" =>
[
".",
"include",
"apps",
],
"apps/speed.o" =>
[
".",
"include",
"apps",
],
"apps/spkac.o" =>
[
".",
"include",
"apps",
],
"apps/srp.o" =>
[
".",
"include",
"apps",
],
"apps/storeutl.o" =>
[
".",
"include",
"apps",
],
"apps/ts.o" =>
[
".",
"include",
"apps",
],
"apps/verify.o" =>
[
".",
"include",
"apps",
],
"apps/version.o" =>
[
".",
"include",
"apps",
],
"apps/x509.o" =>
[
".",
"include",
"apps",
],
"crypto/aes/aes-armv4.o" =>
[
"crypto",
],
"crypto/aes/aes-mips.o" =>
[
"crypto",
],
"crypto/aes/aes-s390x.o" =>
[
"crypto",
],
"crypto/aes/aes-sparcv9.o" =>
[
"crypto",
],
"crypto/aes/aes_cbc.o" =>
[
".",
"include",
],
"crypto/aes/aes_cfb.o" =>
[
".",
"include",
],
"crypto/aes/aes_core.o" =>
[
".",
"include",
],
"crypto/aes/aes_ecb.o" =>
[
".",
"include",
],
"crypto/aes/aes_ige.o" =>
[
".",
"include",
],
"crypto/aes/aes_misc.o" =>
[
".",
"include",
],
"crypto/aes/aes_ofb.o" =>
[
".",
"include",
],
"crypto/aes/aes_wrap.o" =>
[
".",
"include",
],
"crypto/aes/aesfx-sparcv9.o" =>
[
"crypto",
],
"crypto/aes/aest4-sparcv9.o" =>
[
"crypto",
],
"crypto/aes/aesv8-armx.o" =>
[
"crypto",
],
"crypto/aes/bsaes-armv7.o" =>
[
"crypto",
],
"crypto/aria/aria.o" =>
[
".",
"include",
],
"crypto/arm64cpuid.o" =>
[
"crypto",
],
"crypto/armv4cpuid.o" =>
[
"crypto",
],
"crypto/asn1/a_bitstr.o" =>
[
".",
"include",
],
"crypto/asn1/a_d2i_fp.o" =>
[
".",
"include",
],
"crypto/asn1/a_digest.o" =>
[
".",
"include",
],
"crypto/asn1/a_dup.o" =>
[
".",
"include",
],
"crypto/asn1/a_gentm.o" =>
[
".",
"include",
],
"crypto/asn1/a_i2d_fp.o" =>
[
".",
"include",
],
"crypto/asn1/a_int.o" =>
[
".",
"include",
],
"crypto/asn1/a_mbstr.o" =>
[
".",
"include",
],
"crypto/asn1/a_object.o" =>
[
".",
"include",
],
"crypto/asn1/a_octet.o" =>
[
".",
"include",
],
"crypto/asn1/a_print.o" =>
[
".",
"include",
],
"crypto/asn1/a_sign.o" =>
[
".",
"include",
],
"crypto/asn1/a_strex.o" =>
[
".",
"include",
],
"crypto/asn1/a_strnid.o" =>
[
".",
"include",
],
"crypto/asn1/a_time.o" =>
[
".",
"include",
],
"crypto/asn1/a_type.o" =>
[
".",
"include",
],
"crypto/asn1/a_utctm.o" =>
[
".",
"include",
],
"crypto/asn1/a_utf8.o" =>
[
".",
"include",
],
"crypto/asn1/a_verify.o" =>
[
".",
"include",
],
"crypto/asn1/ameth_lib.o" =>
[
".",
"include",
],
"crypto/asn1/asn1_err.o" =>
[
".",
"include",
],
"crypto/asn1/asn1_gen.o" =>
[
".",
"include",
],
"crypto/asn1/asn1_item_list.o" =>
[
".",
"include",
],
"crypto/asn1/asn1_lib.o" =>
[
".",
"include",
],
"crypto/asn1/asn1_par.o" =>
[
".",
"include",
],
"crypto/asn1/asn_mime.o" =>
[
".",
"include",
],
"crypto/asn1/asn_moid.o" =>
[
".",
"include",
],
"crypto/asn1/asn_mstbl.o" =>
[
".",
"include",
],
"crypto/asn1/asn_pack.o" =>
[
".",
"include",
],
"crypto/asn1/bio_asn1.o" =>
[
".",
"include",
],
"crypto/asn1/bio_ndef.o" =>
[
".",
"include",
],
"crypto/asn1/d2i_pr.o" =>
[
".",
"include",
],
"crypto/asn1/d2i_pu.o" =>
[
".",
"include",
],
"crypto/asn1/evp_asn1.o" =>
[
".",
"include",
],
"crypto/asn1/f_int.o" =>
[
".",
"include",
],
"crypto/asn1/f_string.o" =>
[
".",
"include",
],
"crypto/asn1/i2d_pr.o" =>
[
".",
"include",
],
"crypto/asn1/i2d_pu.o" =>
[
".",
"include",
],
"crypto/asn1/n_pkey.o" =>
[
".",
"include",
],
"crypto/asn1/nsseq.o" =>
[
".",
"include",
],
"crypto/asn1/p5_pbe.o" =>
[
".",
"include",
],
"crypto/asn1/p5_pbev2.o" =>
[
".",
"include",
],
"crypto/asn1/p5_scrypt.o" =>
[
".",
"include",
],
"crypto/asn1/p8_pkey.o" =>
[
".",
"include",
],
"crypto/asn1/t_bitst.o" =>
[
".",
"include",
],
"crypto/asn1/t_pkey.o" =>
[
".",
"include",
],
"crypto/asn1/t_spki.o" =>
[
".",
"include",
],
"crypto/asn1/tasn_dec.o" =>
[
".",
"include",
],
"crypto/asn1/tasn_enc.o" =>
[
".",
"include",
],
"crypto/asn1/tasn_fre.o" =>
[
".",
"include",
],
"crypto/asn1/tasn_new.o" =>
[
".",
"include",
],
"crypto/asn1/tasn_prn.o" =>
[
".",
"include",
],
"crypto/asn1/tasn_scn.o" =>
[
".",
"include",
],
"crypto/asn1/tasn_typ.o" =>
[
".",
"include",
],
"crypto/asn1/tasn_utl.o" =>
[
".",
"include",
],
"crypto/asn1/x_algor.o" =>
[
".",
"include",
],
"crypto/asn1/x_bignum.o" =>
[
".",
"include",
],
"crypto/asn1/x_info.o" =>
[
".",
"include",
],
"crypto/asn1/x_int64.o" =>
[
".",
"include",
],
"crypto/asn1/x_long.o" =>
[
".",
"include",
],
"crypto/asn1/x_pkey.o" =>
[
".",
"include",
],
"crypto/asn1/x_sig.o" =>
[
".",
"include",
],
"crypto/asn1/x_spki.o" =>
[
".",
"include",
],
"crypto/asn1/x_val.o" =>
[
".",
"include",
],
"crypto/async/arch/async_null.o" =>
[
".",
"include",
],
"crypto/async/arch/async_posix.o" =>
[
".",
"include",
],
"crypto/async/arch/async_win.o" =>
[
".",
"include",
],
"crypto/async/async.o" =>
[
".",
"include",
],
"crypto/async/async_err.o" =>
[
".",
"include",
],
"crypto/async/async_wait.o" =>
[
".",
"include",
],
"crypto/bf/bf_cfb64.o" =>
[
".",
"include",
],
"crypto/bf/bf_ecb.o" =>
[
".",
"include",
],
"crypto/bf/bf_enc.o" =>
[
".",
"include",
],
"crypto/bf/bf_ofb64.o" =>
[
".",
"include",
],
"crypto/bf/bf_skey.o" =>
[
".",
"include",
],
"crypto/bio/b_addr.o" =>
[
".",
"include",
],
"crypto/bio/b_dump.o" =>
[
".",
"include",
],
"crypto/bio/b_print.o" =>
[
".",
"include",
],
"crypto/bio/b_sock.o" =>
[
".",
"include",
],
"crypto/bio/b_sock2.o" =>
[
".",
"include",
],
"crypto/bio/bf_buff.o" =>
[
".",
"include",
],
"crypto/bio/bf_lbuf.o" =>
[
".",
"include",
],
"crypto/bio/bf_nbio.o" =>
[
".",
"include",
],
"crypto/bio/bf_null.o" =>
[
".",
"include",
],
"crypto/bio/bio_cb.o" =>
[
".",
"include",
],
"crypto/bio/bio_err.o" =>
[
".",
"include",
],
"crypto/bio/bio_lib.o" =>
[
".",
"include",
],
"crypto/bio/bio_meth.o" =>
[
".",
"include",
],
"crypto/bio/bss_acpt.o" =>
[
".",
"include",
],
"crypto/bio/bss_bio.o" =>
[
".",
"include",
],
"crypto/bio/bss_conn.o" =>
[
".",
"include",
],
"crypto/bio/bss_dgram.o" =>
[
".",
"include",
],
"crypto/bio/bss_fd.o" =>
[
".",
"include",
],
"crypto/bio/bss_file.o" =>
[
".",
"include",
],
"crypto/bio/bss_log.o" =>
[
".",
"include",
],
"crypto/bio/bss_mem.o" =>
[
".",
"include",
],
"crypto/bio/bss_null.o" =>
[
".",
"include",
],
"crypto/bio/bss_sock.o" =>
[
".",
"include",
],
"crypto/blake2/blake2b.o" =>
[
".",
"include",
],
"crypto/blake2/blake2s.o" =>
[
".",
"include",
],
"crypto/blake2/m_blake2b.o" =>
[
".",
"include",
],
"crypto/blake2/m_blake2s.o" =>
[
".",
"include",
],
"crypto/bn/armv4-gf2m.o" =>
[
"crypto",
],
"crypto/bn/armv4-mont.o" =>
[
"crypto",
],
"crypto/bn/bn-mips.o" =>
[
"crypto",
],
"crypto/bn/bn_add.o" =>
[
".",
"include",
],
"crypto/bn/bn_asm.o" =>
[
".",
"include",
],
"crypto/bn/bn_blind.o" =>
[
".",
"include",
],
"crypto/bn/bn_const.o" =>
[
".",
"include",
],
"crypto/bn/bn_ctx.o" =>
[
".",
"include",
],
"crypto/bn/bn_depr.o" =>
[
".",
"include",
],
"crypto/bn/bn_dh.o" =>
[
".",
"include",
],
"crypto/bn/bn_div.o" =>
[
".",
"include",
],
"crypto/bn/bn_err.o" =>
[
".",
"include",
],
"crypto/bn/bn_exp.o" =>
[
".",
"include",
"crypto",
],
"crypto/bn/bn_exp2.o" =>
[
".",
"include",
],
"crypto/bn/bn_gcd.o" =>
[
".",
"include",
],
"crypto/bn/bn_gf2m.o" =>
[
".",
"include",
],
"crypto/bn/bn_intern.o" =>
[
".",
"include",
],
"crypto/bn/bn_kron.o" =>
[
".",
"include",
],
"crypto/bn/bn_lib.o" =>
[
".",
"include",
],
"crypto/bn/bn_mod.o" =>
[
".",
"include",
],
"crypto/bn/bn_mont.o" =>
[
".",
"include",
],
"crypto/bn/bn_mpi.o" =>
[
".",
"include",
],
"crypto/bn/bn_mul.o" =>
[
".",
"include",
],
"crypto/bn/bn_nist.o" =>
[
".",
"include",
],
"crypto/bn/bn_prime.o" =>
[
".",
"include",
],
"crypto/bn/bn_print.o" =>
[
".",
"include",
],
"crypto/bn/bn_rand.o" =>
[
".",
"include",
],
"crypto/bn/bn_recp.o" =>
[
".",
"include",
],
"crypto/bn/bn_shift.o" =>
[
".",
"include",
],
"crypto/bn/bn_sqr.o" =>
[
".",
"include",
],
"crypto/bn/bn_sqrt.o" =>
[
".",
"include",
],
"crypto/bn/bn_srp.o" =>
[
".",
"include",
],
"crypto/bn/bn_word.o" =>
[
".",
"include",
],
"crypto/bn/bn_x931p.o" =>
[
".",
"include",
],
"crypto/bn/mips-mont.o" =>
[
"crypto",
],
"crypto/bn/sparct4-mont.o" =>
[
"crypto",
],
"crypto/bn/sparcv9-gf2m.o" =>
[
"crypto",
],
"crypto/bn/sparcv9-mont.o" =>
[
"crypto",
],
"crypto/bn/sparcv9a-mont.o" =>
[
"crypto",
],
"crypto/bn/vis3-mont.o" =>
[
"crypto",
],
"crypto/buffer/buf_err.o" =>
[
".",
"include",
],
"crypto/buffer/buffer.o" =>
[
".",
"include",
],
"crypto/buildinf.h" =>
[
".",
],
"crypto/camellia/camellia.o" =>
[
".",
"include",
],
"crypto/camellia/cmll_cbc.o" =>
[
".",
"include",
],
"crypto/camellia/cmll_cfb.o" =>
[
".",
"include",
],
"crypto/camellia/cmll_ctr.o" =>
[
".",
"include",
],
"crypto/camellia/cmll_ecb.o" =>
[
".",
"include",
],
"crypto/camellia/cmll_misc.o" =>
[
".",
"include",
],
"crypto/camellia/cmll_ofb.o" =>
[
".",
"include",
],
"crypto/camellia/cmllt4-sparcv9.o" =>
[
"crypto",
],
"crypto/cast/c_cfb64.o" =>
[
".",
"include",
],
"crypto/cast/c_ecb.o" =>
[
".",
"include",
],
"crypto/cast/c_enc.o" =>
[
".",
"include",
],
"crypto/cast/c_ofb64.o" =>
[
".",
"include",
],
"crypto/cast/c_skey.o" =>
[
".",
"include",
],
"crypto/chacha/chacha-armv4.o" =>
[
"crypto",
],
"crypto/chacha/chacha-armv8.o" =>
[
"crypto",
],
"crypto/chacha/chacha-s390x.o" =>
[
"crypto",
],
"crypto/chacha/chacha_enc.o" =>
[
".",
"include",
],
"crypto/cmac/cm_ameth.o" =>
[
".",
"include",
],
"crypto/cmac/cm_pmeth.o" =>
[
".",
"include",
],
"crypto/cmac/cmac.o" =>
[
".",
"include",
],
"crypto/cms/cms_asn1.o" =>
[
".",
"include",
],
"crypto/cms/cms_att.o" =>
[
".",
"include",
],
"crypto/cms/cms_cd.o" =>
[
".",
"include",
],
"crypto/cms/cms_dd.o" =>
[
".",
"include",
],
"crypto/cms/cms_enc.o" =>
[
".",
"include",
],
"crypto/cms/cms_env.o" =>
[
".",
"include",
],
"crypto/cms/cms_err.o" =>
[
".",
"include",
],
"crypto/cms/cms_ess.o" =>
[
".",
"include",
],
"crypto/cms/cms_io.o" =>
[
".",
"include",
],
"crypto/cms/cms_kari.o" =>
[
".",
"include",
],
"crypto/cms/cms_lib.o" =>
[
".",
"include",
],
"crypto/cms/cms_pwri.o" =>
[
".",
"include",
],
"crypto/cms/cms_sd.o" =>
[
".",
"include",
],
"crypto/cms/cms_smime.o" =>
[
".",
"include",
],
"crypto/conf/conf_api.o" =>
[
".",
"include",
],
"crypto/conf/conf_def.o" =>
[
".",
"include",
],
"crypto/conf/conf_err.o" =>
[
".",
"include",
],
"crypto/conf/conf_lib.o" =>
[
".",
"include",
],
"crypto/conf/conf_mall.o" =>
[
".",
"include",
],
"crypto/conf/conf_mod.o" =>
[
".",
"include",
],
"crypto/conf/conf_sap.o" =>
[
".",
"include",
],
"crypto/conf/conf_ssl.o" =>
[
".",
"include",
],
"crypto/cpt_err.o" =>
[
".",
"include",
],
"crypto/cryptlib.o" =>
[
".",
"include",
],
"crypto/ct/ct_b64.o" =>
[
".",
"include",
],
"crypto/ct/ct_err.o" =>
[
".",
"include",
],
"crypto/ct/ct_log.o" =>
[
".",
"include",
],
"crypto/ct/ct_oct.o" =>
[
".",
"include",
],
"crypto/ct/ct_policy.o" =>
[
".",
"include",
],
"crypto/ct/ct_prn.o" =>
[
".",
"include",
],
"crypto/ct/ct_sct.o" =>
[
".",
"include",
],
"crypto/ct/ct_sct_ctx.o" =>
[
".",
"include",
],
"crypto/ct/ct_vfy.o" =>
[
".",
"include",
],
"crypto/ct/ct_x509v3.o" =>
[
".",
"include",
],
"crypto/ctype.o" =>
[
".",
"include",
],
"crypto/cversion.o" =>
[
".",
"include",
"crypto",
],
"crypto/des/cbc_cksm.o" =>
[
".",
"include",
],
"crypto/des/cbc_enc.o" =>
[
".",
"include",
],
"crypto/des/cfb64ede.o" =>
[
".",
"include",
],
"crypto/des/cfb64enc.o" =>
[
".",
"include",
],
"crypto/des/cfb_enc.o" =>
[
".",
"include",
],
"crypto/des/des_enc.o" =>
[
".",
"include",
],
"crypto/des/dest4-sparcv9.o" =>
[
"crypto",
],
"crypto/des/ecb3_enc.o" =>
[
".",
"include",
],
"crypto/des/ecb_enc.o" =>
[
".",
"include",
],
"crypto/des/fcrypt.o" =>
[
".",
"include",
],
"crypto/des/fcrypt_b.o" =>
[
".",
"include",
],
"crypto/des/ofb64ede.o" =>
[
".",
"include",
],
"crypto/des/ofb64enc.o" =>
[
".",
"include",
],
"crypto/des/ofb_enc.o" =>
[
".",
"include",
],
"crypto/des/pcbc_enc.o" =>
[
".",
"include",
],
"crypto/des/qud_cksm.o" =>
[
".",
"include",
],
"crypto/des/rand_key.o" =>
[
".",
"include",
],
"crypto/des/set_key.o" =>
[
".",
"include",
],
"crypto/des/str2key.o" =>
[
".",
"include",
],
"crypto/des/xcbc_enc.o" =>
[
".",
"include",
],
"crypto/dh/dh_ameth.o" =>
[
".",
"include",
],
"crypto/dh/dh_asn1.o" =>
[
".",
"include",
],
"crypto/dh/dh_check.o" =>
[
".",
"include",
],
"crypto/dh/dh_depr.o" =>
[
".",
"include",
],
"crypto/dh/dh_err.o" =>
[
".",
"include",
],
"crypto/dh/dh_gen.o" =>
[
".",
"include",
],
"crypto/dh/dh_kdf.o" =>
[
".",
"include",
],
"crypto/dh/dh_key.o" =>
[
".",
"include",
],
"crypto/dh/dh_lib.o" =>
[
".",
"include",
],
"crypto/dh/dh_meth.o" =>
[
".",
"include",
],
"crypto/dh/dh_pmeth.o" =>
[
".",
"include",
],
"crypto/dh/dh_prn.o" =>
[
".",
"include",
],
"crypto/dh/dh_rfc5114.o" =>
[
".",
"include",
],
"crypto/dh/dh_rfc7919.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_ameth.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_asn1.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_depr.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_err.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_gen.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_key.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_lib.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_meth.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_ossl.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_pmeth.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_prn.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_sign.o" =>
[
".",
"include",
],
"crypto/dsa/dsa_vrf.o" =>
[
".",
"include",
],
"crypto/dso/dso_dl.o" =>
[
".",
"include",
],
"crypto/dso/dso_dlfcn.o" =>
[
".",
"include",
],
"crypto/dso/dso_err.o" =>
[
".",
"include",
],
"crypto/dso/dso_lib.o" =>
[
".",
"include",
],
"crypto/dso/dso_openssl.o" =>
[
".",
"include",
],
"crypto/dso/dso_vms.o" =>
[
".",
"include",
],
"crypto/dso/dso_win32.o" =>
[
".",
"include",
],
"crypto/ebcdic.o" =>
[
".",
"include",
],
"crypto/ec/curve25519.o" =>
[
".",
"include",
],
"crypto/ec/curve448/arch_32/f_impl.o" =>
[
".",
"include",
"crypto/ec/curve448/arch_32",
"crypto/ec/curve448",
],
"crypto/ec/curve448/curve448.o" =>
[
".",
"include",
"crypto/ec/curve448/arch_32",
"crypto/ec/curve448",
],
"crypto/ec/curve448/curve448_tables.o" =>
[
".",
"include",
"crypto/ec/curve448/arch_32",
"crypto/ec/curve448",
],
"crypto/ec/curve448/eddsa.o" =>
[
".",
"include",
"crypto/ec/curve448/arch_32",
"crypto/ec/curve448",
],
"crypto/ec/curve448/f_generic.o" =>
[
".",
"include",
"crypto/ec/curve448/arch_32",
"crypto/ec/curve448",
],
"crypto/ec/curve448/scalar.o" =>
[
".",
"include",
"crypto/ec/curve448/arch_32",
"crypto/ec/curve448",
],
"crypto/ec/ec2_oct.o" =>
[
".",
"include",
],
"crypto/ec/ec2_smpl.o" =>
[
".",
"include",
],
"crypto/ec/ec_ameth.o" =>
[
".",
"include",
],
"crypto/ec/ec_asn1.o" =>
[
".",
"include",
],
"crypto/ec/ec_check.o" =>
[
".",
"include",
],
"crypto/ec/ec_curve.o" =>
[
".",
"include",
],
"crypto/ec/ec_cvt.o" =>
[
".",
"include",
],
"crypto/ec/ec_err.o" =>
[
".",
"include",
],
"crypto/ec/ec_key.o" =>
[
".",
"include",
],
"crypto/ec/ec_kmeth.o" =>
[
".",
"include",
],
"crypto/ec/ec_lib.o" =>
[
".",
"include",
],
"crypto/ec/ec_mult.o" =>
[
".",
"include",
],
"crypto/ec/ec_oct.o" =>
[
".",
"include",
],
"crypto/ec/ec_pmeth.o" =>
[
".",
"include",
],
"crypto/ec/ec_print.o" =>
[
".",
"include",
],
"crypto/ec/ecdh_kdf.o" =>
[
".",
"include",
],
"crypto/ec/ecdh_ossl.o" =>
[
".",
"include",
],
"crypto/ec/ecdsa_ossl.o" =>
[
".",
"include",
],
"crypto/ec/ecdsa_sign.o" =>
[
".",
"include",
],
"crypto/ec/ecdsa_vrf.o" =>
[
".",
"include",
],
"crypto/ec/eck_prn.o" =>
[
".",
"include",
],
"crypto/ec/ecp_mont.o" =>
[
".",
"include",
],
"crypto/ec/ecp_nist.o" =>
[
".",
"include",
],
"crypto/ec/ecp_nistp224.o" =>
[
".",
"include",
],
"crypto/ec/ecp_nistp256.o" =>
[
".",
"include",
],
"crypto/ec/ecp_nistp521.o" =>
[
".",
"include",
],
"crypto/ec/ecp_nistputil.o" =>
[
".",
"include",
],
"crypto/ec/ecp_nistz256-armv4.o" =>
[
"crypto",
],
"crypto/ec/ecp_nistz256-armv8.o" =>
[
"crypto",
],
"crypto/ec/ecp_nistz256-sparcv9.o" =>
[
"crypto",
],
"crypto/ec/ecp_oct.o" =>
[
".",
"include",
],
"crypto/ec/ecp_smpl.o" =>
[
".",
"include",
],
"crypto/ec/ecx_meth.o" =>
[
".",
"include",
],
"crypto/engine/eng_all.o" =>
[
".",
"include",
],
"crypto/engine/eng_cnf.o" =>
[
".",
"include",
],
"crypto/engine/eng_ctrl.o" =>
[
".",
"include",
],
"crypto/engine/eng_dyn.o" =>
[
".",
"include",
],
"crypto/engine/eng_err.o" =>
[
".",
"include",
],
"crypto/engine/eng_fat.o" =>
[
".",
"include",
],
"crypto/engine/eng_init.o" =>
[
".",
"include",
],
"crypto/engine/eng_lib.o" =>
[
".",
"include",
],
"crypto/engine/eng_list.o" =>
[
".",
"include",
],
"crypto/engine/eng_openssl.o" =>
[
".",
"include",
],
"crypto/engine/eng_pkey.o" =>
[
".",
"include",
],
"crypto/engine/eng_rdrand.o" =>
[
".",
"include",
],
"crypto/engine/eng_table.o" =>
[
".",
"include",
],
"crypto/engine/tb_asnmth.o" =>
[
".",
"include",
],
"crypto/engine/tb_cipher.o" =>
[
".",
"include",
],
"crypto/engine/tb_dh.o" =>
[
".",
"include",
],
"crypto/engine/tb_digest.o" =>
[
".",
"include",
],
"crypto/engine/tb_dsa.o" =>
[
".",
"include",
],
"crypto/engine/tb_eckey.o" =>
[
".",
"include",
],
"crypto/engine/tb_pkmeth.o" =>
[
".",
"include",
],
"crypto/engine/tb_rand.o" =>
[
".",
"include",
],
"crypto/engine/tb_rsa.o" =>
[
".",
"include",
],
"crypto/err/err.o" =>
[
".",
"include",
],
"crypto/err/err_all.o" =>
[
".",
"include",
],
"crypto/err/err_prn.o" =>
[
".",
"include",
],
"crypto/evp/bio_b64.o" =>
[
".",
"include",
],
"crypto/evp/bio_enc.o" =>
[
".",
"include",
],
"crypto/evp/bio_md.o" =>
[
".",
"include",
],
"crypto/evp/bio_ok.o" =>
[
".",
"include",
],
"crypto/evp/c_allc.o" =>
[
".",
"include",
],
"crypto/evp/c_alld.o" =>
[
".",
"include",
],
"crypto/evp/cmeth_lib.o" =>
[
".",
"include",
],
"crypto/evp/digest.o" =>
[
".",
"include",
],
"crypto/evp/e_aes.o" =>
[
".",
"include",
"crypto",
"crypto/modes",
],
"crypto/evp/e_aes_cbc_hmac_sha1.o" =>
[
".",
"include",
"crypto/modes",
],
"crypto/evp/e_aes_cbc_hmac_sha256.o" =>
[
".",
"include",
"crypto/modes",
],
"crypto/evp/e_aria.o" =>
[
".",
"include",
"crypto",
"crypto/modes",
],
"crypto/evp/e_bf.o" =>
[
".",
"include",
],
"crypto/evp/e_camellia.o" =>
[
".",
"include",
"crypto",
"crypto/modes",
],
"crypto/evp/e_cast.o" =>
[
".",
"include",
],
"crypto/evp/e_chacha20_poly1305.o" =>
[
".",
"include",
],
"crypto/evp/e_des.o" =>
[
".",
"include",
"crypto",
],
"crypto/evp/e_des3.o" =>
[
".",
"include",
"crypto",
],
"crypto/evp/e_idea.o" =>
[
".",
"include",
],
"crypto/evp/e_null.o" =>
[
".",
"include",
],
"crypto/evp/e_old.o" =>
[
".",
"include",
],
"crypto/evp/e_rc2.o" =>
[
".",
"include",
],
"crypto/evp/e_rc4.o" =>
[
".",
"include",
],
"crypto/evp/e_rc4_hmac_md5.o" =>
[
".",
"include",
],
"crypto/evp/e_rc5.o" =>
[
".",
"include",
],
"crypto/evp/e_seed.o" =>
[
".",
"include",
],
"crypto/evp/e_sm4.o" =>
[
".",
"include",
"crypto",
"crypto/modes",
],
"crypto/evp/e_xcbc_d.o" =>
[
".",
"include",
],
"crypto/evp/encode.o" =>
[
".",
"include",
],
"crypto/evp/evp_cnf.o" =>
[
".",
"include",
],
"crypto/evp/evp_enc.o" =>
[
".",
"include",
],
"crypto/evp/evp_err.o" =>
[
".",
"include",
],
"crypto/evp/evp_key.o" =>
[
".",
"include",
],
"crypto/evp/evp_lib.o" =>
[
".",
"include",
],
"crypto/evp/evp_pbe.o" =>
[
".",
"include",
],
"crypto/evp/evp_pkey.o" =>
[
".",
"include",
],
"crypto/evp/m_md2.o" =>
[
".",
"include",
],
"crypto/evp/m_md4.o" =>
[
".",
"include",
],
"crypto/evp/m_md5.o" =>
[
".",
"include",
],
"crypto/evp/m_md5_sha1.o" =>
[
".",
"include",
],
"crypto/evp/m_mdc2.o" =>
[
".",
"include",
],
"crypto/evp/m_null.o" =>
[
".",
"include",
],
"crypto/evp/m_ripemd.o" =>
[
".",
"include",
],
"crypto/evp/m_sha1.o" =>
[
".",
"include",
],
"crypto/evp/m_sha3.o" =>
[
".",
"include",
"crypto",
],
"crypto/evp/m_sigver.o" =>
[
".",
"include",
],
"crypto/evp/m_wp.o" =>
[
".",
"include",
],
"crypto/evp/names.o" =>
[
".",
"include",
],
"crypto/evp/p5_crpt.o" =>
[
".",
"include",
],
"crypto/evp/p5_crpt2.o" =>
[
".",
"include",
],
"crypto/evp/p_dec.o" =>
[
".",
"include",
],
"crypto/evp/p_enc.o" =>
[
".",
"include",
],
"crypto/evp/p_lib.o" =>
[
".",
"include",
],
"crypto/evp/p_open.o" =>
[
".",
"include",
],
"crypto/evp/p_seal.o" =>
[
".",
"include",
],
"crypto/evp/p_sign.o" =>
[
".",
"include",
],
"crypto/evp/p_verify.o" =>
[
".",
"include",
],
"crypto/evp/pbe_scrypt.o" =>
[
".",
"include",
],
"crypto/evp/pmeth_fn.o" =>
[
".",
"include",
],
"crypto/evp/pmeth_gn.o" =>
[
".",
"include",
],
"crypto/evp/pmeth_lib.o" =>
[
".",
"include",
],
"crypto/ex_data.o" =>
[
".",
"include",
],
"crypto/getenv.o" =>
[
".",
"include",
],
"crypto/hmac/hm_ameth.o" =>
[
".",
"include",
],
"crypto/hmac/hm_pmeth.o" =>
[
".",
"include",
],
"crypto/hmac/hmac.o" =>
[
".",
"include",
],
"crypto/idea/i_cbc.o" =>
[
".",
"include",
],
"crypto/idea/i_cfb64.o" =>
[
".",
"include",
],
"crypto/idea/i_ecb.o" =>
[
".",
"include",
],
"crypto/idea/i_ofb64.o" =>
[
".",
"include",
],
"crypto/idea/i_skey.o" =>
[
".",
"include",
],
"crypto/init.o" =>
[
".",
"include",
],
"crypto/kdf/hkdf.o" =>
[
".",
"include",
],
"crypto/kdf/kdf_err.o" =>
[
".",
"include",
],
"crypto/kdf/scrypt.o" =>
[
".",
"include",
],
"crypto/kdf/tls1_prf.o" =>
[
".",
"include",
],
"crypto/lhash/lh_stats.o" =>
[
".",
"include",
],
"crypto/lhash/lhash.o" =>
[
".",
"include",
],
"crypto/md4/md4_dgst.o" =>
[
".",
"include",
],
"crypto/md4/md4_one.o" =>
[
".",
"include",
],
"crypto/md5/md5-sparcv9.o" =>
[
"crypto",
],
"crypto/md5/md5_dgst.o" =>
[
".",
"include",
],
"crypto/md5/md5_one.o" =>
[
".",
"include",
],
"crypto/mdc2/mdc2_one.o" =>
[
".",
"include",
],
"crypto/mdc2/mdc2dgst.o" =>
[
".",
"include",
],
"crypto/mem.o" =>
[
".",
"include",
],
"crypto/mem_clr.o" =>
[
".",
"include",
],
"crypto/mem_dbg.o" =>
[
".",
"include",
],
"crypto/mem_sec.o" =>
[
".",
"include",
],
"crypto/modes/cbc128.o" =>
[
".",
"include",
],
"crypto/modes/ccm128.o" =>
[
".",
"include",
],
"crypto/modes/cfb128.o" =>
[
".",
"include",
],
"crypto/modes/ctr128.o" =>
[
".",
"include",
],
"crypto/modes/cts128.o" =>
[
".",
"include",
],
"crypto/modes/gcm128.o" =>
[
".",
"include",
"crypto",
],
"crypto/modes/ghash-armv4.o" =>
[
"crypto",
],
"crypto/modes/ghash-s390x.o" =>
[
"crypto",
],
"crypto/modes/ghash-sparcv9.o" =>
[
"crypto",
],
"crypto/modes/ghashv8-armx.o" =>
[
"crypto",
],
"crypto/modes/ocb128.o" =>
[
".",
"include",
],
"crypto/modes/ofb128.o" =>
[
".",
"include",
],
"crypto/modes/wrap128.o" =>
[
".",
"include",
],
"crypto/modes/xts128.o" =>
[
".",
"include",
],
"crypto/o_dir.o" =>
[
".",
"include",
],
"crypto/o_fips.o" =>
[
".",
"include",
],
"crypto/o_fopen.o" =>
[
".",
"include",
],
"crypto/o_init.o" =>
[
".",
"include",
],
"crypto/o_str.o" =>
[
".",
"include",
],
"crypto/o_time.o" =>
[
".",
"include",
],
"crypto/objects/o_names.o" =>
[
".",
"include",
],
"crypto/objects/obj_dat.o" =>
[
".",
"include",
],
"crypto/objects/obj_err.o" =>
[
".",
"include",
],
"crypto/objects/obj_lib.o" =>
[
".",
"include",
],
"crypto/objects/obj_xref.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_asn.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_cl.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_err.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_ext.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_ht.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_lib.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_prn.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_srv.o" =>
[
".",
"include",
],
"crypto/ocsp/ocsp_vfy.o" =>
[
".",
"include",
],
"crypto/ocsp/v3_ocsp.o" =>
[
".",
"include",
],
"crypto/pem/pem_all.o" =>
[
".",
"include",
],
"crypto/pem/pem_err.o" =>
[
".",
"include",
],
"crypto/pem/pem_info.o" =>
[
".",
"include",
],
"crypto/pem/pem_lib.o" =>
[
".",
"include",
],
"crypto/pem/pem_oth.o" =>
[
".",
"include",
],
"crypto/pem/pem_pk8.o" =>
[
".",
"include",
],
"crypto/pem/pem_pkey.o" =>
[
".",
"include",
],
"crypto/pem/pem_sign.o" =>
[
".",
"include",
],
"crypto/pem/pem_x509.o" =>
[
".",
"include",
],
"crypto/pem/pem_xaux.o" =>
[
".",
"include",
],
"crypto/pem/pvkfmt.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_add.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_asn.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_attr.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_crpt.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_crt.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_decr.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_init.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_key.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_kiss.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_mutl.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_npas.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_p8d.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_p8e.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_sbag.o" =>
[
".",
"include",
],
"crypto/pkcs12/p12_utl.o" =>
[
".",
"include",
],
"crypto/pkcs12/pk12err.o" =>
[
".",
"include",
],
"crypto/pkcs7/bio_pk7.o" =>
[
".",
"include",
],
"crypto/pkcs7/pk7_asn1.o" =>
[
".",
"include",
],
"crypto/pkcs7/pk7_attr.o" =>
[
".",
"include",
],
"crypto/pkcs7/pk7_doit.o" =>
[
".",
"include",
],
"crypto/pkcs7/pk7_lib.o" =>
[
".",
"include",
],
"crypto/pkcs7/pk7_mime.o" =>
[
".",
"include",
],
"crypto/pkcs7/pk7_smime.o" =>
[
".",
"include",
],
"crypto/pkcs7/pkcs7err.o" =>
[
".",
"include",
],
"crypto/poly1305/poly1305-armv4.o" =>
[
"crypto",
],
"crypto/poly1305/poly1305-armv8.o" =>
[
"crypto",
],
"crypto/poly1305/poly1305-mips.o" =>
[
"crypto",
],
"crypto/poly1305/poly1305-sparcv9.o" =>
[
"crypto",
],
"crypto/poly1305/poly1305.o" =>
[
".",
"include",
],
"crypto/poly1305/poly1305_ameth.o" =>
[
".",
"include",
],
"crypto/poly1305/poly1305_pmeth.o" =>
[
".",
"include",
],
"crypto/rand/drbg_ctr.o" =>
[
".",
"include",
"crypto/modes",
],
"crypto/rand/drbg_lib.o" =>
[
".",
"include",
],
"crypto/rand/rand_egd.o" =>
[
".",
"include",
],
"crypto/rand/rand_err.o" =>
[
".",
"include",
],
"crypto/rand/rand_lib.o" =>
[
".",
"include",
],
"crypto/rand/rand_unix.o" =>
[
".",
"include",
],
"crypto/rand/rand_vms.o" =>
[
".",
"include",
],
"crypto/rand/rand_win.o" =>
[
".",
"include",
],
"crypto/rand/randfile.o" =>
[
".",
"include",
],
"crypto/rc2/rc2_cbc.o" =>
[
".",
"include",
],
"crypto/rc2/rc2_ecb.o" =>
[
".",
"include",
],
"crypto/rc2/rc2_skey.o" =>
[
".",
"include",
],
"crypto/rc2/rc2cfb64.o" =>
[
".",
"include",
],
"crypto/rc2/rc2ofb64.o" =>
[
".",
"include",
],
"crypto/rc4/rc4_enc.o" =>
[
".",
"include",
],
"crypto/rc4/rc4_skey.o" =>
[
".",
"include",
],
"crypto/ripemd/rmd_dgst.o" =>
[
".",
"include",
],
"crypto/ripemd/rmd_one.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_ameth.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_asn1.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_chk.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_crpt.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_depr.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_err.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_gen.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_lib.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_meth.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_mp.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_none.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_oaep.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_ossl.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_pk1.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_pmeth.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_prn.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_pss.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_saos.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_sign.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_ssl.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_x931.o" =>
[
".",
"include",
],
"crypto/rsa/rsa_x931g.o" =>
[
".",
"include",
],
"crypto/s390xcpuid.o" =>
[
"crypto",
],
"crypto/seed/seed.o" =>
[
".",
"include",
],
"crypto/seed/seed_cbc.o" =>
[
".",
"include",
],
"crypto/seed/seed_cfb.o" =>
[
".",
"include",
],
"crypto/seed/seed_ecb.o" =>
[
".",
"include",
],
"crypto/seed/seed_ofb.o" =>
[
".",
"include",
],
"crypto/sha/keccak1600-armv4.o" =>
[
"crypto",
],
"crypto/sha/keccak1600.o" =>
[
".",
"include",
],
"crypto/sha/sha1-armv4-large.o" =>
[
"crypto",
],
"crypto/sha/sha1-armv8.o" =>
[
"crypto",
],
"crypto/sha/sha1-mips.o" =>
[
"crypto",
],
"crypto/sha/sha1-s390x.o" =>
[
"crypto",
],
"crypto/sha/sha1-sparcv9.o" =>
[
"crypto",
],
"crypto/sha/sha1_one.o" =>
[
".",
"include",
],
"crypto/sha/sha1dgst.o" =>
[
".",
"include",
],
"crypto/sha/sha256-armv4.o" =>
[
"crypto",
],
"crypto/sha/sha256-armv8.o" =>
[
"crypto",
],
"crypto/sha/sha256-mips.o" =>
[
"crypto",
],
"crypto/sha/sha256-s390x.o" =>
[
"crypto",
],
"crypto/sha/sha256-sparcv9.o" =>
[
"crypto",
],
"crypto/sha/sha256.o" =>
[
".",
"include",
],
"crypto/sha/sha512-armv4.o" =>
[
"crypto",
],
"crypto/sha/sha512-armv8.o" =>
[
"crypto",
],
"crypto/sha/sha512-mips.o" =>
[
"crypto",
],
"crypto/sha/sha512-s390x.o" =>
[
"crypto",
],
"crypto/sha/sha512-sparcv9.o" =>
[
"crypto",
],
"crypto/sha/sha512.o" =>
[
".",
"include",
],
"crypto/siphash/siphash.o" =>
[
".",
"include",
],
"crypto/siphash/siphash_ameth.o" =>
[
".",
"include",
],
"crypto/siphash/siphash_pmeth.o" =>
[
".",
"include",
],
"crypto/sm2/sm2_crypt.o" =>
[
".",
"include",
],
"crypto/sm2/sm2_err.o" =>
[
".",
"include",
],
"crypto/sm2/sm2_pmeth.o" =>
[
".",
"include",
],
"crypto/sm2/sm2_sign.o" =>
[
".",
"include",
],
"crypto/sm3/m_sm3.o" =>
[
".",
"include",
],
"crypto/sm3/sm3.o" =>
[
".",
"include",
],
"crypto/sm4/sm4.o" =>
[
".",
"include",
],
"crypto/srp/srp_lib.o" =>
[
".",
"include",
],
"crypto/srp/srp_vfy.o" =>
[
".",
"include",
],
"crypto/stack/stack.o" =>
[
".",
"include",
],
"crypto/store/loader_file.o" =>
[
".",
"include",
],
"crypto/store/store_err.o" =>
[
".",
"include",
],
"crypto/store/store_init.o" =>
[
".",
"include",
],
"crypto/store/store_lib.o" =>
[
".",
"include",
],
"crypto/store/store_register.o" =>
[
".",
"include",
],
"crypto/store/store_strings.o" =>
[
".",
"include",
],
"crypto/threads_none.o" =>
[
".",
"include",
],
"crypto/threads_pthread.o" =>
[
".",
"include",
],
"crypto/threads_win.o" =>
[
".",
"include",
],
"crypto/ts/ts_asn1.o" =>
[
".",
"include",
],
"crypto/ts/ts_conf.o" =>
[
".",
"include",
],
"crypto/ts/ts_err.o" =>
[
".",
"include",
],
"crypto/ts/ts_lib.o" =>
[
".",
"include",
],
"crypto/ts/ts_req_print.o" =>
[
".",
"include",
],
"crypto/ts/ts_req_utils.o" =>
[
".",
"include",
],
"crypto/ts/ts_rsp_print.o" =>
[
".",
"include",
],
"crypto/ts/ts_rsp_sign.o" =>
[
".",
"include",
],
"crypto/ts/ts_rsp_utils.o" =>
[
".",
"include",
],
"crypto/ts/ts_rsp_verify.o" =>
[
".",
"include",
],
"crypto/ts/ts_verify_ctx.o" =>
[
".",
"include",
],
"crypto/txt_db/txt_db.o" =>
[
".",
"include",
],
"crypto/ui/ui_err.o" =>
[
".",
"include",
],
"crypto/ui/ui_lib.o" =>
[
".",
"include",
],
"crypto/ui/ui_null.o" =>
[
".",
"include",
],
"crypto/ui/ui_openssl.o" =>
[
".",
"include",
],
"crypto/ui/ui_util.o" =>
[
".",
"include",
],
"crypto/uid.o" =>
[
".",
"include",
],
"crypto/whrlpool/wp_block.o" =>
[
".",
"include",
],
"crypto/whrlpool/wp_dgst.o" =>
[
".",
"include",
],
"crypto/x509/by_dir.o" =>
[
".",
"include",
],
"crypto/x509/by_file.o" =>
[
".",
"include",
],
"crypto/x509/t_crl.o" =>
[
".",
"include",
],
"crypto/x509/t_req.o" =>
[
".",
"include",
],
"crypto/x509/t_x509.o" =>
[
".",
"include",
],
"crypto/x509/x509_att.o" =>
[
".",
"include",
],
"crypto/x509/x509_cmp.o" =>
[
".",
"include",
],
"crypto/x509/x509_d2.o" =>
[
".",
"include",
],
"crypto/x509/x509_def.o" =>
[
".",
"include",
],
"crypto/x509/x509_err.o" =>
[
".",
"include",
],
"crypto/x509/x509_ext.o" =>
[
".",
"include",
],
"crypto/x509/x509_lu.o" =>
[
".",
"include",
],
"crypto/x509/x509_meth.o" =>
[
".",
"include",
],
"crypto/x509/x509_obj.o" =>
[
".",
"include",
],
"crypto/x509/x509_r2x.o" =>
[
".",
"include",
],
"crypto/x509/x509_req.o" =>
[
".",
"include",
],
"crypto/x509/x509_set.o" =>
[
".",
"include",
],
"crypto/x509/x509_trs.o" =>
[
".",
"include",
],
"crypto/x509/x509_txt.o" =>
[
".",
"include",
],
"crypto/x509/x509_v3.o" =>
[
".",
"include",
],
"crypto/x509/x509_vfy.o" =>
[
".",
"include",
],
"crypto/x509/x509_vpm.o" =>
[
".",
"include",
],
"crypto/x509/x509cset.o" =>
[
".",
"include",
],
"crypto/x509/x509name.o" =>
[
".",
"include",
],
"crypto/x509/x509rset.o" =>
[
".",
"include",
],
"crypto/x509/x509spki.o" =>
[
".",
"include",
],
"crypto/x509/x509type.o" =>
[
".",
"include",
],
"crypto/x509/x_all.o" =>
[
".",
"include",
],
"crypto/x509/x_attrib.o" =>
[
".",
"include",
],
"crypto/x509/x_crl.o" =>
[
".",
"include",
],
"crypto/x509/x_exten.o" =>
[
".",
"include",
],
"crypto/x509/x_name.o" =>
[
".",
"include",
],
"crypto/x509/x_pubkey.o" =>
[
".",
"include",
],
"crypto/x509/x_req.o" =>
[
".",
"include",
],
"crypto/x509/x_x509.o" =>
[
".",
"include",
],
"crypto/x509/x_x509a.o" =>
[
".",
"include",
],
"crypto/x509v3/pcy_cache.o" =>
[
".",
"include",
],
"crypto/x509v3/pcy_data.o" =>
[
".",
"include",
],
"crypto/x509v3/pcy_lib.o" =>
[
".",
"include",
],
"crypto/x509v3/pcy_map.o" =>
[
".",
"include",
],
"crypto/x509v3/pcy_node.o" =>
[
".",
"include",
],
"crypto/x509v3/pcy_tree.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_addr.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_admis.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_akey.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_akeya.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_alt.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_asid.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_bcons.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_bitst.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_conf.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_cpols.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_crld.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_enum.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_extku.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_genn.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_ia5.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_info.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_int.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_lib.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_ncons.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_pci.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_pcia.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_pcons.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_pku.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_pmaps.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_prn.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_purp.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_skey.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_sxnet.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_tlsf.o" =>
[
".",
"include",
],
"crypto/x509v3/v3_utl.o" =>
[
".",
"include",
],
"crypto/x509v3/v3err.o" =>
[
".",
"include",
],
"engines/e_capi.o" =>
[
".",
"include",
],
"engines/e_padlock.o" =>
[
".",
"include",
],
"fuzz/asn1.o" =>
[
"include",
],
"fuzz/asn1parse.o" =>
[
"include",
],
"fuzz/bignum.o" =>
[
"include",
],
"fuzz/bndiv.o" =>
[
"include",
],
"fuzz/client.o" =>
[
"include",
],
"fuzz/cms.o" =>
[
"include",
],
"fuzz/conf.o" =>
[
"include",
],
"fuzz/crl.o" =>
[
"include",
],
"fuzz/ct.o" =>
[
"include",
],
"fuzz/server.o" =>
[
"include",
],
"fuzz/test-corpus.o" =>
[
"include",
],
"fuzz/x509.o" =>
[
"include",
],
"include/crypto/bn_conf.h" =>
[
".",
],
"include/crypto/dso_conf.h" =>
[
".",
],
"include/openssl/opensslconf.h" =>
[
".",
],
"ssl/bio_ssl.o" =>
[
".",
"include",
],
"ssl/d1_lib.o" =>
[
".",
"include",
],
"ssl/d1_msg.o" =>
[
".",
"include",
],
"ssl/d1_srtp.o" =>
[
".",
"include",
],
"ssl/methods.o" =>
[
".",
"include",
],
"ssl/packet.o" =>
[
".",
"include",
],
"ssl/pqueue.o" =>
[
".",
"include",
],
"ssl/record/dtls1_bitmap.o" =>
[
".",
"include",
],
"ssl/record/rec_layer_d1.o" =>
[
".",
"include",
],
"ssl/record/rec_layer_s3.o" =>
[
".",
"include",
],
"ssl/record/ssl3_buffer.o" =>
[
".",
"include",
],
"ssl/record/ssl3_record.o" =>
[
".",
"include",
],
"ssl/record/ssl3_record_tls13.o" =>
[
".",
"include",
],
"ssl/s3_cbc.o" =>
[
".",
"include",
],
"ssl/s3_enc.o" =>
[
".",
"include",
],
"ssl/s3_lib.o" =>
[
".",
"include",
],
"ssl/s3_msg.o" =>
[
".",
"include",
],
"ssl/ssl_asn1.o" =>
[
".",
"include",
],
"ssl/ssl_cert.o" =>
[
".",
"include",
],
"ssl/ssl_ciph.o" =>
[
".",
"include",
],
"ssl/ssl_conf.o" =>
[
".",
"include",
],
"ssl/ssl_err.o" =>
[
".",
"include",
],
"ssl/ssl_init.o" =>
[
".",
"include",
],
"ssl/ssl_lib.o" =>
[
".",
"include",
],
"ssl/ssl_mcnf.o" =>
[
".",
"include",
],
"ssl/ssl_quic.o" =>
[
".",
"include",
],
"ssl/ssl_rsa.o" =>
[
".",
"include",
],
"ssl/ssl_sess.o" =>
[
".",
"include",
],
"ssl/ssl_stat.o" =>
[
".",
"include",
],
"ssl/ssl_txt.o" =>
[
".",
"include",
],
"ssl/ssl_utst.o" =>
[
".",
"include",
],
"ssl/statem/extensions.o" =>
[
".",
"include",
],
"ssl/statem/extensions_clnt.o" =>
[
".",
"include",
],
"ssl/statem/extensions_cust.o" =>
[
".",
"include",
],
"ssl/statem/extensions_srvr.o" =>
[
".",
"include",
],
"ssl/statem/statem.o" =>
[
".",
"include",
],
"ssl/statem/statem_clnt.o" =>
[
".",
"include",
],
"ssl/statem/statem_dtls.o" =>
[
".",
"include",
],
"ssl/statem/statem_lib.o" =>
[
".",
"include",
],
"ssl/statem/statem_quic.o" =>
[
".",
"include",
],
"ssl/statem/statem_srvr.o" =>
[
".",
"include",
],
"ssl/t1_enc.o" =>
[
".",
"include",
],
"ssl/t1_lib.o" =>
[
".",
"include",
],
"ssl/t1_trce.o" =>
[
".",
"include",
],
"ssl/tls13_enc.o" =>
[
".",
"include",
],
"ssl/tls_srp.o" =>
[
".",
"include",
],
"test/aborttest.o" =>
[
"include",
],
"test/afalgtest.o" =>
[
"include",
],
"test/asn1_decode_test.o" =>
[
"include",
],
"test/asn1_encode_test.o" =>
[
"include",
],
"test/asn1_internal_test.o" =>
[
".",
"include",
],
"test/asn1_string_table_test.o" =>
[
"include",
],
"test/asn1_time_test.o" =>
[
"include",
],
"test/asynciotest.o" =>
[
"include",
],
"test/asynctest.o" =>
[
"include",
],
"test/bad_dtls_test.o" =>
[
"include",
],
"test/bftest.o" =>
[
"include",
],
"test/bio_callback_test.o" =>
[
"include",
],
"test/bio_enc_test.o" =>
[
"include",
],
"test/bio_memleak_test.o" =>
[
"include",
],
"test/bioprinttest.o" =>
[
"include",
],
"test/bntest.o" =>
[
"include",
],
"test/buildtest_aes.o" =>
[
"include",
],
"test/buildtest_asn1.o" =>
[
"include",
],
"test/buildtest_asn1t.o" =>
[
"include",
],
"test/buildtest_async.o" =>
[
"include",
],
"test/buildtest_bio.o" =>
[
"include",
],
"test/buildtest_blowfish.o" =>
[
"include",
],
"test/buildtest_bn.o" =>
[
"include",
],
"test/buildtest_buffer.o" =>
[
"include",
],
"test/buildtest_camellia.o" =>
[
"include",
],
"test/buildtest_cast.o" =>
[
"include",
],
"test/buildtest_cmac.o" =>
[
"include",
],
"test/buildtest_cms.o" =>
[
"include",
],
"test/buildtest_conf.o" =>
[
"include",
],
"test/buildtest_conf_api.o" =>
[
"include",
],
"test/buildtest_crypto.o" =>
[
"include",
],
"test/buildtest_ct.o" =>
[
"include",
],
"test/buildtest_des.o" =>
[
"include",
],
"test/buildtest_dh.o" =>
[
"include",
],
"test/buildtest_dsa.o" =>
[
"include",
],
"test/buildtest_dtls1.o" =>
[
"include",
],
"test/buildtest_e_os2.o" =>
[
"include",
],
"test/buildtest_ebcdic.o" =>
[
"include",
],
"test/buildtest_ec.o" =>
[
"include",
],
"test/buildtest_ecdh.o" =>
[
"include",
],
"test/buildtest_ecdsa.o" =>
[
"include",
],
"test/buildtest_engine.o" =>
[
"include",
],
"test/buildtest_evp.o" =>
[
"include",
],
"test/buildtest_hmac.o" =>
[
"include",
],
"test/buildtest_idea.o" =>
[
"include",
],
"test/buildtest_kdf.o" =>
[
"include",
],
"test/buildtest_lhash.o" =>
[
"include",
],
"test/buildtest_md4.o" =>
[
"include",
],
"test/buildtest_md5.o" =>
[
"include",
],
"test/buildtest_mdc2.o" =>
[
"include",
],
"test/buildtest_modes.o" =>
[
"include",
],
"test/buildtest_obj_mac.o" =>
[
"include",
],
"test/buildtest_objects.o" =>
[
"include",
],
"test/buildtest_ocsp.o" =>
[
"include",
],
"test/buildtest_opensslv.o" =>
[
"include",
],
"test/buildtest_ossl_typ.o" =>
[
"include",
],
"test/buildtest_pem.o" =>
[
"include",
],
"test/buildtest_pem2.o" =>
[
"include",
],
"test/buildtest_pkcs12.o" =>
[
"include",
],
"test/buildtest_pkcs7.o" =>
[
"include",
],
"test/buildtest_rand.o" =>
[
"include",
],
"test/buildtest_rand_drbg.o" =>
[
"include",
],
"test/buildtest_rc2.o" =>
[
"include",
],
"test/buildtest_rc4.o" =>
[
"include",
],
"test/buildtest_ripemd.o" =>
[
"include",
],
"test/buildtest_rsa.o" =>
[
"include",
],
"test/buildtest_safestack.o" =>
[
"include",
],
"test/buildtest_seed.o" =>
[
"include",
],
"test/buildtest_sha.o" =>
[
"include",
],
"test/buildtest_srp.o" =>
[
"include",
],
"test/buildtest_srtp.o" =>
[
"include",
],
"test/buildtest_ssl.o" =>
[
"include",
],
"test/buildtest_ssl2.o" =>
[
"include",
],
"test/buildtest_stack.o" =>
[
"include",
],
"test/buildtest_store.o" =>
[
"include",
],
"test/buildtest_symhacks.o" =>
[
"include",
],
"test/buildtest_tls1.o" =>
[
"include",
],
"test/buildtest_ts.o" =>
[
"include",
],
"test/buildtest_txt_db.o" =>
[
"include",
],
"test/buildtest_ui.o" =>
[
"include",
],
"test/buildtest_whrlpool.o" =>
[
"include",
],
"test/buildtest_x509.o" =>
[
"include",
],
"test/buildtest_x509_vfy.o" =>
[
"include",
],
"test/buildtest_x509v3.o" =>
[
"include",
],
"test/casttest.o" =>
[
"include",
],
"test/chacha_internal_test.o" =>
[
".",
"include",
],
"test/cipher_overhead_test.o" =>
[
".",
"include",
],
"test/cipherbytes_test.o" =>
[
"include",
],
"test/cipherlist_test.o" =>
[
"include",
],
"test/ciphername_test.o" =>
[
"include",
],
"test/clienthellotest.o" =>
[
"include",
],
"test/cmactest.o" =>
[
"include",
],
"test/cmsapitest.o" =>
[
"include",
],
"test/conf_include_test.o" =>
[
"include",
],
"test/constant_time_test.o" =>
[
"include",
],
"test/crltest.o" =>
[
"include",
],
"test/ct_test.o" =>
[
"include",
],
"test/ctype_internal_test.o" =>
[
".",
"include",
],
"test/curve448_internal_test.o" =>
[
".",
"include",
"crypto/ec/curve448",
],
"test/d2i_test.o" =>
[
"include",
],
"test/danetest.o" =>
[
"include",
],
"test/destest.o" =>
[
"include",
],
"test/dhtest.o" =>
[
"include",
],
"test/drbg_cavs_data.o" =>
[
"include",
"test",
".",
],
"test/drbg_cavs_test.o" =>
[
"include",
"test",
".",
],
"test/drbgtest.o" =>
[
"include",
],
"test/dsa_no_digest_size_test.o" =>
[
"include",
],
"test/dsatest.o" =>
[
"include",
],
"test/dtls_mtu_test.o" =>
[
".",
"include",
],
"test/dtlstest.o" =>
[
"include",
],
"test/dtlsv1listentest.o" =>
[
"include",
],
"test/ec_internal_test.o" =>
[
"include",
"crypto/ec",
],
"test/ecdsatest.o" =>
[
"include",
],
"test/ecstresstest.o" =>
[
"include",
],
"test/ectest.o" =>
[
"include",
],
"test/enginetest.o" =>
[
"include",
],
"test/errtest.o" =>
[
"include",
],
"test/evp_extra_test.o" =>
[
"include",
],
"test/evp_test.o" =>
[
"include",
],
"test/exdatatest.o" =>
[
"include",
],
"test/exptest.o" =>
[
"include",
],
"test/fatalerrtest.o" =>
[
"include",
],
"test/gmdifftest.o" =>
[
"include",
],
"test/gosttest.o" =>
[
"include",
".",
],
"test/handshake_helper.o" =>
[
".",
"include",
],
"test/hmactest.o" =>
[
"include",
],
"test/ideatest.o" =>
[
"include",
],
"test/igetest.o" =>
[
"include",
],
"test/lhash_test.o" =>
[
"include",
],
"test/md2test.o" =>
[
"include",
],
"test/mdc2_internal_test.o" =>
[
".",
"include",
],
"test/mdc2test.o" =>
[
"include",
],
"test/memleaktest.o" =>
[
"include",
],
"test/modes_internal_test.o" =>
[
".",
"include",
],
"test/ocspapitest.o" =>
[
"include",
],
"test/packettest.o" =>
[
"include",
],
"test/pbelutest.o" =>
[
"include",
],
"test/pemtest.o" =>
[
"include",
],
"test/pkey_meth_kdf_test.o" =>
[
"include",
],
"test/pkey_meth_test.o" =>
[
"include",
],
"test/poly1305_internal_test.o" =>
[
".",
"include",
],
"test/rc2test.o" =>
[
"include",
],
"test/rc4test.o" =>
[
"include",
],
"test/rc5test.o" =>
[
"include",
],
"test/rdrand_sanitytest.o" =>
[
"include",
],
"test/recordlentest.o" =>
[
"include",
],
"test/rsa_complex.o" =>
[
"include",
],
"test/rsa_mp_test.o" =>
[
"include",
],
"test/rsa_test.o" =>
[
"include",
],
"test/sanitytest.o" =>
[
"include",
],
"test/secmemtest.o" =>
[
"include",
],
"test/servername_test.o" =>
[
"include",
],
"test/siphash_internal_test.o" =>
[
".",
"include",
],
"test/sm2_internal_test.o" =>
[
"include",
],
"test/sm4_internal_test.o" =>
[
".",
"include",
],
"test/srptest.o" =>
[
"include",
],
"test/ssl_cert_table_internal_test.o" =>
[
".",
"include",
],
"test/ssl_ctx_test.o" =>
[
"include",
],
"test/ssl_test.o" =>
[
"include",
],
"test/ssl_test_ctx.o" =>
[
"include",
],
"test/ssl_test_ctx_test.o" =>
[
"include",
],
"test/sslapitest.o" =>
[
"include",
".",
],
"test/sslbuffertest.o" =>
[
"include",
],
"test/sslcorrupttest.o" =>
[
"include",
],
"test/ssltest_old.o" =>
[
".",
"include",
],
"test/ssltestlib.o" =>
[
".",
"include",
],
"test/stack_test.o" =>
[
"include",
],
"test/sysdefaulttest.o" =>
[
"include",
],
"test/test_test.o" =>
[
"include",
],
"test/testutil/basic_output.o" =>
[
"include",
],
"test/testutil/cb.o" =>
[
"include",
],
"test/testutil/driver.o" =>
[
"include",
],
"test/testutil/format_output.o" =>
[
"include",
],
"test/testutil/main.o" =>
[
"include",
],
"test/testutil/output_helpers.o" =>
[
"include",
],
"test/testutil/random.o" =>
[
"include",
],
"test/testutil/stanza.o" =>
[
"include",
],
"test/testutil/tap_bio.o" =>
[
"include",
],
"test/testutil/test_cleanup.o" =>
[
"include",
],
"test/testutil/tests.o" =>
[
"include",
],
"test/testutil/testutil_init.o" =>
[
"include",
],
"test/threadstest.o" =>
[
"include",
],
"test/time_offset_test.o" =>
[
"include",
],
"test/tls13ccstest.o" =>
[
"include",
],
"test/tls13encryptiontest.o" =>
[
".",
"include",
],
"test/uitest.o" =>
[
".",
"include",
"apps",
],
"test/v3ext.o" =>
[
"include",
],
"test/v3nametest.o" =>
[
"include",
],
"test/verify_extra_test.o" =>
[
"include",
],
"test/versions.o" =>
[
"include",
],
"test/wpackettest.o" =>
[
"include",
],
"test/x509_check_cert_pkey_test.o" =>
[
"include",
],
"test/x509_dup_cert_test.o" =>
[
"include",
],
"test/x509_internal_test.o" =>
[
".",
"include",
],
"test/x509_time_test.o" =>
[
"include",
],
"test/x509aux.o" =>
[
"include",
],
},
"install" =>
{
"libraries" =>
[
"libcrypto",
"libssl",
],
"programs" =>
[
"apps/openssl",
],
"scripts" =>
[
"apps/CA.pl",
"apps/tsget.pl",
"tools/c_rehash",
],
},
"ldadd" =>
{
},
"libraries" =>
[
"apps/libapps.a",
"libcrypto",
"libssl",
"test/libtestutil.a",
],
"overrides" =>
[
],
"programs" =>
[
"apps/openssl",
"fuzz/asn1-test",
"fuzz/asn1parse-test",
"fuzz/bignum-test",
"fuzz/bndiv-test",
"fuzz/client-test",
"fuzz/cms-test",
"fuzz/conf-test",
"fuzz/crl-test",
"fuzz/ct-test",
"fuzz/server-test",
"fuzz/x509-test",
"test/aborttest",
"test/afalgtest",
"test/asn1_decode_test",
"test/asn1_encode_test",
"test/asn1_internal_test",
"test/asn1_string_table_test",
"test/asn1_time_test",
"test/asynciotest",
"test/asynctest",
"test/bad_dtls_test",
"test/bftest",
"test/bio_callback_test",
"test/bio_enc_test",
"test/bio_memleak_test",
"test/bioprinttest",
"test/bntest",
"test/buildtest_c_aes",
"test/buildtest_c_asn1",
"test/buildtest_c_asn1t",
"test/buildtest_c_async",
"test/buildtest_c_bio",
"test/buildtest_c_blowfish",
"test/buildtest_c_bn",
"test/buildtest_c_buffer",
"test/buildtest_c_camellia",
"test/buildtest_c_cast",
"test/buildtest_c_cmac",
"test/buildtest_c_cms",
"test/buildtest_c_conf",
"test/buildtest_c_conf_api",
"test/buildtest_c_crypto",
"test/buildtest_c_ct",
"test/buildtest_c_des",
"test/buildtest_c_dh",
"test/buildtest_c_dsa",
"test/buildtest_c_dtls1",
"test/buildtest_c_e_os2",
"test/buildtest_c_ebcdic",
"test/buildtest_c_ec",
"test/buildtest_c_ecdh",
"test/buildtest_c_ecdsa",
"test/buildtest_c_engine",
"test/buildtest_c_evp",
"test/buildtest_c_hmac",
"test/buildtest_c_idea",
"test/buildtest_c_kdf",
"test/buildtest_c_lhash",
"test/buildtest_c_md4",
"test/buildtest_c_md5",
"test/buildtest_c_mdc2",
"test/buildtest_c_modes",
"test/buildtest_c_obj_mac",
"test/buildtest_c_objects",
"test/buildtest_c_ocsp",
"test/buildtest_c_opensslv",
"test/buildtest_c_ossl_typ",
"test/buildtest_c_pem",
"test/buildtest_c_pem2",
"test/buildtest_c_pkcs12",
"test/buildtest_c_pkcs7",
"test/buildtest_c_rand",
"test/buildtest_c_rand_drbg",
"test/buildtest_c_rc2",
"test/buildtest_c_rc4",
"test/buildtest_c_ripemd",
"test/buildtest_c_rsa",
"test/buildtest_c_safestack",
"test/buildtest_c_seed",
"test/buildtest_c_sha",
"test/buildtest_c_srp",
"test/buildtest_c_srtp",
"test/buildtest_c_ssl",
"test/buildtest_c_ssl2",
"test/buildtest_c_stack",
"test/buildtest_c_store",
"test/buildtest_c_symhacks",
"test/buildtest_c_tls1",
"test/buildtest_c_ts",
"test/buildtest_c_txt_db",
"test/buildtest_c_ui",
"test/buildtest_c_whrlpool",
"test/buildtest_c_x509",
"test/buildtest_c_x509_vfy",
"test/buildtest_c_x509v3",
"test/casttest",
"test/chacha_internal_test",
"test/cipher_overhead_test",
"test/cipherbytes_test",
"test/cipherlist_test",
"test/ciphername_test",
"test/clienthellotest",
"test/cmactest",
"test/cmsapitest",
"test/conf_include_test",
"test/constant_time_test",
"test/crltest",
"test/ct_test",
"test/ctype_internal_test",
"test/curve448_internal_test",
"test/d2i_test",
"test/danetest",
"test/destest",
"test/dhtest",
"test/drbg_cavs_test",
"test/drbgtest",
"test/dsa_no_digest_size_test",
"test/dsatest",
"test/dtls_mtu_test",
"test/dtlstest",
"test/dtlsv1listentest",
"test/ec_internal_test",
"test/ecdsatest",
"test/ecstresstest",
"test/ectest",
"test/enginetest",
"test/errtest",
"test/evp_extra_test",
"test/evp_test",
"test/exdatatest",
"test/exptest",
"test/fatalerrtest",
"test/gmdifftest",
"test/gosttest",
"test/hmactest",
"test/ideatest",
"test/igetest",
"test/lhash_test",
"test/md2test",
"test/mdc2_internal_test",
"test/mdc2test",
"test/memleaktest",
"test/modes_internal_test",
"test/ocspapitest",
"test/packettest",
"test/pbelutest",
"test/pemtest",
"test/pkey_meth_kdf_test",
"test/pkey_meth_test",
"test/poly1305_internal_test",
"test/rc2test",
"test/rc4test",
"test/rc5test",
"test/rdrand_sanitytest",
"test/recordlentest",
"test/rsa_complex",
"test/rsa_mp_test",
"test/rsa_test",
"test/sanitytest",
"test/secmemtest",
"test/servername_test",
"test/siphash_internal_test",
"test/sm2_internal_test",
"test/sm4_internal_test",
"test/srptest",
"test/ssl_cert_table_internal_test",
"test/ssl_ctx_test",
"test/ssl_test",
"test/ssl_test_ctx_test",
"test/sslapitest",
"test/sslbuffertest",
"test/sslcorrupttest",
"test/ssltest_old",
"test/stack_test",
"test/sysdefaulttest",
"test/test_test",
"test/threadstest",
"test/time_offset_test",
"test/tls13ccstest",
"test/tls13encryptiontest",
"test/uitest",
"test/v3ext",
"test/v3nametest",
"test/verify_extra_test",
"test/versions",
"test/wpackettest",
"test/x509_check_cert_pkey_test",
"test/x509_dup_cert_test",
"test/x509_internal_test",
"test/x509_time_test",
"test/x509aux",
],
"rawlines" =>
[
"##### SHA assembler implementations",
"",
"# GNU make \"catch all\"",
"crypto/sha/sha1-%.S: crypto/sha/asm/sha1-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"crypto/sha/sha256-%.S: crypto/sha/asm/sha512-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"crypto/sha/sha512-%.S: crypto/sha/asm/sha512-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"crypto/poly1305/poly1305-%.S: crypto/poly1305/asm/poly1305-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"##### AES assembler implementations",
"",
"# GNU make \"catch all\"",
"crypto/aes/aes-%.S: crypto/aes/asm/aes-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"crypto/aes/bsaes-%.S: crypto/aes/asm/bsaes-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"",
"# GNU make \"catch all\"",
"crypto/rc4/rc4-%.s: crypto/rc4/asm/rc4-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"##### CHACHA assembler implementations",
"",
"crypto/chacha/chacha-%.S: crypto/chacha/asm/chacha-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"# GNU make \"catch all\"",
"crypto/modes/ghash-%.S: crypto/modes/asm/ghash-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
"crypto/ec/ecp_nistz256-%.S: crypto/ec/asm/ecp_nistz256-%.pl",
" CC=\"\$(CC)\" \$(PERL) \$< \$(PERLASM_SCHEME) \$\@",
],
"rename" =>
{
},
"scripts" =>
[
"apps/CA.pl",
"apps/tsget.pl",
"tools/c_rehash",
"util/shlib_wrap.sh",
],
"shared_sources" =>
{
},
"sources" =>
{
"apps/CA.pl" =>
[
"apps/CA.pl.in",
],
"apps/app_rand.o" =>
[
"apps/app_rand.c",
],
"apps/apps.o" =>
[
"apps/apps.c",
],
"apps/asn1pars.o" =>
[
"apps/asn1pars.c",
],
"apps/bf_prefix.o" =>
[
"apps/bf_prefix.c",
],
"apps/ca.o" =>
[
"apps/ca.c",
],
"apps/ciphers.o" =>
[
"apps/ciphers.c",
],
"apps/cms.o" =>
[
"apps/cms.c",
],
"apps/crl.o" =>
[
"apps/crl.c",
],
"apps/crl2p7.o" =>
[
"apps/crl2p7.c",
],
"apps/dgst.o" =>
[
"apps/dgst.c",
],
"apps/dhparam.o" =>
[
"apps/dhparam.c",
],
"apps/dsa.o" =>
[
"apps/dsa.c",
],
"apps/dsaparam.o" =>
[
"apps/dsaparam.c",
],
"apps/ec.o" =>
[
"apps/ec.c",
],
"apps/ecparam.o" =>
[
"apps/ecparam.c",
],
"apps/enc.o" =>
[
"apps/enc.c",
],
"apps/engine.o" =>
[
"apps/engine.c",
],
"apps/errstr.o" =>
[
"apps/errstr.c",
],
"apps/gendsa.o" =>
[
"apps/gendsa.c",
],
"apps/genpkey.o" =>
[
"apps/genpkey.c",
],
"apps/genrsa.o" =>
[
"apps/genrsa.c",
],
"apps/libapps.a" =>
[
"apps/app_rand.o",
"apps/apps.o",
"apps/bf_prefix.o",
"apps/opt.o",
"apps/s_cb.o",
"apps/s_socket.o",
],
"apps/nseq.o" =>
[
"apps/nseq.c",
],
"apps/ocsp.o" =>
[
"apps/ocsp.c",
],
"apps/openssl" =>
[
"apps/asn1pars.o",
"apps/ca.o",
"apps/ciphers.o",
"apps/cms.o",
"apps/crl.o",
"apps/crl2p7.o",
"apps/dgst.o",
"apps/dhparam.o",
"apps/dsa.o",
"apps/dsaparam.o",
"apps/ec.o",
"apps/ecparam.o",
"apps/enc.o",
"apps/engine.o",
"apps/errstr.o",
"apps/gendsa.o",
"apps/genpkey.o",
"apps/genrsa.o",
"apps/nseq.o",
"apps/ocsp.o",
"apps/openssl.o",
"apps/passwd.o",
"apps/pkcs12.o",
"apps/pkcs7.o",
"apps/pkcs8.o",
"apps/pkey.o",
"apps/pkeyparam.o",
"apps/pkeyutl.o",
"apps/prime.o",
"apps/rand.o",
"apps/rehash.o",
"apps/req.o",
"apps/rsa.o",
"apps/rsautl.o",
"apps/s_client.o",
"apps/s_server.o",
"apps/s_time.o",
"apps/sess_id.o",
"apps/smime.o",
"apps/speed.o",
"apps/spkac.o",
"apps/srp.o",
"apps/storeutl.o",
"apps/ts.o",
"apps/verify.o",
"apps/version.o",
"apps/x509.o",
],
"apps/openssl.o" =>
[
"apps/openssl.c",
],
"apps/opt.o" =>
[
"apps/opt.c",
],
"apps/passwd.o" =>
[
"apps/passwd.c",
],
"apps/pkcs12.o" =>
[
"apps/pkcs12.c",
],
"apps/pkcs7.o" =>
[
"apps/pkcs7.c",
],
"apps/pkcs8.o" =>
[
"apps/pkcs8.c",
],
"apps/pkey.o" =>
[
"apps/pkey.c",
],
"apps/pkeyparam.o" =>
[
"apps/pkeyparam.c",
],
"apps/pkeyutl.o" =>
[
"apps/pkeyutl.c",
],
"apps/prime.o" =>
[
"apps/prime.c",
],
"apps/rand.o" =>
[
"apps/rand.c",
],
"apps/rehash.o" =>
[
"apps/rehash.c",
],
"apps/req.o" =>
[
"apps/req.c",
],
"apps/rsa.o" =>
[
"apps/rsa.c",
],
"apps/rsautl.o" =>
[
"apps/rsautl.c",
],
"apps/s_cb.o" =>
[
"apps/s_cb.c",
],
"apps/s_client.o" =>
[
"apps/s_client.c",
],
"apps/s_server.o" =>
[
"apps/s_server.c",
],
"apps/s_socket.o" =>
[
"apps/s_socket.c",
],
"apps/s_time.o" =>
[
"apps/s_time.c",
],
"apps/sess_id.o" =>
[
"apps/sess_id.c",
],
"apps/smime.o" =>
[
"apps/smime.c",
],
"apps/speed.o" =>
[
"apps/speed.c",
],
"apps/spkac.o" =>
[
"apps/spkac.c",
],
"apps/srp.o" =>
[
"apps/srp.c",
],
"apps/storeutl.o" =>
[
"apps/storeutl.c",
],
"apps/ts.o" =>
[
"apps/ts.c",
],
"apps/tsget.pl" =>
[
"apps/tsget.in",
],
"apps/verify.o" =>
[
"apps/verify.c",
],
"apps/version.o" =>
[
"apps/version.c",
],
"apps/x509.o" =>
[
"apps/x509.c",
],
"crypto/aes/aes_cbc.o" =>
[
"crypto/aes/aes_cbc.c",
],
"crypto/aes/aes_cfb.o" =>
[
"crypto/aes/aes_cfb.c",
],
"crypto/aes/aes_core.o" =>
[
"crypto/aes/aes_core.c",
],
"crypto/aes/aes_ecb.o" =>
[
"crypto/aes/aes_ecb.c",
],
"crypto/aes/aes_ige.o" =>
[
"crypto/aes/aes_ige.c",
],
"crypto/aes/aes_misc.o" =>
[
"crypto/aes/aes_misc.c",
],
"crypto/aes/aes_ofb.o" =>
[
"crypto/aes/aes_ofb.c",
],
"crypto/aes/aes_wrap.o" =>
[
"crypto/aes/aes_wrap.c",
],
"crypto/aria/aria.o" =>
[
"crypto/aria/aria.c",
],
"crypto/asn1/a_bitstr.o" =>
[
"crypto/asn1/a_bitstr.c",
],
"crypto/asn1/a_d2i_fp.o" =>
[
"crypto/asn1/a_d2i_fp.c",
],
"crypto/asn1/a_digest.o" =>
[
"crypto/asn1/a_digest.c",
],
"crypto/asn1/a_dup.o" =>
[
"crypto/asn1/a_dup.c",
],
"crypto/asn1/a_gentm.o" =>
[
"crypto/asn1/a_gentm.c",
],
"crypto/asn1/a_i2d_fp.o" =>
[
"crypto/asn1/a_i2d_fp.c",
],
"crypto/asn1/a_int.o" =>
[
"crypto/asn1/a_int.c",
],
"crypto/asn1/a_mbstr.o" =>
[
"crypto/asn1/a_mbstr.c",
],
"crypto/asn1/a_object.o" =>
[
"crypto/asn1/a_object.c",
],
"crypto/asn1/a_octet.o" =>
[
"crypto/asn1/a_octet.c",
],
"crypto/asn1/a_print.o" =>
[
"crypto/asn1/a_print.c",
],
"crypto/asn1/a_sign.o" =>
[
"crypto/asn1/a_sign.c",
],
"crypto/asn1/a_strex.o" =>
[
"crypto/asn1/a_strex.c",
],
"crypto/asn1/a_strnid.o" =>
[
"crypto/asn1/a_strnid.c",
],
"crypto/asn1/a_time.o" =>
[
"crypto/asn1/a_time.c",
],
"crypto/asn1/a_type.o" =>
[
"crypto/asn1/a_type.c",
],
"crypto/asn1/a_utctm.o" =>
[
"crypto/asn1/a_utctm.c",
],
"crypto/asn1/a_utf8.o" =>
[
"crypto/asn1/a_utf8.c",
],
"crypto/asn1/a_verify.o" =>
[
"crypto/asn1/a_verify.c",
],
"crypto/asn1/ameth_lib.o" =>
[
"crypto/asn1/ameth_lib.c",
],
"crypto/asn1/asn1_err.o" =>
[
"crypto/asn1/asn1_err.c",
],
"crypto/asn1/asn1_gen.o" =>
[
"crypto/asn1/asn1_gen.c",
],
"crypto/asn1/asn1_item_list.o" =>
[
"crypto/asn1/asn1_item_list.c",
],
"crypto/asn1/asn1_lib.o" =>
[
"crypto/asn1/asn1_lib.c",
],
"crypto/asn1/asn1_par.o" =>
[
"crypto/asn1/asn1_par.c",
],
"crypto/asn1/asn_mime.o" =>
[
"crypto/asn1/asn_mime.c",
],
"crypto/asn1/asn_moid.o" =>
[
"crypto/asn1/asn_moid.c",
],
"crypto/asn1/asn_mstbl.o" =>
[
"crypto/asn1/asn_mstbl.c",
],
"crypto/asn1/asn_pack.o" =>
[
"crypto/asn1/asn_pack.c",
],
"crypto/asn1/bio_asn1.o" =>
[
"crypto/asn1/bio_asn1.c",
],
"crypto/asn1/bio_ndef.o" =>
[
"crypto/asn1/bio_ndef.c",
],
"crypto/asn1/d2i_pr.o" =>
[
"crypto/asn1/d2i_pr.c",
],
"crypto/asn1/d2i_pu.o" =>
[
"crypto/asn1/d2i_pu.c",
],
"crypto/asn1/evp_asn1.o" =>
[
"crypto/asn1/evp_asn1.c",
],
"crypto/asn1/f_int.o" =>
[
"crypto/asn1/f_int.c",
],
"crypto/asn1/f_string.o" =>
[
"crypto/asn1/f_string.c",
],
"crypto/asn1/i2d_pr.o" =>
[
"crypto/asn1/i2d_pr.c",
],
"crypto/asn1/i2d_pu.o" =>
[
"crypto/asn1/i2d_pu.c",
],
"crypto/asn1/n_pkey.o" =>
[
"crypto/asn1/n_pkey.c",
],
"crypto/asn1/nsseq.o" =>
[
"crypto/asn1/nsseq.c",
],
"crypto/asn1/p5_pbe.o" =>
[
"crypto/asn1/p5_pbe.c",
],
"crypto/asn1/p5_pbev2.o" =>
[
"crypto/asn1/p5_pbev2.c",
],
"crypto/asn1/p5_scrypt.o" =>
[
"crypto/asn1/p5_scrypt.c",
],
"crypto/asn1/p8_pkey.o" =>
[
"crypto/asn1/p8_pkey.c",
],
"crypto/asn1/t_bitst.o" =>
[
"crypto/asn1/t_bitst.c",
],
"crypto/asn1/t_pkey.o" =>
[
"crypto/asn1/t_pkey.c",
],
"crypto/asn1/t_spki.o" =>
[
"crypto/asn1/t_spki.c",
],
"crypto/asn1/tasn_dec.o" =>
[
"crypto/asn1/tasn_dec.c",
],
"crypto/asn1/tasn_enc.o" =>
[
"crypto/asn1/tasn_enc.c",
],
"crypto/asn1/tasn_fre.o" =>
[
"crypto/asn1/tasn_fre.c",
],
"crypto/asn1/tasn_new.o" =>
[
"crypto/asn1/tasn_new.c",
],
"crypto/asn1/tasn_prn.o" =>
[
"crypto/asn1/tasn_prn.c",
],
"crypto/asn1/tasn_scn.o" =>
[
"crypto/asn1/tasn_scn.c",
],
"crypto/asn1/tasn_typ.o" =>
[
"crypto/asn1/tasn_typ.c",
],
"crypto/asn1/tasn_utl.o" =>
[
"crypto/asn1/tasn_utl.c",
],
"crypto/asn1/x_algor.o" =>
[
"crypto/asn1/x_algor.c",
],
"crypto/asn1/x_bignum.o" =>
[
"crypto/asn1/x_bignum.c",
],
"crypto/asn1/x_info.o" =>
[
"crypto/asn1/x_info.c",
],
"crypto/asn1/x_int64.o" =>
[
"crypto/asn1/x_int64.c",
],
"crypto/asn1/x_long.o" =>
[
"crypto/asn1/x_long.c",
],
"crypto/asn1/x_pkey.o" =>
[
"crypto/asn1/x_pkey.c",
],
"crypto/asn1/x_sig.o" =>
[
"crypto/asn1/x_sig.c",
],
"crypto/asn1/x_spki.o" =>
[
"crypto/asn1/x_spki.c",
],
"crypto/asn1/x_val.o" =>
[
"crypto/asn1/x_val.c",
],
"crypto/async/arch/async_null.o" =>
[
"crypto/async/arch/async_null.c",
],
"crypto/async/arch/async_posix.o" =>
[
"crypto/async/arch/async_posix.c",
],
"crypto/async/arch/async_win.o" =>
[
"crypto/async/arch/async_win.c",
],
"crypto/async/async.o" =>
[
"crypto/async/async.c",
],
"crypto/async/async_err.o" =>
[
"crypto/async/async_err.c",
],
"crypto/async/async_wait.o" =>
[
"crypto/async/async_wait.c",
],
"crypto/bf/bf_cfb64.o" =>
[
"crypto/bf/bf_cfb64.c",
],
"crypto/bf/bf_ecb.o" =>
[
"crypto/bf/bf_ecb.c",
],
"crypto/bf/bf_enc.o" =>
[
"crypto/bf/bf_enc.c",
],
"crypto/bf/bf_ofb64.o" =>
[
"crypto/bf/bf_ofb64.c",
],
"crypto/bf/bf_skey.o" =>
[
"crypto/bf/bf_skey.c",
],
"crypto/bio/b_addr.o" =>
[
"crypto/bio/b_addr.c",
],
"crypto/bio/b_dump.o" =>
[
"crypto/bio/b_dump.c",
],
"crypto/bio/b_print.o" =>
[
"crypto/bio/b_print.c",
],
"crypto/bio/b_sock.o" =>
[
"crypto/bio/b_sock.c",
],
"crypto/bio/b_sock2.o" =>
[
"crypto/bio/b_sock2.c",
],
"crypto/bio/bf_buff.o" =>
[
"crypto/bio/bf_buff.c",
],
"crypto/bio/bf_lbuf.o" =>
[
"crypto/bio/bf_lbuf.c",
],
"crypto/bio/bf_nbio.o" =>
[
"crypto/bio/bf_nbio.c",
],
"crypto/bio/bf_null.o" =>
[
"crypto/bio/bf_null.c",
],
"crypto/bio/bio_cb.o" =>
[
"crypto/bio/bio_cb.c",
],
"crypto/bio/bio_err.o" =>
[
"crypto/bio/bio_err.c",
],
"crypto/bio/bio_lib.o" =>
[
"crypto/bio/bio_lib.c",
],
"crypto/bio/bio_meth.o" =>
[
"crypto/bio/bio_meth.c",
],
"crypto/bio/bss_acpt.o" =>
[
"crypto/bio/bss_acpt.c",
],
"crypto/bio/bss_bio.o" =>
[
"crypto/bio/bss_bio.c",
],
"crypto/bio/bss_conn.o" =>
[
"crypto/bio/bss_conn.c",
],
"crypto/bio/bss_dgram.o" =>
[
"crypto/bio/bss_dgram.c",
],
"crypto/bio/bss_fd.o" =>
[
"crypto/bio/bss_fd.c",
],
"crypto/bio/bss_file.o" =>
[
"crypto/bio/bss_file.c",
],
"crypto/bio/bss_log.o" =>
[
"crypto/bio/bss_log.c",
],
"crypto/bio/bss_mem.o" =>
[
"crypto/bio/bss_mem.c",
],
"crypto/bio/bss_null.o" =>
[
"crypto/bio/bss_null.c",
],
"crypto/bio/bss_sock.o" =>
[
"crypto/bio/bss_sock.c",
],
"crypto/blake2/blake2b.o" =>
[
"crypto/blake2/blake2b.c",
],
"crypto/blake2/blake2s.o" =>
[
"crypto/blake2/blake2s.c",
],
"crypto/blake2/m_blake2b.o" =>
[
"crypto/blake2/m_blake2b.c",
],
"crypto/blake2/m_blake2s.o" =>
[
"crypto/blake2/m_blake2s.c",
],
"crypto/bn/bn_add.o" =>
[
"crypto/bn/bn_add.c",
],
"crypto/bn/bn_asm.o" =>
[
"crypto/bn/bn_asm.c",
],
"crypto/bn/bn_blind.o" =>
[
"crypto/bn/bn_blind.c",
],
"crypto/bn/bn_const.o" =>
[
"crypto/bn/bn_const.c",
],
"crypto/bn/bn_ctx.o" =>
[
"crypto/bn/bn_ctx.c",
],
"crypto/bn/bn_depr.o" =>
[
"crypto/bn/bn_depr.c",
],
"crypto/bn/bn_dh.o" =>
[
"crypto/bn/bn_dh.c",
],
"crypto/bn/bn_div.o" =>
[
"crypto/bn/bn_div.c",
],
"crypto/bn/bn_err.o" =>
[
"crypto/bn/bn_err.c",
],
"crypto/bn/bn_exp.o" =>
[
"crypto/bn/bn_exp.c",
],
"crypto/bn/bn_exp2.o" =>
[
"crypto/bn/bn_exp2.c",
],
"crypto/bn/bn_gcd.o" =>
[
"crypto/bn/bn_gcd.c",
],
"crypto/bn/bn_gf2m.o" =>
[
"crypto/bn/bn_gf2m.c",
],
"crypto/bn/bn_intern.o" =>
[
"crypto/bn/bn_intern.c",
],
"crypto/bn/bn_kron.o" =>
[
"crypto/bn/bn_kron.c",
],
"crypto/bn/bn_lib.o" =>
[
"crypto/bn/bn_lib.c",
],
"crypto/bn/bn_mod.o" =>
[
"crypto/bn/bn_mod.c",
],
"crypto/bn/bn_mont.o" =>
[
"crypto/bn/bn_mont.c",
],
"crypto/bn/bn_mpi.o" =>
[
"crypto/bn/bn_mpi.c",
],
"crypto/bn/bn_mul.o" =>
[
"crypto/bn/bn_mul.c",
],
"crypto/bn/bn_nist.o" =>
[
"crypto/bn/bn_nist.c",
],
"crypto/bn/bn_prime.o" =>
[
"crypto/bn/bn_prime.c",
],
"crypto/bn/bn_print.o" =>
[
"crypto/bn/bn_print.c",
],
"crypto/bn/bn_rand.o" =>
[
"crypto/bn/bn_rand.c",
],
"crypto/bn/bn_recp.o" =>
[
"crypto/bn/bn_recp.c",
],
"crypto/bn/bn_shift.o" =>
[
"crypto/bn/bn_shift.c",
],
"crypto/bn/bn_sqr.o" =>
[
"crypto/bn/bn_sqr.c",
],
"crypto/bn/bn_sqrt.o" =>
[
"crypto/bn/bn_sqrt.c",
],
"crypto/bn/bn_srp.o" =>
[
"crypto/bn/bn_srp.c",
],
"crypto/bn/bn_word.o" =>
[
"crypto/bn/bn_word.c",
],
"crypto/bn/bn_x931p.o" =>
[
"crypto/bn/bn_x931p.c",
],
"crypto/buffer/buf_err.o" =>
[
"crypto/buffer/buf_err.c",
],
"crypto/buffer/buffer.o" =>
[
"crypto/buffer/buffer.c",
],
"crypto/camellia/camellia.o" =>
[
"crypto/camellia/camellia.c",
],
"crypto/camellia/cmll_cbc.o" =>
[
"crypto/camellia/cmll_cbc.c",
],
"crypto/camellia/cmll_cfb.o" =>
[
"crypto/camellia/cmll_cfb.c",
],
"crypto/camellia/cmll_ctr.o" =>
[
"crypto/camellia/cmll_ctr.c",
],
"crypto/camellia/cmll_ecb.o" =>
[
"crypto/camellia/cmll_ecb.c",
],
"crypto/camellia/cmll_misc.o" =>
[
"crypto/camellia/cmll_misc.c",
],
"crypto/camellia/cmll_ofb.o" =>
[
"crypto/camellia/cmll_ofb.c",
],
"crypto/cast/c_cfb64.o" =>
[
"crypto/cast/c_cfb64.c",
],
"crypto/cast/c_ecb.o" =>
[
"crypto/cast/c_ecb.c",
],
"crypto/cast/c_enc.o" =>
[
"crypto/cast/c_enc.c",
],
"crypto/cast/c_ofb64.o" =>
[
"crypto/cast/c_ofb64.c",
],
"crypto/cast/c_skey.o" =>
[
"crypto/cast/c_skey.c",
],
"crypto/chacha/chacha_enc.o" =>
[
"crypto/chacha/chacha_enc.c",
],
"crypto/cmac/cm_ameth.o" =>
[
"crypto/cmac/cm_ameth.c",
],
"crypto/cmac/cm_pmeth.o" =>
[
"crypto/cmac/cm_pmeth.c",
],
"crypto/cmac/cmac.o" =>
[
"crypto/cmac/cmac.c",
],
"crypto/cms/cms_asn1.o" =>
[
"crypto/cms/cms_asn1.c",
],
"crypto/cms/cms_att.o" =>
[
"crypto/cms/cms_att.c",
],
"crypto/cms/cms_cd.o" =>
[
"crypto/cms/cms_cd.c",
],
"crypto/cms/cms_dd.o" =>
[
"crypto/cms/cms_dd.c",
],
"crypto/cms/cms_enc.o" =>
[
"crypto/cms/cms_enc.c",
],
"crypto/cms/cms_env.o" =>
[
"crypto/cms/cms_env.c",
],
"crypto/cms/cms_err.o" =>
[
"crypto/cms/cms_err.c",
],
"crypto/cms/cms_ess.o" =>
[
"crypto/cms/cms_ess.c",
],
"crypto/cms/cms_io.o" =>
[
"crypto/cms/cms_io.c",
],
"crypto/cms/cms_kari.o" =>
[
"crypto/cms/cms_kari.c",
],
"crypto/cms/cms_lib.o" =>
[
"crypto/cms/cms_lib.c",
],
"crypto/cms/cms_pwri.o" =>
[
"crypto/cms/cms_pwri.c",
],
"crypto/cms/cms_sd.o" =>
[
"crypto/cms/cms_sd.c",
],
"crypto/cms/cms_smime.o" =>
[
"crypto/cms/cms_smime.c",
],
"crypto/conf/conf_api.o" =>
[
"crypto/conf/conf_api.c",
],
"crypto/conf/conf_def.o" =>
[
"crypto/conf/conf_def.c",
],
"crypto/conf/conf_err.o" =>
[
"crypto/conf/conf_err.c",
],
"crypto/conf/conf_lib.o" =>
[
"crypto/conf/conf_lib.c",
],
"crypto/conf/conf_mall.o" =>
[
"crypto/conf/conf_mall.c",
],
"crypto/conf/conf_mod.o" =>
[
"crypto/conf/conf_mod.c",
],
"crypto/conf/conf_sap.o" =>
[
"crypto/conf/conf_sap.c",
],
"crypto/conf/conf_ssl.o" =>
[
"crypto/conf/conf_ssl.c",
],
"crypto/cpt_err.o" =>
[
"crypto/cpt_err.c",
],
"crypto/cryptlib.o" =>
[
"crypto/cryptlib.c",
],
"crypto/ct/ct_b64.o" =>
[
"crypto/ct/ct_b64.c",
],
"crypto/ct/ct_err.o" =>
[
"crypto/ct/ct_err.c",
],
"crypto/ct/ct_log.o" =>
[
"crypto/ct/ct_log.c",
],
"crypto/ct/ct_oct.o" =>
[
"crypto/ct/ct_oct.c",
],
"crypto/ct/ct_policy.o" =>
[
"crypto/ct/ct_policy.c",
],
"crypto/ct/ct_prn.o" =>
[
"crypto/ct/ct_prn.c",
],
"crypto/ct/ct_sct.o" =>
[
"crypto/ct/ct_sct.c",
],
"crypto/ct/ct_sct_ctx.o" =>
[
"crypto/ct/ct_sct_ctx.c",
],
"crypto/ct/ct_vfy.o" =>
[
"crypto/ct/ct_vfy.c",
],
"crypto/ct/ct_x509v3.o" =>
[
"crypto/ct/ct_x509v3.c",
],
"crypto/ctype.o" =>
[
"crypto/ctype.c",
],
"crypto/cversion.o" =>
[
"crypto/cversion.c",
],
"crypto/des/cbc_cksm.o" =>
[
"crypto/des/cbc_cksm.c",
],
"crypto/des/cbc_enc.o" =>
[
"crypto/des/cbc_enc.c",
],
"crypto/des/cfb64ede.o" =>
[
"crypto/des/cfb64ede.c",
],
"crypto/des/cfb64enc.o" =>
[
"crypto/des/cfb64enc.c",
],
"crypto/des/cfb_enc.o" =>
[
"crypto/des/cfb_enc.c",
],
"crypto/des/des_enc.o" =>
[
"crypto/des/des_enc.c",
],
"crypto/des/ecb3_enc.o" =>
[
"crypto/des/ecb3_enc.c",
],
"crypto/des/ecb_enc.o" =>
[
"crypto/des/ecb_enc.c",
],
"crypto/des/fcrypt.o" =>
[
"crypto/des/fcrypt.c",
],
"crypto/des/fcrypt_b.o" =>
[
"crypto/des/fcrypt_b.c",
],
"crypto/des/ofb64ede.o" =>
[
"crypto/des/ofb64ede.c",
],
"crypto/des/ofb64enc.o" =>
[
"crypto/des/ofb64enc.c",
],
"crypto/des/ofb_enc.o" =>
[
"crypto/des/ofb_enc.c",
],
"crypto/des/pcbc_enc.o" =>
[
"crypto/des/pcbc_enc.c",
],
"crypto/des/qud_cksm.o" =>
[
"crypto/des/qud_cksm.c",
],
"crypto/des/rand_key.o" =>
[
"crypto/des/rand_key.c",
],
"crypto/des/set_key.o" =>
[
"crypto/des/set_key.c",
],
"crypto/des/str2key.o" =>
[
"crypto/des/str2key.c",
],
"crypto/des/xcbc_enc.o" =>
[
"crypto/des/xcbc_enc.c",
],
"crypto/dh/dh_ameth.o" =>
[
"crypto/dh/dh_ameth.c",
],
"crypto/dh/dh_asn1.o" =>
[
"crypto/dh/dh_asn1.c",
],
"crypto/dh/dh_check.o" =>
[
"crypto/dh/dh_check.c",
],
"crypto/dh/dh_depr.o" =>
[
"crypto/dh/dh_depr.c",
],
"crypto/dh/dh_err.o" =>
[
"crypto/dh/dh_err.c",
],
"crypto/dh/dh_gen.o" =>
[
"crypto/dh/dh_gen.c",
],
"crypto/dh/dh_kdf.o" =>
[
"crypto/dh/dh_kdf.c",
],
"crypto/dh/dh_key.o" =>
[
"crypto/dh/dh_key.c",
],
"crypto/dh/dh_lib.o" =>
[
"crypto/dh/dh_lib.c",
],
"crypto/dh/dh_meth.o" =>
[
"crypto/dh/dh_meth.c",
],
"crypto/dh/dh_pmeth.o" =>
[
"crypto/dh/dh_pmeth.c",
],
"crypto/dh/dh_prn.o" =>
[
"crypto/dh/dh_prn.c",
],
"crypto/dh/dh_rfc5114.o" =>
[
"crypto/dh/dh_rfc5114.c",
],
"crypto/dh/dh_rfc7919.o" =>
[
"crypto/dh/dh_rfc7919.c",
],
"crypto/dsa/dsa_ameth.o" =>
[
"crypto/dsa/dsa_ameth.c",
],
"crypto/dsa/dsa_asn1.o" =>
[
"crypto/dsa/dsa_asn1.c",
],
"crypto/dsa/dsa_depr.o" =>
[
"crypto/dsa/dsa_depr.c",
],
"crypto/dsa/dsa_err.o" =>
[
"crypto/dsa/dsa_err.c",
],
"crypto/dsa/dsa_gen.o" =>
[
"crypto/dsa/dsa_gen.c",
],
"crypto/dsa/dsa_key.o" =>
[
"crypto/dsa/dsa_key.c",
],
"crypto/dsa/dsa_lib.o" =>
[
"crypto/dsa/dsa_lib.c",
],
"crypto/dsa/dsa_meth.o" =>
[
"crypto/dsa/dsa_meth.c",
],
"crypto/dsa/dsa_ossl.o" =>
[
"crypto/dsa/dsa_ossl.c",
],
"crypto/dsa/dsa_pmeth.o" =>
[
"crypto/dsa/dsa_pmeth.c",
],
"crypto/dsa/dsa_prn.o" =>
[
"crypto/dsa/dsa_prn.c",
],
"crypto/dsa/dsa_sign.o" =>
[
"crypto/dsa/dsa_sign.c",
],
"crypto/dsa/dsa_vrf.o" =>
[
"crypto/dsa/dsa_vrf.c",
],
"crypto/dso/dso_dl.o" =>
[
"crypto/dso/dso_dl.c",
],
"crypto/dso/dso_dlfcn.o" =>
[
"crypto/dso/dso_dlfcn.c",
],
"crypto/dso/dso_err.o" =>
[
"crypto/dso/dso_err.c",
],
"crypto/dso/dso_lib.o" =>
[
"crypto/dso/dso_lib.c",
],
"crypto/dso/dso_openssl.o" =>
[
"crypto/dso/dso_openssl.c",
],
"crypto/dso/dso_vms.o" =>
[
"crypto/dso/dso_vms.c",
],
"crypto/dso/dso_win32.o" =>
[
"crypto/dso/dso_win32.c",
],
"crypto/ebcdic.o" =>
[
"crypto/ebcdic.c",
],
"crypto/ec/curve25519.o" =>
[
"crypto/ec/curve25519.c",
],
"crypto/ec/curve448/arch_32/f_impl.o" =>
[
"crypto/ec/curve448/arch_32/f_impl.c",
],
"crypto/ec/curve448/curve448.o" =>
[
"crypto/ec/curve448/curve448.c",
],
"crypto/ec/curve448/curve448_tables.o" =>
[
"crypto/ec/curve448/curve448_tables.c",
],
"crypto/ec/curve448/eddsa.o" =>
[
"crypto/ec/curve448/eddsa.c",
],
"crypto/ec/curve448/f_generic.o" =>
[
"crypto/ec/curve448/f_generic.c",
],
"crypto/ec/curve448/scalar.o" =>
[
"crypto/ec/curve448/scalar.c",
],
"crypto/ec/ec2_oct.o" =>
[
"crypto/ec/ec2_oct.c",
],
"crypto/ec/ec2_smpl.o" =>
[
"crypto/ec/ec2_smpl.c",
],
"crypto/ec/ec_ameth.o" =>
[
"crypto/ec/ec_ameth.c",
],
"crypto/ec/ec_asn1.o" =>
[
"crypto/ec/ec_asn1.c",
],
"crypto/ec/ec_check.o" =>
[
"crypto/ec/ec_check.c",
],
"crypto/ec/ec_curve.o" =>
[
"crypto/ec/ec_curve.c",
],
"crypto/ec/ec_cvt.o" =>
[
"crypto/ec/ec_cvt.c",
],
"crypto/ec/ec_err.o" =>
[
"crypto/ec/ec_err.c",
],
"crypto/ec/ec_key.o" =>
[
"crypto/ec/ec_key.c",
],
"crypto/ec/ec_kmeth.o" =>
[
"crypto/ec/ec_kmeth.c",
],
"crypto/ec/ec_lib.o" =>
[
"crypto/ec/ec_lib.c",
],
"crypto/ec/ec_mult.o" =>
[
"crypto/ec/ec_mult.c",
],
"crypto/ec/ec_oct.o" =>
[
"crypto/ec/ec_oct.c",
],
"crypto/ec/ec_pmeth.o" =>
[
"crypto/ec/ec_pmeth.c",
],
"crypto/ec/ec_print.o" =>
[
"crypto/ec/ec_print.c",
],
"crypto/ec/ecdh_kdf.o" =>
[
"crypto/ec/ecdh_kdf.c",
],
"crypto/ec/ecdh_ossl.o" =>
[
"crypto/ec/ecdh_ossl.c",
],
"crypto/ec/ecdsa_ossl.o" =>
[
"crypto/ec/ecdsa_ossl.c",
],
"crypto/ec/ecdsa_sign.o" =>
[
"crypto/ec/ecdsa_sign.c",
],
"crypto/ec/ecdsa_vrf.o" =>
[
"crypto/ec/ecdsa_vrf.c",
],
"crypto/ec/eck_prn.o" =>
[
"crypto/ec/eck_prn.c",
],
"crypto/ec/ecp_mont.o" =>
[
"crypto/ec/ecp_mont.c",
],
"crypto/ec/ecp_nist.o" =>
[
"crypto/ec/ecp_nist.c",
],
"crypto/ec/ecp_nistp224.o" =>
[
"crypto/ec/ecp_nistp224.c",
],
"crypto/ec/ecp_nistp256.o" =>
[
"crypto/ec/ecp_nistp256.c",
],
"crypto/ec/ecp_nistp521.o" =>
[
"crypto/ec/ecp_nistp521.c",
],
"crypto/ec/ecp_nistputil.o" =>
[
"crypto/ec/ecp_nistputil.c",
],
"crypto/ec/ecp_oct.o" =>
[
"crypto/ec/ecp_oct.c",
],
"crypto/ec/ecp_smpl.o" =>
[
"crypto/ec/ecp_smpl.c",
],
"crypto/ec/ecx_meth.o" =>
[
"crypto/ec/ecx_meth.c",
],
"crypto/engine/eng_all.o" =>
[
"crypto/engine/eng_all.c",
],
"crypto/engine/eng_cnf.o" =>
[
"crypto/engine/eng_cnf.c",
],
"crypto/engine/eng_ctrl.o" =>
[
"crypto/engine/eng_ctrl.c",
],
"crypto/engine/eng_dyn.o" =>
[
"crypto/engine/eng_dyn.c",
],
"crypto/engine/eng_err.o" =>
[
"crypto/engine/eng_err.c",
],
"crypto/engine/eng_fat.o" =>
[
"crypto/engine/eng_fat.c",
],
"crypto/engine/eng_init.o" =>
[
"crypto/engine/eng_init.c",
],
"crypto/engine/eng_lib.o" =>
[
"crypto/engine/eng_lib.c",
],
"crypto/engine/eng_list.o" =>
[
"crypto/engine/eng_list.c",
],
"crypto/engine/eng_openssl.o" =>
[
"crypto/engine/eng_openssl.c",
],
"crypto/engine/eng_pkey.o" =>
[
"crypto/engine/eng_pkey.c",
],
"crypto/engine/eng_rdrand.o" =>
[
"crypto/engine/eng_rdrand.c",
],
"crypto/engine/eng_table.o" =>
[
"crypto/engine/eng_table.c",
],
"crypto/engine/tb_asnmth.o" =>
[
"crypto/engine/tb_asnmth.c",
],
"crypto/engine/tb_cipher.o" =>
[
"crypto/engine/tb_cipher.c",
],
"crypto/engine/tb_dh.o" =>
[
"crypto/engine/tb_dh.c",
],
"crypto/engine/tb_digest.o" =>
[
"crypto/engine/tb_digest.c",
],
"crypto/engine/tb_dsa.o" =>
[
"crypto/engine/tb_dsa.c",
],
"crypto/engine/tb_eckey.o" =>
[
"crypto/engine/tb_eckey.c",
],
"crypto/engine/tb_pkmeth.o" =>
[
"crypto/engine/tb_pkmeth.c",
],
"crypto/engine/tb_rand.o" =>
[
"crypto/engine/tb_rand.c",
],
"crypto/engine/tb_rsa.o" =>
[
"crypto/engine/tb_rsa.c",
],
"crypto/err/err.o" =>
[
"crypto/err/err.c",
],
"crypto/err/err_all.o" =>
[
"crypto/err/err_all.c",
],
"crypto/err/err_prn.o" =>
[
"crypto/err/err_prn.c",
],
"crypto/evp/bio_b64.o" =>
[
"crypto/evp/bio_b64.c",
],
"crypto/evp/bio_enc.o" =>
[
"crypto/evp/bio_enc.c",
],
"crypto/evp/bio_md.o" =>
[
"crypto/evp/bio_md.c",
],
"crypto/evp/bio_ok.o" =>
[
"crypto/evp/bio_ok.c",
],
"crypto/evp/c_allc.o" =>
[
"crypto/evp/c_allc.c",
],
"crypto/evp/c_alld.o" =>
[
"crypto/evp/c_alld.c",
],
"crypto/evp/cmeth_lib.o" =>
[
"crypto/evp/cmeth_lib.c",
],
"crypto/evp/digest.o" =>
[
"crypto/evp/digest.c",
],
"crypto/evp/e_aes.o" =>
[
"crypto/evp/e_aes.c",
],
"crypto/evp/e_aes_cbc_hmac_sha1.o" =>
[
"crypto/evp/e_aes_cbc_hmac_sha1.c",
],
"crypto/evp/e_aes_cbc_hmac_sha256.o" =>
[
"crypto/evp/e_aes_cbc_hmac_sha256.c",
],
"crypto/evp/e_aria.o" =>
[
"crypto/evp/e_aria.c",
],
"crypto/evp/e_bf.o" =>
[
"crypto/evp/e_bf.c",
],
"crypto/evp/e_camellia.o" =>
[
"crypto/evp/e_camellia.c",
],
"crypto/evp/e_cast.o" =>
[
"crypto/evp/e_cast.c",
],
"crypto/evp/e_chacha20_poly1305.o" =>
[
"crypto/evp/e_chacha20_poly1305.c",
],
"crypto/evp/e_des.o" =>
[
"crypto/evp/e_des.c",
],
"crypto/evp/e_des3.o" =>
[
"crypto/evp/e_des3.c",
],
"crypto/evp/e_idea.o" =>
[
"crypto/evp/e_idea.c",
],
"crypto/evp/e_null.o" =>
[
"crypto/evp/e_null.c",
],
"crypto/evp/e_old.o" =>
[
"crypto/evp/e_old.c",
],
"crypto/evp/e_rc2.o" =>
[
"crypto/evp/e_rc2.c",
],
"crypto/evp/e_rc4.o" =>
[
"crypto/evp/e_rc4.c",
],
"crypto/evp/e_rc4_hmac_md5.o" =>
[
"crypto/evp/e_rc4_hmac_md5.c",
],
"crypto/evp/e_rc5.o" =>
[
"crypto/evp/e_rc5.c",
],
"crypto/evp/e_seed.o" =>
[
"crypto/evp/e_seed.c",
],
"crypto/evp/e_sm4.o" =>
[
"crypto/evp/e_sm4.c",
],
"crypto/evp/e_xcbc_d.o" =>
[
"crypto/evp/e_xcbc_d.c",
],
"crypto/evp/encode.o" =>
[
"crypto/evp/encode.c",
],
"crypto/evp/evp_cnf.o" =>
[
"crypto/evp/evp_cnf.c",
],
"crypto/evp/evp_enc.o" =>
[
"crypto/evp/evp_enc.c",
],
"crypto/evp/evp_err.o" =>
[
"crypto/evp/evp_err.c",
],
"crypto/evp/evp_key.o" =>
[
"crypto/evp/evp_key.c",
],
"crypto/evp/evp_lib.o" =>
[
"crypto/evp/evp_lib.c",
],
"crypto/evp/evp_pbe.o" =>
[
"crypto/evp/evp_pbe.c",
],
"crypto/evp/evp_pkey.o" =>
[
"crypto/evp/evp_pkey.c",
],
"crypto/evp/m_md2.o" =>
[
"crypto/evp/m_md2.c",
],
"crypto/evp/m_md4.o" =>
[
"crypto/evp/m_md4.c",
],
"crypto/evp/m_md5.o" =>
[
"crypto/evp/m_md5.c",
],
"crypto/evp/m_md5_sha1.o" =>
[
"crypto/evp/m_md5_sha1.c",
],
"crypto/evp/m_mdc2.o" =>
[
"crypto/evp/m_mdc2.c",
],
"crypto/evp/m_null.o" =>
[
"crypto/evp/m_null.c",
],
"crypto/evp/m_ripemd.o" =>
[
"crypto/evp/m_ripemd.c",
],
"crypto/evp/m_sha1.o" =>
[
"crypto/evp/m_sha1.c",
],
"crypto/evp/m_sha3.o" =>
[
"crypto/evp/m_sha3.c",
],
"crypto/evp/m_sigver.o" =>
[
"crypto/evp/m_sigver.c",
],
"crypto/evp/m_wp.o" =>
[
"crypto/evp/m_wp.c",
],
"crypto/evp/names.o" =>
[
"crypto/evp/names.c",
],
"crypto/evp/p5_crpt.o" =>
[
"crypto/evp/p5_crpt.c",
],
"crypto/evp/p5_crpt2.o" =>
[
"crypto/evp/p5_crpt2.c",
],
"crypto/evp/p_dec.o" =>
[
"crypto/evp/p_dec.c",
],
"crypto/evp/p_enc.o" =>
[
"crypto/evp/p_enc.c",
],
"crypto/evp/p_lib.o" =>
[
"crypto/evp/p_lib.c",
],
"crypto/evp/p_open.o" =>
[
"crypto/evp/p_open.c",
],
"crypto/evp/p_seal.o" =>
[
"crypto/evp/p_seal.c",
],
"crypto/evp/p_sign.o" =>
[
"crypto/evp/p_sign.c",
],
"crypto/evp/p_verify.o" =>
[
"crypto/evp/p_verify.c",
],
"crypto/evp/pbe_scrypt.o" =>
[
"crypto/evp/pbe_scrypt.c",
],
"crypto/evp/pmeth_fn.o" =>
[
"crypto/evp/pmeth_fn.c",
],
"crypto/evp/pmeth_gn.o" =>
[
"crypto/evp/pmeth_gn.c",
],
"crypto/evp/pmeth_lib.o" =>
[
"crypto/evp/pmeth_lib.c",
],
"crypto/ex_data.o" =>
[
"crypto/ex_data.c",
],
"crypto/getenv.o" =>
[
"crypto/getenv.c",
],
"crypto/hmac/hm_ameth.o" =>
[
"crypto/hmac/hm_ameth.c",
],
"crypto/hmac/hm_pmeth.o" =>
[
"crypto/hmac/hm_pmeth.c",
],
"crypto/hmac/hmac.o" =>
[
"crypto/hmac/hmac.c",
],
"crypto/idea/i_cbc.o" =>
[
"crypto/idea/i_cbc.c",
],
"crypto/idea/i_cfb64.o" =>
[
"crypto/idea/i_cfb64.c",
],
"crypto/idea/i_ecb.o" =>
[
"crypto/idea/i_ecb.c",
],
"crypto/idea/i_ofb64.o" =>
[
"crypto/idea/i_ofb64.c",
],
"crypto/idea/i_skey.o" =>
[
"crypto/idea/i_skey.c",
],
"crypto/init.o" =>
[
"crypto/init.c",
],
"crypto/kdf/hkdf.o" =>
[
"crypto/kdf/hkdf.c",
],
"crypto/kdf/kdf_err.o" =>
[
"crypto/kdf/kdf_err.c",
],
"crypto/kdf/scrypt.o" =>
[
"crypto/kdf/scrypt.c",
],
"crypto/kdf/tls1_prf.o" =>
[
"crypto/kdf/tls1_prf.c",
],
"crypto/lhash/lh_stats.o" =>
[
"crypto/lhash/lh_stats.c",
],
"crypto/lhash/lhash.o" =>
[
"crypto/lhash/lhash.c",
],
"crypto/md4/md4_dgst.o" =>
[
"crypto/md4/md4_dgst.c",
],
"crypto/md4/md4_one.o" =>
[
"crypto/md4/md4_one.c",
],
"crypto/md5/md5_dgst.o" =>
[
"crypto/md5/md5_dgst.c",
],
"crypto/md5/md5_one.o" =>
[
"crypto/md5/md5_one.c",
],
"crypto/mdc2/mdc2_one.o" =>
[
"crypto/mdc2/mdc2_one.c",
],
"crypto/mdc2/mdc2dgst.o" =>
[
"crypto/mdc2/mdc2dgst.c",
],
"crypto/mem.o" =>
[
"crypto/mem.c",
],
"crypto/mem_clr.o" =>
[
"crypto/mem_clr.c",
],
"crypto/mem_dbg.o" =>
[
"crypto/mem_dbg.c",
],
"crypto/mem_sec.o" =>
[
"crypto/mem_sec.c",
],
"crypto/modes/cbc128.o" =>
[
"crypto/modes/cbc128.c",
],
"crypto/modes/ccm128.o" =>
[
"crypto/modes/ccm128.c",
],
"crypto/modes/cfb128.o" =>
[
"crypto/modes/cfb128.c",
],
"crypto/modes/ctr128.o" =>
[
"crypto/modes/ctr128.c",
],
"crypto/modes/cts128.o" =>
[
"crypto/modes/cts128.c",
],
"crypto/modes/gcm128.o" =>
[
"crypto/modes/gcm128.c",
],
"crypto/modes/ocb128.o" =>
[
"crypto/modes/ocb128.c",
],
"crypto/modes/ofb128.o" =>
[
"crypto/modes/ofb128.c",
],
"crypto/modes/wrap128.o" =>
[
"crypto/modes/wrap128.c",
],
"crypto/modes/xts128.o" =>
[
"crypto/modes/xts128.c",
],
"crypto/o_dir.o" =>
[
"crypto/o_dir.c",
],
"crypto/o_fips.o" =>
[
"crypto/o_fips.c",
],
"crypto/o_fopen.o" =>
[
"crypto/o_fopen.c",
],
"crypto/o_init.o" =>
[
"crypto/o_init.c",
],
"crypto/o_str.o" =>
[
"crypto/o_str.c",
],
"crypto/o_time.o" =>
[
"crypto/o_time.c",
],
"crypto/objects/o_names.o" =>
[
"crypto/objects/o_names.c",
],
"crypto/objects/obj_dat.o" =>
[
"crypto/objects/obj_dat.c",
],
"crypto/objects/obj_err.o" =>
[
"crypto/objects/obj_err.c",
],
"crypto/objects/obj_lib.o" =>
[
"crypto/objects/obj_lib.c",
],
"crypto/objects/obj_xref.o" =>
[
"crypto/objects/obj_xref.c",
],
"crypto/ocsp/ocsp_asn.o" =>
[
"crypto/ocsp/ocsp_asn.c",
],
"crypto/ocsp/ocsp_cl.o" =>
[
"crypto/ocsp/ocsp_cl.c",
],
"crypto/ocsp/ocsp_err.o" =>
[
"crypto/ocsp/ocsp_err.c",
],
"crypto/ocsp/ocsp_ext.o" =>
[
"crypto/ocsp/ocsp_ext.c",
],
"crypto/ocsp/ocsp_ht.o" =>
[
"crypto/ocsp/ocsp_ht.c",
],
"crypto/ocsp/ocsp_lib.o" =>
[
"crypto/ocsp/ocsp_lib.c",
],
"crypto/ocsp/ocsp_prn.o" =>
[
"crypto/ocsp/ocsp_prn.c",
],
"crypto/ocsp/ocsp_srv.o" =>
[
"crypto/ocsp/ocsp_srv.c",
],
"crypto/ocsp/ocsp_vfy.o" =>
[
"crypto/ocsp/ocsp_vfy.c",
],
"crypto/ocsp/v3_ocsp.o" =>
[
"crypto/ocsp/v3_ocsp.c",
],
"crypto/pem/pem_all.o" =>
[
"crypto/pem/pem_all.c",
],
"crypto/pem/pem_err.o" =>
[
"crypto/pem/pem_err.c",
],
"crypto/pem/pem_info.o" =>
[
"crypto/pem/pem_info.c",
],
"crypto/pem/pem_lib.o" =>
[
"crypto/pem/pem_lib.c",
],
"crypto/pem/pem_oth.o" =>
[
"crypto/pem/pem_oth.c",
],
"crypto/pem/pem_pk8.o" =>
[
"crypto/pem/pem_pk8.c",
],
"crypto/pem/pem_pkey.o" =>
[
"crypto/pem/pem_pkey.c",
],
"crypto/pem/pem_sign.o" =>
[
"crypto/pem/pem_sign.c",
],
"crypto/pem/pem_x509.o" =>
[
"crypto/pem/pem_x509.c",
],
"crypto/pem/pem_xaux.o" =>
[
"crypto/pem/pem_xaux.c",
],
"crypto/pem/pvkfmt.o" =>
[
"crypto/pem/pvkfmt.c",
],
"crypto/pkcs12/p12_add.o" =>
[
"crypto/pkcs12/p12_add.c",
],
"crypto/pkcs12/p12_asn.o" =>
[
"crypto/pkcs12/p12_asn.c",
],
"crypto/pkcs12/p12_attr.o" =>
[
"crypto/pkcs12/p12_attr.c",
],
"crypto/pkcs12/p12_crpt.o" =>
[
"crypto/pkcs12/p12_crpt.c",
],
"crypto/pkcs12/p12_crt.o" =>
[
"crypto/pkcs12/p12_crt.c",
],
"crypto/pkcs12/p12_decr.o" =>
[
"crypto/pkcs12/p12_decr.c",
],
"crypto/pkcs12/p12_init.o" =>
[
"crypto/pkcs12/p12_init.c",
],
"crypto/pkcs12/p12_key.o" =>
[
"crypto/pkcs12/p12_key.c",
],
"crypto/pkcs12/p12_kiss.o" =>
[
"crypto/pkcs12/p12_kiss.c",
],
"crypto/pkcs12/p12_mutl.o" =>
[
"crypto/pkcs12/p12_mutl.c",
],
"crypto/pkcs12/p12_npas.o" =>
[
"crypto/pkcs12/p12_npas.c",
],
"crypto/pkcs12/p12_p8d.o" =>
[
"crypto/pkcs12/p12_p8d.c",
],
"crypto/pkcs12/p12_p8e.o" =>
[
"crypto/pkcs12/p12_p8e.c",
],
"crypto/pkcs12/p12_sbag.o" =>
[
"crypto/pkcs12/p12_sbag.c",
],
"crypto/pkcs12/p12_utl.o" =>
[
"crypto/pkcs12/p12_utl.c",
],
"crypto/pkcs12/pk12err.o" =>
[
"crypto/pkcs12/pk12err.c",
],
"crypto/pkcs7/bio_pk7.o" =>
[
"crypto/pkcs7/bio_pk7.c",
],
"crypto/pkcs7/pk7_asn1.o" =>
[
"crypto/pkcs7/pk7_asn1.c",
],
"crypto/pkcs7/pk7_attr.o" =>
[
"crypto/pkcs7/pk7_attr.c",
],
"crypto/pkcs7/pk7_doit.o" =>
[
"crypto/pkcs7/pk7_doit.c",
],
"crypto/pkcs7/pk7_lib.o" =>
[
"crypto/pkcs7/pk7_lib.c",
],
"crypto/pkcs7/pk7_mime.o" =>
[
"crypto/pkcs7/pk7_mime.c",
],
"crypto/pkcs7/pk7_smime.o" =>
[
"crypto/pkcs7/pk7_smime.c",
],
"crypto/pkcs7/pkcs7err.o" =>
[
"crypto/pkcs7/pkcs7err.c",
],
"crypto/poly1305/poly1305.o" =>
[
"crypto/poly1305/poly1305.c",
],
"crypto/poly1305/poly1305_ameth.o" =>
[
"crypto/poly1305/poly1305_ameth.c",
],
"crypto/poly1305/poly1305_pmeth.o" =>
[
"crypto/poly1305/poly1305_pmeth.c",
],
"crypto/rand/drbg_ctr.o" =>
[
"crypto/rand/drbg_ctr.c",
],
"crypto/rand/drbg_lib.o" =>
[
"crypto/rand/drbg_lib.c",
],
"crypto/rand/rand_egd.o" =>
[
"crypto/rand/rand_egd.c",
],
"crypto/rand/rand_err.o" =>
[
"crypto/rand/rand_err.c",
],
"crypto/rand/rand_lib.o" =>
[
"crypto/rand/rand_lib.c",
],
"crypto/rand/rand_unix.o" =>
[
"crypto/rand/rand_unix.c",
],
"crypto/rand/rand_vms.o" =>
[
"crypto/rand/rand_vms.c",
],
"crypto/rand/rand_win.o" =>
[
"crypto/rand/rand_win.c",
],
"crypto/rand/randfile.o" =>
[
"crypto/rand/randfile.c",
],
"crypto/rc2/rc2_cbc.o" =>
[
"crypto/rc2/rc2_cbc.c",
],
"crypto/rc2/rc2_ecb.o" =>
[
"crypto/rc2/rc2_ecb.c",
],
"crypto/rc2/rc2_skey.o" =>
[
"crypto/rc2/rc2_skey.c",
],
"crypto/rc2/rc2cfb64.o" =>
[
"crypto/rc2/rc2cfb64.c",
],
"crypto/rc2/rc2ofb64.o" =>
[
"crypto/rc2/rc2ofb64.c",
],
"crypto/rc4/rc4_enc.o" =>
[
"crypto/rc4/rc4_enc.c",
],
"crypto/rc4/rc4_skey.o" =>
[
"crypto/rc4/rc4_skey.c",
],
"crypto/ripemd/rmd_dgst.o" =>
[
"crypto/ripemd/rmd_dgst.c",
],
"crypto/ripemd/rmd_one.o" =>
[
"crypto/ripemd/rmd_one.c",
],
"crypto/rsa/rsa_ameth.o" =>
[
"crypto/rsa/rsa_ameth.c",
],
"crypto/rsa/rsa_asn1.o" =>
[
"crypto/rsa/rsa_asn1.c",
],
"crypto/rsa/rsa_chk.o" =>
[
"crypto/rsa/rsa_chk.c",
],
"crypto/rsa/rsa_crpt.o" =>
[
"crypto/rsa/rsa_crpt.c",
],
"crypto/rsa/rsa_depr.o" =>
[
"crypto/rsa/rsa_depr.c",
],
"crypto/rsa/rsa_err.o" =>
[
"crypto/rsa/rsa_err.c",
],
"crypto/rsa/rsa_gen.o" =>
[
"crypto/rsa/rsa_gen.c",
],
"crypto/rsa/rsa_lib.o" =>
[
"crypto/rsa/rsa_lib.c",
],
"crypto/rsa/rsa_meth.o" =>
[
"crypto/rsa/rsa_meth.c",
],
"crypto/rsa/rsa_mp.o" =>
[
"crypto/rsa/rsa_mp.c",
],
"crypto/rsa/rsa_none.o" =>
[
"crypto/rsa/rsa_none.c",
],
"crypto/rsa/rsa_oaep.o" =>
[
"crypto/rsa/rsa_oaep.c",
],
"crypto/rsa/rsa_ossl.o" =>
[
"crypto/rsa/rsa_ossl.c",
],
"crypto/rsa/rsa_pk1.o" =>
[
"crypto/rsa/rsa_pk1.c",
],
"crypto/rsa/rsa_pmeth.o" =>
[
"crypto/rsa/rsa_pmeth.c",
],
"crypto/rsa/rsa_prn.o" =>
[
"crypto/rsa/rsa_prn.c",
],
"crypto/rsa/rsa_pss.o" =>
[
"crypto/rsa/rsa_pss.c",
],
"crypto/rsa/rsa_saos.o" =>
[
"crypto/rsa/rsa_saos.c",
],
"crypto/rsa/rsa_sign.o" =>
[
"crypto/rsa/rsa_sign.c",
],
"crypto/rsa/rsa_ssl.o" =>
[
"crypto/rsa/rsa_ssl.c",
],
"crypto/rsa/rsa_x931.o" =>
[
"crypto/rsa/rsa_x931.c",
],
"crypto/rsa/rsa_x931g.o" =>
[
"crypto/rsa/rsa_x931g.c",
],
"crypto/seed/seed.o" =>
[
"crypto/seed/seed.c",
],
"crypto/seed/seed_cbc.o" =>
[
"crypto/seed/seed_cbc.c",
],
"crypto/seed/seed_cfb.o" =>
[
"crypto/seed/seed_cfb.c",
],
"crypto/seed/seed_ecb.o" =>
[
"crypto/seed/seed_ecb.c",
],
"crypto/seed/seed_ofb.o" =>
[
"crypto/seed/seed_ofb.c",
],
"crypto/sha/keccak1600.o" =>
[
"crypto/sha/keccak1600.c",
],
"crypto/sha/sha1_one.o" =>
[
"crypto/sha/sha1_one.c",
],
"crypto/sha/sha1dgst.o" =>
[
"crypto/sha/sha1dgst.c",
],
"crypto/sha/sha256.o" =>
[
"crypto/sha/sha256.c",
],
"crypto/sha/sha512.o" =>
[
"crypto/sha/sha512.c",
],
"crypto/siphash/siphash.o" =>
[
"crypto/siphash/siphash.c",
],
"crypto/siphash/siphash_ameth.o" =>
[
"crypto/siphash/siphash_ameth.c",
],
"crypto/siphash/siphash_pmeth.o" =>
[
"crypto/siphash/siphash_pmeth.c",
],
"crypto/sm2/sm2_crypt.o" =>
[
"crypto/sm2/sm2_crypt.c",
],
"crypto/sm2/sm2_err.o" =>
[
"crypto/sm2/sm2_err.c",
],
"crypto/sm2/sm2_pmeth.o" =>
[
"crypto/sm2/sm2_pmeth.c",
],
"crypto/sm2/sm2_sign.o" =>
[
"crypto/sm2/sm2_sign.c",
],
"crypto/sm3/m_sm3.o" =>
[
"crypto/sm3/m_sm3.c",
],
"crypto/sm3/sm3.o" =>
[
"crypto/sm3/sm3.c",
],
"crypto/sm4/sm4.o" =>
[
"crypto/sm4/sm4.c",
],
"crypto/srp/srp_lib.o" =>
[
"crypto/srp/srp_lib.c",
],
"crypto/srp/srp_vfy.o" =>
[
"crypto/srp/srp_vfy.c",
],
"crypto/stack/stack.o" =>
[
"crypto/stack/stack.c",
],
"crypto/store/loader_file.o" =>
[
"crypto/store/loader_file.c",
],
"crypto/store/store_err.o" =>
[
"crypto/store/store_err.c",
],
"crypto/store/store_init.o" =>
[
"crypto/store/store_init.c",
],
"crypto/store/store_lib.o" =>
[
"crypto/store/store_lib.c",
],
"crypto/store/store_register.o" =>
[
"crypto/store/store_register.c",
],
"crypto/store/store_strings.o" =>
[
"crypto/store/store_strings.c",
],
"crypto/threads_none.o" =>
[
"crypto/threads_none.c",
],
"crypto/threads_pthread.o" =>
[
"crypto/threads_pthread.c",
],
"crypto/threads_win.o" =>
[
"crypto/threads_win.c",
],
"crypto/ts/ts_asn1.o" =>
[
"crypto/ts/ts_asn1.c",
],
"crypto/ts/ts_conf.o" =>
[
"crypto/ts/ts_conf.c",
],
"crypto/ts/ts_err.o" =>
[
"crypto/ts/ts_err.c",
],
"crypto/ts/ts_lib.o" =>
[
"crypto/ts/ts_lib.c",
],
"crypto/ts/ts_req_print.o" =>
[
"crypto/ts/ts_req_print.c",
],
"crypto/ts/ts_req_utils.o" =>
[
"crypto/ts/ts_req_utils.c",
],
"crypto/ts/ts_rsp_print.o" =>
[
"crypto/ts/ts_rsp_print.c",
],
"crypto/ts/ts_rsp_sign.o" =>
[
"crypto/ts/ts_rsp_sign.c",
],
"crypto/ts/ts_rsp_utils.o" =>
[
"crypto/ts/ts_rsp_utils.c",
],
"crypto/ts/ts_rsp_verify.o" =>
[
"crypto/ts/ts_rsp_verify.c",
],
"crypto/ts/ts_verify_ctx.o" =>
[
"crypto/ts/ts_verify_ctx.c",
],
"crypto/txt_db/txt_db.o" =>
[
"crypto/txt_db/txt_db.c",
],
"crypto/ui/ui_err.o" =>
[
"crypto/ui/ui_err.c",
],
"crypto/ui/ui_lib.o" =>
[
"crypto/ui/ui_lib.c",
],
"crypto/ui/ui_null.o" =>
[
"crypto/ui/ui_null.c",
],
"crypto/ui/ui_openssl.o" =>
[
"crypto/ui/ui_openssl.c",
],
"crypto/ui/ui_util.o" =>
[
"crypto/ui/ui_util.c",
],
"crypto/uid.o" =>
[
"crypto/uid.c",
],
"crypto/whrlpool/wp_block.o" =>
[
"crypto/whrlpool/wp_block.c",
],
"crypto/whrlpool/wp_dgst.o" =>
[
"crypto/whrlpool/wp_dgst.c",
],
"crypto/x509/by_dir.o" =>
[
"crypto/x509/by_dir.c",
],
"crypto/x509/by_file.o" =>
[
"crypto/x509/by_file.c",
],
"crypto/x509/t_crl.o" =>
[
"crypto/x509/t_crl.c",
],
"crypto/x509/t_req.o" =>
[
"crypto/x509/t_req.c",
],
"crypto/x509/t_x509.o" =>
[
"crypto/x509/t_x509.c",
],
"crypto/x509/x509_att.o" =>
[
"crypto/x509/x509_att.c",
],
"crypto/x509/x509_cmp.o" =>
[
"crypto/x509/x509_cmp.c",
],
"crypto/x509/x509_d2.o" =>
[
"crypto/x509/x509_d2.c",
],
"crypto/x509/x509_def.o" =>
[
"crypto/x509/x509_def.c",
],
"crypto/x509/x509_err.o" =>
[
"crypto/x509/x509_err.c",
],
"crypto/x509/x509_ext.o" =>
[
"crypto/x509/x509_ext.c",
],
"crypto/x509/x509_lu.o" =>
[
"crypto/x509/x509_lu.c",
],
"crypto/x509/x509_meth.o" =>
[
"crypto/x509/x509_meth.c",
],
"crypto/x509/x509_obj.o" =>
[
"crypto/x509/x509_obj.c",
],
"crypto/x509/x509_r2x.o" =>
[
"crypto/x509/x509_r2x.c",
],
"crypto/x509/x509_req.o" =>
[
"crypto/x509/x509_req.c",
],
"crypto/x509/x509_set.o" =>
[
"crypto/x509/x509_set.c",
],
"crypto/x509/x509_trs.o" =>
[
"crypto/x509/x509_trs.c",
],
"crypto/x509/x509_txt.o" =>
[
"crypto/x509/x509_txt.c",
],
"crypto/x509/x509_v3.o" =>
[
"crypto/x509/x509_v3.c",
],
"crypto/x509/x509_vfy.o" =>
[
"crypto/x509/x509_vfy.c",
],
"crypto/x509/x509_vpm.o" =>
[
"crypto/x509/x509_vpm.c",
],
"crypto/x509/x509cset.o" =>
[
"crypto/x509/x509cset.c",
],
"crypto/x509/x509name.o" =>
[
"crypto/x509/x509name.c",
],
"crypto/x509/x509rset.o" =>
[
"crypto/x509/x509rset.c",
],
"crypto/x509/x509spki.o" =>
[
"crypto/x509/x509spki.c",
],
"crypto/x509/x509type.o" =>
[
"crypto/x509/x509type.c",
],
"crypto/x509/x_all.o" =>
[
"crypto/x509/x_all.c",
],
"crypto/x509/x_attrib.o" =>
[
"crypto/x509/x_attrib.c",
],
"crypto/x509/x_crl.o" =>
[
"crypto/x509/x_crl.c",
],
"crypto/x509/x_exten.o" =>
[
"crypto/x509/x_exten.c",
],
"crypto/x509/x_name.o" =>
[
"crypto/x509/x_name.c",
],
"crypto/x509/x_pubkey.o" =>
[
"crypto/x509/x_pubkey.c",
],
"crypto/x509/x_req.o" =>
[
"crypto/x509/x_req.c",
],
"crypto/x509/x_x509.o" =>
[
"crypto/x509/x_x509.c",
],
"crypto/x509/x_x509a.o" =>
[
"crypto/x509/x_x509a.c",
],
"crypto/x509v3/pcy_cache.o" =>
[
"crypto/x509v3/pcy_cache.c",
],
"crypto/x509v3/pcy_data.o" =>
[
"crypto/x509v3/pcy_data.c",
],
"crypto/x509v3/pcy_lib.o" =>
[
"crypto/x509v3/pcy_lib.c",
],
"crypto/x509v3/pcy_map.o" =>
[
"crypto/x509v3/pcy_map.c",
],
"crypto/x509v3/pcy_node.o" =>
[
"crypto/x509v3/pcy_node.c",
],
"crypto/x509v3/pcy_tree.o" =>
[
"crypto/x509v3/pcy_tree.c",
],
"crypto/x509v3/v3_addr.o" =>
[
"crypto/x509v3/v3_addr.c",
],
"crypto/x509v3/v3_admis.o" =>
[
"crypto/x509v3/v3_admis.c",
],
"crypto/x509v3/v3_akey.o" =>
[
"crypto/x509v3/v3_akey.c",
],
"crypto/x509v3/v3_akeya.o" =>
[
"crypto/x509v3/v3_akeya.c",
],
"crypto/x509v3/v3_alt.o" =>
[
"crypto/x509v3/v3_alt.c",
],
"crypto/x509v3/v3_asid.o" =>
[
"crypto/x509v3/v3_asid.c",
],
"crypto/x509v3/v3_bcons.o" =>
[
"crypto/x509v3/v3_bcons.c",
],
"crypto/x509v3/v3_bitst.o" =>
[
"crypto/x509v3/v3_bitst.c",
],
"crypto/x509v3/v3_conf.o" =>
[
"crypto/x509v3/v3_conf.c",
],
"crypto/x509v3/v3_cpols.o" =>
[
"crypto/x509v3/v3_cpols.c",
],
"crypto/x509v3/v3_crld.o" =>
[
"crypto/x509v3/v3_crld.c",
],
"crypto/x509v3/v3_enum.o" =>
[
"crypto/x509v3/v3_enum.c",
],
"crypto/x509v3/v3_extku.o" =>
[
"crypto/x509v3/v3_extku.c",
],
"crypto/x509v3/v3_genn.o" =>
[
"crypto/x509v3/v3_genn.c",
],
"crypto/x509v3/v3_ia5.o" =>
[
"crypto/x509v3/v3_ia5.c",
],
"crypto/x509v3/v3_info.o" =>
[
"crypto/x509v3/v3_info.c",
],
"crypto/x509v3/v3_int.o" =>
[
"crypto/x509v3/v3_int.c",
],
"crypto/x509v3/v3_lib.o" =>
[
"crypto/x509v3/v3_lib.c",
],
"crypto/x509v3/v3_ncons.o" =>
[
"crypto/x509v3/v3_ncons.c",
],
"crypto/x509v3/v3_pci.o" =>
[
"crypto/x509v3/v3_pci.c",
],
"crypto/x509v3/v3_pcia.o" =>
[
"crypto/x509v3/v3_pcia.c",
],
"crypto/x509v3/v3_pcons.o" =>
[
"crypto/x509v3/v3_pcons.c",
],
"crypto/x509v3/v3_pku.o" =>
[
"crypto/x509v3/v3_pku.c",
],
"crypto/x509v3/v3_pmaps.o" =>
[
"crypto/x509v3/v3_pmaps.c",
],
"crypto/x509v3/v3_prn.o" =>
[
"crypto/x509v3/v3_prn.c",
],
"crypto/x509v3/v3_purp.o" =>
[
"crypto/x509v3/v3_purp.c",
],
"crypto/x509v3/v3_skey.o" =>
[
"crypto/x509v3/v3_skey.c",
],
"crypto/x509v3/v3_sxnet.o" =>
[
"crypto/x509v3/v3_sxnet.c",
],
"crypto/x509v3/v3_tlsf.o" =>
[
"crypto/x509v3/v3_tlsf.c",
],
"crypto/x509v3/v3_utl.o" =>
[
"crypto/x509v3/v3_utl.c",
],
"crypto/x509v3/v3err.o" =>
[
"crypto/x509v3/v3err.c",
],
"engines/e_capi.o" =>
[
"engines/e_capi.c",
],
"engines/e_padlock.o" =>
[
"engines/e_padlock.c",
],
"fuzz/asn1-test" =>
[
"fuzz/asn1.o",
"fuzz/test-corpus.o",
],
"fuzz/asn1.o" =>
[
"fuzz/asn1.c",
],
"fuzz/asn1parse-test" =>
[
"fuzz/asn1parse.o",
"fuzz/test-corpus.o",
],
"fuzz/asn1parse.o" =>
[
"fuzz/asn1parse.c",
],
"fuzz/bignum-test" =>
[
"fuzz/bignum.o",
"fuzz/test-corpus.o",
],
"fuzz/bignum.o" =>
[
"fuzz/bignum.c",
],
"fuzz/bndiv-test" =>
[
"fuzz/bndiv.o",
"fuzz/test-corpus.o",
],
"fuzz/bndiv.o" =>
[
"fuzz/bndiv.c",
],
"fuzz/client-test" =>
[
"fuzz/client.o",
"fuzz/test-corpus.o",
],
"fuzz/client.o" =>
[
"fuzz/client.c",
],
"fuzz/cms-test" =>
[
"fuzz/cms.o",
"fuzz/test-corpus.o",
],
"fuzz/cms.o" =>
[
"fuzz/cms.c",
],
"fuzz/conf-test" =>
[
"fuzz/conf.o",
"fuzz/test-corpus.o",
],
"fuzz/conf.o" =>
[
"fuzz/conf.c",
],
"fuzz/crl-test" =>
[
"fuzz/crl.o",
"fuzz/test-corpus.o",
],
"fuzz/crl.o" =>
[
"fuzz/crl.c",
],
"fuzz/ct-test" =>
[
"fuzz/ct.o",
"fuzz/test-corpus.o",
],
"fuzz/ct.o" =>
[
"fuzz/ct.c",
],
"fuzz/server-test" =>
[
"fuzz/server.o",
"fuzz/test-corpus.o",
],
"fuzz/server.o" =>
[
"fuzz/server.c",
],
"fuzz/test-corpus.o" =>
[
"fuzz/test-corpus.c",
],
"fuzz/x509-test" =>
[
"fuzz/test-corpus.o",
"fuzz/x509.o",
],
"fuzz/x509.o" =>
[
"fuzz/x509.c",
],
"libcrypto" =>
[
"crypto/aes/aes_cbc.o",
"crypto/aes/aes_cfb.o",
"crypto/aes/aes_core.o",
"crypto/aes/aes_ecb.o",
"crypto/aes/aes_ige.o",
"crypto/aes/aes_misc.o",
"crypto/aes/aes_ofb.o",
"crypto/aes/aes_wrap.o",
"crypto/aria/aria.o",
"crypto/asn1/a_bitstr.o",
"crypto/asn1/a_d2i_fp.o",
"crypto/asn1/a_digest.o",
"crypto/asn1/a_dup.o",
"crypto/asn1/a_gentm.o",
"crypto/asn1/a_i2d_fp.o",
"crypto/asn1/a_int.o",
"crypto/asn1/a_mbstr.o",
"crypto/asn1/a_object.o",
"crypto/asn1/a_octet.o",
"crypto/asn1/a_print.o",
"crypto/asn1/a_sign.o",
"crypto/asn1/a_strex.o",
"crypto/asn1/a_strnid.o",
"crypto/asn1/a_time.o",
"crypto/asn1/a_type.o",
"crypto/asn1/a_utctm.o",
"crypto/asn1/a_utf8.o",
"crypto/asn1/a_verify.o",
"crypto/asn1/ameth_lib.o",
"crypto/asn1/asn1_err.o",
"crypto/asn1/asn1_gen.o",
"crypto/asn1/asn1_item_list.o",
"crypto/asn1/asn1_lib.o",
"crypto/asn1/asn1_par.o",
"crypto/asn1/asn_mime.o",
"crypto/asn1/asn_moid.o",
"crypto/asn1/asn_mstbl.o",
"crypto/asn1/asn_pack.o",
"crypto/asn1/bio_asn1.o",
"crypto/asn1/bio_ndef.o",
"crypto/asn1/d2i_pr.o",
"crypto/asn1/d2i_pu.o",
"crypto/asn1/evp_asn1.o",
"crypto/asn1/f_int.o",
"crypto/asn1/f_string.o",
"crypto/asn1/i2d_pr.o",
"crypto/asn1/i2d_pu.o",
"crypto/asn1/n_pkey.o",
"crypto/asn1/nsseq.o",
"crypto/asn1/p5_pbe.o",
"crypto/asn1/p5_pbev2.o",
"crypto/asn1/p5_scrypt.o",
"crypto/asn1/p8_pkey.o",
"crypto/asn1/t_bitst.o",
"crypto/asn1/t_pkey.o",
"crypto/asn1/t_spki.o",
"crypto/asn1/tasn_dec.o",
"crypto/asn1/tasn_enc.o",
"crypto/asn1/tasn_fre.o",
"crypto/asn1/tasn_new.o",
"crypto/asn1/tasn_prn.o",
"crypto/asn1/tasn_scn.o",
"crypto/asn1/tasn_typ.o",
"crypto/asn1/tasn_utl.o",
"crypto/asn1/x_algor.o",
"crypto/asn1/x_bignum.o",
"crypto/asn1/x_info.o",
"crypto/asn1/x_int64.o",
"crypto/asn1/x_long.o",
"crypto/asn1/x_pkey.o",
"crypto/asn1/x_sig.o",
"crypto/asn1/x_spki.o",
"crypto/asn1/x_val.o",
"crypto/async/arch/async_null.o",
"crypto/async/arch/async_posix.o",
"crypto/async/arch/async_win.o",
"crypto/async/async.o",
"crypto/async/async_err.o",
"crypto/async/async_wait.o",
"crypto/bf/bf_cfb64.o",
"crypto/bf/bf_ecb.o",
"crypto/bf/bf_enc.o",
"crypto/bf/bf_ofb64.o",
"crypto/bf/bf_skey.o",
"crypto/bio/b_addr.o",
"crypto/bio/b_dump.o",
"crypto/bio/b_print.o",
"crypto/bio/b_sock.o",
"crypto/bio/b_sock2.o",
"crypto/bio/bf_buff.o",
"crypto/bio/bf_lbuf.o",
"crypto/bio/bf_nbio.o",
"crypto/bio/bf_null.o",
"crypto/bio/bio_cb.o",
"crypto/bio/bio_err.o",
"crypto/bio/bio_lib.o",
"crypto/bio/bio_meth.o",
"crypto/bio/bss_acpt.o",
"crypto/bio/bss_bio.o",
"crypto/bio/bss_conn.o",
"crypto/bio/bss_dgram.o",
"crypto/bio/bss_fd.o",
"crypto/bio/bss_file.o",
"crypto/bio/bss_log.o",
"crypto/bio/bss_mem.o",
"crypto/bio/bss_null.o",
"crypto/bio/bss_sock.o",
"crypto/blake2/blake2b.o",
"crypto/blake2/blake2s.o",
"crypto/blake2/m_blake2b.o",
"crypto/blake2/m_blake2s.o",
"crypto/bn/bn_add.o",
"crypto/bn/bn_asm.o",
"crypto/bn/bn_blind.o",
"crypto/bn/bn_const.o",
"crypto/bn/bn_ctx.o",
"crypto/bn/bn_depr.o",
"crypto/bn/bn_dh.o",
"crypto/bn/bn_div.o",
"crypto/bn/bn_err.o",
"crypto/bn/bn_exp.o",
"crypto/bn/bn_exp2.o",
"crypto/bn/bn_gcd.o",
"crypto/bn/bn_gf2m.o",
"crypto/bn/bn_intern.o",
"crypto/bn/bn_kron.o",
"crypto/bn/bn_lib.o",
"crypto/bn/bn_mod.o",
"crypto/bn/bn_mont.o",
"crypto/bn/bn_mpi.o",
"crypto/bn/bn_mul.o",
"crypto/bn/bn_nist.o",
"crypto/bn/bn_prime.o",
"crypto/bn/bn_print.o",
"crypto/bn/bn_rand.o",
"crypto/bn/bn_recp.o",
"crypto/bn/bn_shift.o",
"crypto/bn/bn_sqr.o",
"crypto/bn/bn_sqrt.o",
"crypto/bn/bn_srp.o",
"crypto/bn/bn_word.o",
"crypto/bn/bn_x931p.o",
"crypto/buffer/buf_err.o",
"crypto/buffer/buffer.o",
"crypto/camellia/camellia.o",
"crypto/camellia/cmll_cbc.o",
"crypto/camellia/cmll_cfb.o",
"crypto/camellia/cmll_ctr.o",
"crypto/camellia/cmll_ecb.o",
"crypto/camellia/cmll_misc.o",
"crypto/camellia/cmll_ofb.o",
"crypto/cast/c_cfb64.o",
"crypto/cast/c_ecb.o",
"crypto/cast/c_enc.o",
"crypto/cast/c_ofb64.o",
"crypto/cast/c_skey.o",
"crypto/chacha/chacha_enc.o",
"crypto/cmac/cm_ameth.o",
"crypto/cmac/cm_pmeth.o",
"crypto/cmac/cmac.o",
"crypto/cms/cms_asn1.o",
"crypto/cms/cms_att.o",
"crypto/cms/cms_cd.o",
"crypto/cms/cms_dd.o",
"crypto/cms/cms_enc.o",
"crypto/cms/cms_env.o",
"crypto/cms/cms_err.o",
"crypto/cms/cms_ess.o",
"crypto/cms/cms_io.o",
"crypto/cms/cms_kari.o",
"crypto/cms/cms_lib.o",
"crypto/cms/cms_pwri.o",
"crypto/cms/cms_sd.o",
"crypto/cms/cms_smime.o",
"crypto/conf/conf_api.o",
"crypto/conf/conf_def.o",
"crypto/conf/conf_err.o",
"crypto/conf/conf_lib.o",
"crypto/conf/conf_mall.o",
"crypto/conf/conf_mod.o",
"crypto/conf/conf_sap.o",
"crypto/conf/conf_ssl.o",
"crypto/cpt_err.o",
"crypto/cryptlib.o",
"crypto/ct/ct_b64.o",
"crypto/ct/ct_err.o",
"crypto/ct/ct_log.o",
"crypto/ct/ct_oct.o",
"crypto/ct/ct_policy.o",
"crypto/ct/ct_prn.o",
"crypto/ct/ct_sct.o",
"crypto/ct/ct_sct_ctx.o",
"crypto/ct/ct_vfy.o",
"crypto/ct/ct_x509v3.o",
"crypto/ctype.o",
"crypto/cversion.o",
"crypto/des/cbc_cksm.o",
"crypto/des/cbc_enc.o",
"crypto/des/cfb64ede.o",
"crypto/des/cfb64enc.o",
"crypto/des/cfb_enc.o",
"crypto/des/des_enc.o",
"crypto/des/ecb3_enc.o",
"crypto/des/ecb_enc.o",
"crypto/des/fcrypt.o",
"crypto/des/fcrypt_b.o",
"crypto/des/ofb64ede.o",
"crypto/des/ofb64enc.o",
"crypto/des/ofb_enc.o",
"crypto/des/pcbc_enc.o",
"crypto/des/qud_cksm.o",
"crypto/des/rand_key.o",
"crypto/des/set_key.o",
"crypto/des/str2key.o",
"crypto/des/xcbc_enc.o",
"crypto/dh/dh_ameth.o",
"crypto/dh/dh_asn1.o",
"crypto/dh/dh_check.o",
"crypto/dh/dh_depr.o",
"crypto/dh/dh_err.o",
"crypto/dh/dh_gen.o",
"crypto/dh/dh_kdf.o",
"crypto/dh/dh_key.o",
"crypto/dh/dh_lib.o",
"crypto/dh/dh_meth.o",
"crypto/dh/dh_pmeth.o",
"crypto/dh/dh_prn.o",
"crypto/dh/dh_rfc5114.o",
"crypto/dh/dh_rfc7919.o",
"crypto/dsa/dsa_ameth.o",
"crypto/dsa/dsa_asn1.o",
"crypto/dsa/dsa_depr.o",
"crypto/dsa/dsa_err.o",
"crypto/dsa/dsa_gen.o",
"crypto/dsa/dsa_key.o",
"crypto/dsa/dsa_lib.o",
"crypto/dsa/dsa_meth.o",
"crypto/dsa/dsa_ossl.o",
"crypto/dsa/dsa_pmeth.o",
"crypto/dsa/dsa_prn.o",
"crypto/dsa/dsa_sign.o",
"crypto/dsa/dsa_vrf.o",
"crypto/dso/dso_dl.o",
"crypto/dso/dso_dlfcn.o",
"crypto/dso/dso_err.o",
"crypto/dso/dso_lib.o",
"crypto/dso/dso_openssl.o",
"crypto/dso/dso_vms.o",
"crypto/dso/dso_win32.o",
"crypto/ebcdic.o",
"crypto/ec/curve25519.o",
"crypto/ec/curve448/arch_32/f_impl.o",
"crypto/ec/curve448/curve448.o",
"crypto/ec/curve448/curve448_tables.o",
"crypto/ec/curve448/eddsa.o",
"crypto/ec/curve448/f_generic.o",
"crypto/ec/curve448/scalar.o",
"crypto/ec/ec2_oct.o",
"crypto/ec/ec2_smpl.o",
"crypto/ec/ec_ameth.o",
"crypto/ec/ec_asn1.o",
"crypto/ec/ec_check.o",
"crypto/ec/ec_curve.o",
"crypto/ec/ec_cvt.o",
"crypto/ec/ec_err.o",
"crypto/ec/ec_key.o",
"crypto/ec/ec_kmeth.o",
"crypto/ec/ec_lib.o",
"crypto/ec/ec_mult.o",
"crypto/ec/ec_oct.o",
"crypto/ec/ec_pmeth.o",
"crypto/ec/ec_print.o",
"crypto/ec/ecdh_kdf.o",
"crypto/ec/ecdh_ossl.o",
"crypto/ec/ecdsa_ossl.o",
"crypto/ec/ecdsa_sign.o",
"crypto/ec/ecdsa_vrf.o",
"crypto/ec/eck_prn.o",
"crypto/ec/ecp_mont.o",
"crypto/ec/ecp_nist.o",
"crypto/ec/ecp_nistp224.o",
"crypto/ec/ecp_nistp256.o",
"crypto/ec/ecp_nistp521.o",
"crypto/ec/ecp_nistputil.o",
"crypto/ec/ecp_oct.o",
"crypto/ec/ecp_smpl.o",
"crypto/ec/ecx_meth.o",
"crypto/engine/eng_all.o",
"crypto/engine/eng_cnf.o",
"crypto/engine/eng_ctrl.o",
"crypto/engine/eng_dyn.o",
"crypto/engine/eng_err.o",
"crypto/engine/eng_fat.o",
"crypto/engine/eng_init.o",
"crypto/engine/eng_lib.o",
"crypto/engine/eng_list.o",
"crypto/engine/eng_openssl.o",
"crypto/engine/eng_pkey.o",
"crypto/engine/eng_rdrand.o",
"crypto/engine/eng_table.o",
"crypto/engine/tb_asnmth.o",
"crypto/engine/tb_cipher.o",
"crypto/engine/tb_dh.o",
"crypto/engine/tb_digest.o",
"crypto/engine/tb_dsa.o",
"crypto/engine/tb_eckey.o",
"crypto/engine/tb_pkmeth.o",
"crypto/engine/tb_rand.o",
"crypto/engine/tb_rsa.o",
"crypto/err/err.o",
"crypto/err/err_all.o",
"crypto/err/err_prn.o",
"crypto/evp/bio_b64.o",
"crypto/evp/bio_enc.o",
"crypto/evp/bio_md.o",
"crypto/evp/bio_ok.o",
"crypto/evp/c_allc.o",
"crypto/evp/c_alld.o",
"crypto/evp/cmeth_lib.o",
"crypto/evp/digest.o",
"crypto/evp/e_aes.o",
"crypto/evp/e_aes_cbc_hmac_sha1.o",
"crypto/evp/e_aes_cbc_hmac_sha256.o",
"crypto/evp/e_aria.o",
"crypto/evp/e_bf.o",
"crypto/evp/e_camellia.o",
"crypto/evp/e_cast.o",
"crypto/evp/e_chacha20_poly1305.o",
"crypto/evp/e_des.o",
"crypto/evp/e_des3.o",
"crypto/evp/e_idea.o",
"crypto/evp/e_null.o",
"crypto/evp/e_old.o",
"crypto/evp/e_rc2.o",
"crypto/evp/e_rc4.o",
"crypto/evp/e_rc4_hmac_md5.o",
"crypto/evp/e_rc5.o",
"crypto/evp/e_seed.o",
"crypto/evp/e_sm4.o",
"crypto/evp/e_xcbc_d.o",
"crypto/evp/encode.o",
"crypto/evp/evp_cnf.o",
"crypto/evp/evp_enc.o",
"crypto/evp/evp_err.o",
"crypto/evp/evp_key.o",
"crypto/evp/evp_lib.o",
"crypto/evp/evp_pbe.o",
"crypto/evp/evp_pkey.o",
"crypto/evp/m_md2.o",
"crypto/evp/m_md4.o",
"crypto/evp/m_md5.o",
"crypto/evp/m_md5_sha1.o",
"crypto/evp/m_mdc2.o",
"crypto/evp/m_null.o",
"crypto/evp/m_ripemd.o",
"crypto/evp/m_sha1.o",
"crypto/evp/m_sha3.o",
"crypto/evp/m_sigver.o",
"crypto/evp/m_wp.o",
"crypto/evp/names.o",
"crypto/evp/p5_crpt.o",
"crypto/evp/p5_crpt2.o",
"crypto/evp/p_dec.o",
"crypto/evp/p_enc.o",
"crypto/evp/p_lib.o",
"crypto/evp/p_open.o",
"crypto/evp/p_seal.o",
"crypto/evp/p_sign.o",
"crypto/evp/p_verify.o",
"crypto/evp/pbe_scrypt.o",
"crypto/evp/pmeth_fn.o",
"crypto/evp/pmeth_gn.o",
"crypto/evp/pmeth_lib.o",
"crypto/ex_data.o",
"crypto/getenv.o",
"crypto/hmac/hm_ameth.o",
"crypto/hmac/hm_pmeth.o",
"crypto/hmac/hmac.o",
"crypto/idea/i_cbc.o",
"crypto/idea/i_cfb64.o",
"crypto/idea/i_ecb.o",
"crypto/idea/i_ofb64.o",
"crypto/idea/i_skey.o",
"crypto/init.o",
"crypto/kdf/hkdf.o",
"crypto/kdf/kdf_err.o",
"crypto/kdf/scrypt.o",
"crypto/kdf/tls1_prf.o",
"crypto/lhash/lh_stats.o",
"crypto/lhash/lhash.o",
"crypto/md4/md4_dgst.o",
"crypto/md4/md4_one.o",
"crypto/md5/md5_dgst.o",
"crypto/md5/md5_one.o",
"crypto/mdc2/mdc2_one.o",
"crypto/mdc2/mdc2dgst.o",
"crypto/mem.o",
"crypto/mem_clr.o",
"crypto/mem_dbg.o",
"crypto/mem_sec.o",
"crypto/modes/cbc128.o",
"crypto/modes/ccm128.o",
"crypto/modes/cfb128.o",
"crypto/modes/ctr128.o",
"crypto/modes/cts128.o",
"crypto/modes/gcm128.o",
"crypto/modes/ocb128.o",
"crypto/modes/ofb128.o",
"crypto/modes/wrap128.o",
"crypto/modes/xts128.o",
"crypto/o_dir.o",
"crypto/o_fips.o",
"crypto/o_fopen.o",
"crypto/o_init.o",
"crypto/o_str.o",
"crypto/o_time.o",
"crypto/objects/o_names.o",
"crypto/objects/obj_dat.o",
"crypto/objects/obj_err.o",
"crypto/objects/obj_lib.o",
"crypto/objects/obj_xref.o",
"crypto/ocsp/ocsp_asn.o",
"crypto/ocsp/ocsp_cl.o",
"crypto/ocsp/ocsp_err.o",
"crypto/ocsp/ocsp_ext.o",
"crypto/ocsp/ocsp_ht.o",
"crypto/ocsp/ocsp_lib.o",
"crypto/ocsp/ocsp_prn.o",
"crypto/ocsp/ocsp_srv.o",
"crypto/ocsp/ocsp_vfy.o",
"crypto/ocsp/v3_ocsp.o",
"crypto/pem/pem_all.o",
"crypto/pem/pem_err.o",
"crypto/pem/pem_info.o",
"crypto/pem/pem_lib.o",
"crypto/pem/pem_oth.o",
"crypto/pem/pem_pk8.o",
"crypto/pem/pem_pkey.o",
"crypto/pem/pem_sign.o",
"crypto/pem/pem_x509.o",
"crypto/pem/pem_xaux.o",
"crypto/pem/pvkfmt.o",
"crypto/pkcs12/p12_add.o",
"crypto/pkcs12/p12_asn.o",
"crypto/pkcs12/p12_attr.o",
"crypto/pkcs12/p12_crpt.o",
"crypto/pkcs12/p12_crt.o",
"crypto/pkcs12/p12_decr.o",
"crypto/pkcs12/p12_init.o",
"crypto/pkcs12/p12_key.o",
"crypto/pkcs12/p12_kiss.o",
"crypto/pkcs12/p12_mutl.o",
"crypto/pkcs12/p12_npas.o",
"crypto/pkcs12/p12_p8d.o",
"crypto/pkcs12/p12_p8e.o",
"crypto/pkcs12/p12_sbag.o",
"crypto/pkcs12/p12_utl.o",
"crypto/pkcs12/pk12err.o",
"crypto/pkcs7/bio_pk7.o",
"crypto/pkcs7/pk7_asn1.o",
"crypto/pkcs7/pk7_attr.o",
"crypto/pkcs7/pk7_doit.o",
"crypto/pkcs7/pk7_lib.o",
"crypto/pkcs7/pk7_mime.o",
"crypto/pkcs7/pk7_smime.o",
"crypto/pkcs7/pkcs7err.o",
"crypto/poly1305/poly1305.o",
"crypto/poly1305/poly1305_ameth.o",
"crypto/poly1305/poly1305_pmeth.o",
"crypto/rand/drbg_ctr.o",
"crypto/rand/drbg_lib.o",
"crypto/rand/rand_egd.o",
"crypto/rand/rand_err.o",
"crypto/rand/rand_lib.o",
"crypto/rand/rand_unix.o",
"crypto/rand/rand_vms.o",
"crypto/rand/rand_win.o",
"crypto/rand/randfile.o",
"crypto/rc2/rc2_cbc.o",
"crypto/rc2/rc2_ecb.o",
"crypto/rc2/rc2_skey.o",
"crypto/rc2/rc2cfb64.o",
"crypto/rc2/rc2ofb64.o",
"crypto/rc4/rc4_enc.o",
"crypto/rc4/rc4_skey.o",
"crypto/ripemd/rmd_dgst.o",
"crypto/ripemd/rmd_one.o",
"crypto/rsa/rsa_ameth.o",
"crypto/rsa/rsa_asn1.o",
"crypto/rsa/rsa_chk.o",
"crypto/rsa/rsa_crpt.o",
"crypto/rsa/rsa_depr.o",
"crypto/rsa/rsa_err.o",
"crypto/rsa/rsa_gen.o",
"crypto/rsa/rsa_lib.o",
"crypto/rsa/rsa_meth.o",
"crypto/rsa/rsa_mp.o",
"crypto/rsa/rsa_none.o",
"crypto/rsa/rsa_oaep.o",
"crypto/rsa/rsa_ossl.o",
"crypto/rsa/rsa_pk1.o",
"crypto/rsa/rsa_pmeth.o",
"crypto/rsa/rsa_prn.o",
"crypto/rsa/rsa_pss.o",
"crypto/rsa/rsa_saos.o",
"crypto/rsa/rsa_sign.o",
"crypto/rsa/rsa_ssl.o",
"crypto/rsa/rsa_x931.o",
"crypto/rsa/rsa_x931g.o",
"crypto/seed/seed.o",
"crypto/seed/seed_cbc.o",
"crypto/seed/seed_cfb.o",
"crypto/seed/seed_ecb.o",
"crypto/seed/seed_ofb.o",
"crypto/sha/keccak1600.o",
"crypto/sha/sha1_one.o",
"crypto/sha/sha1dgst.o",
"crypto/sha/sha256.o",
"crypto/sha/sha512.o",
"crypto/siphash/siphash.o",
"crypto/siphash/siphash_ameth.o",
"crypto/siphash/siphash_pmeth.o",
"crypto/sm2/sm2_crypt.o",
"crypto/sm2/sm2_err.o",
"crypto/sm2/sm2_pmeth.o",
"crypto/sm2/sm2_sign.o",
"crypto/sm3/m_sm3.o",
"crypto/sm3/sm3.o",
"crypto/sm4/sm4.o",
"crypto/srp/srp_lib.o",
"crypto/srp/srp_vfy.o",
"crypto/stack/stack.o",
"crypto/store/loader_file.o",
"crypto/store/store_err.o",
"crypto/store/store_init.o",
"crypto/store/store_lib.o",
"crypto/store/store_register.o",
"crypto/store/store_strings.o",
"crypto/threads_none.o",
"crypto/threads_pthread.o",
"crypto/threads_win.o",
"crypto/ts/ts_asn1.o",
"crypto/ts/ts_conf.o",
"crypto/ts/ts_err.o",
"crypto/ts/ts_lib.o",
"crypto/ts/ts_req_print.o",
"crypto/ts/ts_req_utils.o",
"crypto/ts/ts_rsp_print.o",
"crypto/ts/ts_rsp_sign.o",
"crypto/ts/ts_rsp_utils.o",
"crypto/ts/ts_rsp_verify.o",
"crypto/ts/ts_verify_ctx.o",
"crypto/txt_db/txt_db.o",
"crypto/ui/ui_err.o",
"crypto/ui/ui_lib.o",
"crypto/ui/ui_null.o",
"crypto/ui/ui_openssl.o",
"crypto/ui/ui_util.o",
"crypto/uid.o",
"crypto/whrlpool/wp_block.o",
"crypto/whrlpool/wp_dgst.o",
"crypto/x509/by_dir.o",
"crypto/x509/by_file.o",
"crypto/x509/t_crl.o",
"crypto/x509/t_req.o",
"crypto/x509/t_x509.o",
"crypto/x509/x509_att.o",
"crypto/x509/x509_cmp.o",
"crypto/x509/x509_d2.o",
"crypto/x509/x509_def.o",
"crypto/x509/x509_err.o",
"crypto/x509/x509_ext.o",
"crypto/x509/x509_lu.o",
"crypto/x509/x509_meth.o",
"crypto/x509/x509_obj.o",
"crypto/x509/x509_r2x.o",
"crypto/x509/x509_req.o",
"crypto/x509/x509_set.o",
"crypto/x509/x509_trs.o",
"crypto/x509/x509_txt.o",
"crypto/x509/x509_v3.o",
"crypto/x509/x509_vfy.o",
"crypto/x509/x509_vpm.o",
"crypto/x509/x509cset.o",
"crypto/x509/x509name.o",
"crypto/x509/x509rset.o",
"crypto/x509/x509spki.o",
"crypto/x509/x509type.o",
"crypto/x509/x_all.o",
"crypto/x509/x_attrib.o",
"crypto/x509/x_crl.o",
"crypto/x509/x_exten.o",
"crypto/x509/x_name.o",
"crypto/x509/x_pubkey.o",
"crypto/x509/x_req.o",
"crypto/x509/x_x509.o",
"crypto/x509/x_x509a.o",
"crypto/x509v3/pcy_cache.o",
"crypto/x509v3/pcy_data.o",
"crypto/x509v3/pcy_lib.o",
"crypto/x509v3/pcy_map.o",
"crypto/x509v3/pcy_node.o",
"crypto/x509v3/pcy_tree.o",
"crypto/x509v3/v3_addr.o",
"crypto/x509v3/v3_admis.o",
"crypto/x509v3/v3_akey.o",
"crypto/x509v3/v3_akeya.o",
"crypto/x509v3/v3_alt.o",
"crypto/x509v3/v3_asid.o",
"crypto/x509v3/v3_bcons.o",
"crypto/x509v3/v3_bitst.o",
"crypto/x509v3/v3_conf.o",
"crypto/x509v3/v3_cpols.o",
"crypto/x509v3/v3_crld.o",
"crypto/x509v3/v3_enum.o",
"crypto/x509v3/v3_extku.o",
"crypto/x509v3/v3_genn.o",
"crypto/x509v3/v3_ia5.o",
"crypto/x509v3/v3_info.o",
"crypto/x509v3/v3_int.o",
"crypto/x509v3/v3_lib.o",
"crypto/x509v3/v3_ncons.o",
"crypto/x509v3/v3_pci.o",
"crypto/x509v3/v3_pcia.o",
"crypto/x509v3/v3_pcons.o",
"crypto/x509v3/v3_pku.o",
"crypto/x509v3/v3_pmaps.o",
"crypto/x509v3/v3_prn.o",
"crypto/x509v3/v3_purp.o",
"crypto/x509v3/v3_skey.o",
"crypto/x509v3/v3_sxnet.o",
"crypto/x509v3/v3_tlsf.o",
"crypto/x509v3/v3_utl.o",
"crypto/x509v3/v3err.o",
"engines/e_capi.o",
"engines/e_padlock.o",
],
"libssl" =>
[
"ssl/bio_ssl.o",
"ssl/d1_lib.o",
"ssl/d1_msg.o",
"ssl/d1_srtp.o",
"ssl/methods.o",
"ssl/packet.o",
"ssl/pqueue.o",
"ssl/record/dtls1_bitmap.o",
"ssl/record/rec_layer_d1.o",
"ssl/record/rec_layer_s3.o",
"ssl/record/ssl3_buffer.o",
"ssl/record/ssl3_record.o",
"ssl/record/ssl3_record_tls13.o",
"ssl/s3_cbc.o",
"ssl/s3_enc.o",
"ssl/s3_lib.o",
"ssl/s3_msg.o",
"ssl/ssl_asn1.o",
"ssl/ssl_cert.o",
"ssl/ssl_ciph.o",
"ssl/ssl_conf.o",
"ssl/ssl_err.o",
"ssl/ssl_init.o",
"ssl/ssl_lib.o",
"ssl/ssl_mcnf.o",
"ssl/ssl_quic.o",
"ssl/ssl_rsa.o",
"ssl/ssl_sess.o",
"ssl/ssl_stat.o",
"ssl/ssl_txt.o",
"ssl/ssl_utst.o",
"ssl/statem/extensions.o",
"ssl/statem/extensions_clnt.o",
"ssl/statem/extensions_cust.o",
"ssl/statem/extensions_srvr.o",
"ssl/statem/statem.o",
"ssl/statem/statem_clnt.o",
"ssl/statem/statem_dtls.o",
"ssl/statem/statem_lib.o",
"ssl/statem/statem_quic.o",
"ssl/statem/statem_srvr.o",
"ssl/t1_enc.o",
"ssl/t1_lib.o",
"ssl/t1_trce.o",
"ssl/tls13_enc.o",
"ssl/tls_srp.o",
],
"ssl/bio_ssl.o" =>
[
"ssl/bio_ssl.c",
],
"ssl/d1_lib.o" =>
[
"ssl/d1_lib.c",
],
"ssl/d1_msg.o" =>
[
"ssl/d1_msg.c",
],
"ssl/d1_srtp.o" =>
[
"ssl/d1_srtp.c",
],
"ssl/methods.o" =>
[
"ssl/methods.c",
],
"ssl/packet.o" =>
[
"ssl/packet.c",
],
"ssl/pqueue.o" =>
[
"ssl/pqueue.c",
],
"ssl/record/dtls1_bitmap.o" =>
[
"ssl/record/dtls1_bitmap.c",
],
"ssl/record/rec_layer_d1.o" =>
[
"ssl/record/rec_layer_d1.c",
],
"ssl/record/rec_layer_s3.o" =>
[
"ssl/record/rec_layer_s3.c",
],
"ssl/record/ssl3_buffer.o" =>
[
"ssl/record/ssl3_buffer.c",
],
"ssl/record/ssl3_record.o" =>
[
"ssl/record/ssl3_record.c",
],
"ssl/record/ssl3_record_tls13.o" =>
[
"ssl/record/ssl3_record_tls13.c",
],
"ssl/s3_cbc.o" =>
[
"ssl/s3_cbc.c",
],
"ssl/s3_enc.o" =>
[
"ssl/s3_enc.c",
],
"ssl/s3_lib.o" =>
[
"ssl/s3_lib.c",
],
"ssl/s3_msg.o" =>
[
"ssl/s3_msg.c",
],
"ssl/ssl_asn1.o" =>
[
"ssl/ssl_asn1.c",
],
"ssl/ssl_cert.o" =>
[
"ssl/ssl_cert.c",
],
"ssl/ssl_ciph.o" =>
[
"ssl/ssl_ciph.c",
],
"ssl/ssl_conf.o" =>
[
"ssl/ssl_conf.c",
],
"ssl/ssl_err.o" =>
[
"ssl/ssl_err.c",
],
"ssl/ssl_init.o" =>
[
"ssl/ssl_init.c",
],
"ssl/ssl_lib.o" =>
[
"ssl/ssl_lib.c",
],
"ssl/ssl_mcnf.o" =>
[
"ssl/ssl_mcnf.c",
],
"ssl/ssl_quic.o" =>
[
"ssl/ssl_quic.c",
],
"ssl/ssl_rsa.o" =>
[
"ssl/ssl_rsa.c",
],
"ssl/ssl_sess.o" =>
[
"ssl/ssl_sess.c",
],
"ssl/ssl_stat.o" =>
[
"ssl/ssl_stat.c",
],
"ssl/ssl_txt.o" =>
[
"ssl/ssl_txt.c",
],
"ssl/ssl_utst.o" =>
[
"ssl/ssl_utst.c",
],
"ssl/statem/extensions.o" =>
[
"ssl/statem/extensions.c",
],
"ssl/statem/extensions_clnt.o" =>
[
"ssl/statem/extensions_clnt.c",
],
"ssl/statem/extensions_cust.o" =>
[
"ssl/statem/extensions_cust.c",
],
"ssl/statem/extensions_srvr.o" =>
[
"ssl/statem/extensions_srvr.c",
],
"ssl/statem/statem.o" =>
[
"ssl/statem/statem.c",
],
"ssl/statem/statem_clnt.o" =>
[
"ssl/statem/statem_clnt.c",
],
"ssl/statem/statem_dtls.o" =>
[
"ssl/statem/statem_dtls.c",
],
"ssl/statem/statem_lib.o" =>
[
"ssl/statem/statem_lib.c",
],
"ssl/statem/statem_quic.o" =>
[
"ssl/statem/statem_quic.c",
],
"ssl/statem/statem_srvr.o" =>
[
"ssl/statem/statem_srvr.c",
],
"ssl/t1_enc.o" =>
[
"ssl/t1_enc.c",
],
"ssl/t1_lib.o" =>
[
"ssl/t1_lib.c",
],
"ssl/t1_trce.o" =>
[
"ssl/t1_trce.c",
],
"ssl/tls13_enc.o" =>
[
"ssl/tls13_enc.c",
],
"ssl/tls_srp.o" =>
[
"ssl/tls_srp.c",
],
"test/aborttest" =>
[
"test/aborttest.o",
],
"test/aborttest.o" =>
[
"test/aborttest.c",
],
"test/afalgtest" =>
[
"test/afalgtest.o",
],
"test/afalgtest.o" =>
[
"test/afalgtest.c",
],
"test/asn1_decode_test" =>
[
"test/asn1_decode_test.o",
],
"test/asn1_decode_test.o" =>
[
"test/asn1_decode_test.c",
],
"test/asn1_encode_test" =>
[
"test/asn1_encode_test.o",
],
"test/asn1_encode_test.o" =>
[
"test/asn1_encode_test.c",
],
"test/asn1_internal_test" =>
[
"test/asn1_internal_test.o",
],
"test/asn1_internal_test.o" =>
[
"test/asn1_internal_test.c",
],
"test/asn1_string_table_test" =>
[
"test/asn1_string_table_test.o",
],
"test/asn1_string_table_test.o" =>
[
"test/asn1_string_table_test.c",
],
"test/asn1_time_test" =>
[
"test/asn1_time_test.o",
],
"test/asn1_time_test.o" =>
[
"test/asn1_time_test.c",
],
"test/asynciotest" =>
[
"test/asynciotest.o",
"test/ssltestlib.o",
],
"test/asynciotest.o" =>
[
"test/asynciotest.c",
],
"test/asynctest" =>
[
"test/asynctest.o",
],
"test/asynctest.o" =>
[
"test/asynctest.c",
],
"test/bad_dtls_test" =>
[
"test/bad_dtls_test.o",
],
"test/bad_dtls_test.o" =>
[
"test/bad_dtls_test.c",
],
"test/bftest" =>
[
"test/bftest.o",
],
"test/bftest.o" =>
[
"test/bftest.c",
],
"test/bio_callback_test" =>
[
"test/bio_callback_test.o",
],
"test/bio_callback_test.o" =>
[
"test/bio_callback_test.c",
],
"test/bio_enc_test" =>
[
"test/bio_enc_test.o",
],
"test/bio_enc_test.o" =>
[
"test/bio_enc_test.c",
],
"test/bio_memleak_test" =>
[
"test/bio_memleak_test.o",
],
"test/bio_memleak_test.o" =>
[
"test/bio_memleak_test.c",
],
"test/bioprinttest" =>
[
"test/bioprinttest.o",
],
"test/bioprinttest.o" =>
[
"test/bioprinttest.c",
],
"test/bntest" =>
[
"test/bntest.o",
],
"test/bntest.o" =>
[
"test/bntest.c",
],
"test/buildtest_aes.o" =>
[
"test/buildtest_aes.c",
],
"test/buildtest_asn1.o" =>
[
"test/buildtest_asn1.c",
],
"test/buildtest_asn1t.o" =>
[
"test/buildtest_asn1t.c",
],
"test/buildtest_async.o" =>
[
"test/buildtest_async.c",
],
"test/buildtest_bio.o" =>
[
"test/buildtest_bio.c",
],
"test/buildtest_blowfish.o" =>
[
"test/buildtest_blowfish.c",
],
"test/buildtest_bn.o" =>
[
"test/buildtest_bn.c",
],
"test/buildtest_buffer.o" =>
[
"test/buildtest_buffer.c",
],
"test/buildtest_c_aes" =>
[
"test/buildtest_aes.o",
],
"test/buildtest_c_asn1" =>
[
"test/buildtest_asn1.o",
],
"test/buildtest_c_asn1t" =>
[
"test/buildtest_asn1t.o",
],
"test/buildtest_c_async" =>
[
"test/buildtest_async.o",
],
"test/buildtest_c_bio" =>
[
"test/buildtest_bio.o",
],
"test/buildtest_c_blowfish" =>
[
"test/buildtest_blowfish.o",
],
"test/buildtest_c_bn" =>
[
"test/buildtest_bn.o",
],
"test/buildtest_c_buffer" =>
[
"test/buildtest_buffer.o",
],
"test/buildtest_c_camellia" =>
[
"test/buildtest_camellia.o",
],
"test/buildtest_c_cast" =>
[
"test/buildtest_cast.o",
],
"test/buildtest_c_cmac" =>
[
"test/buildtest_cmac.o",
],
"test/buildtest_c_cms" =>
[
"test/buildtest_cms.o",
],
"test/buildtest_c_conf" =>
[
"test/buildtest_conf.o",
],
"test/buildtest_c_conf_api" =>
[
"test/buildtest_conf_api.o",
],
"test/buildtest_c_crypto" =>
[
"test/buildtest_crypto.o",
],
"test/buildtest_c_ct" =>
[
"test/buildtest_ct.o",
],
"test/buildtest_c_des" =>
[
"test/buildtest_des.o",
],
"test/buildtest_c_dh" =>
[
"test/buildtest_dh.o",
],
"test/buildtest_c_dsa" =>
[
"test/buildtest_dsa.o",
],
"test/buildtest_c_dtls1" =>
[
"test/buildtest_dtls1.o",
],
"test/buildtest_c_e_os2" =>
[
"test/buildtest_e_os2.o",
],
"test/buildtest_c_ebcdic" =>
[
"test/buildtest_ebcdic.o",
],
"test/buildtest_c_ec" =>
[
"test/buildtest_ec.o",
],
"test/buildtest_c_ecdh" =>
[
"test/buildtest_ecdh.o",
],
"test/buildtest_c_ecdsa" =>
[
"test/buildtest_ecdsa.o",
],
"test/buildtest_c_engine" =>
[
"test/buildtest_engine.o",
],
"test/buildtest_c_evp" =>
[
"test/buildtest_evp.o",
],
"test/buildtest_c_hmac" =>
[
"test/buildtest_hmac.o",
],
"test/buildtest_c_idea" =>
[
"test/buildtest_idea.o",
],
"test/buildtest_c_kdf" =>
[
"test/buildtest_kdf.o",
],
"test/buildtest_c_lhash" =>
[
"test/buildtest_lhash.o",
],
"test/buildtest_c_md4" =>
[
"test/buildtest_md4.o",
],
"test/buildtest_c_md5" =>
[
"test/buildtest_md5.o",
],
"test/buildtest_c_mdc2" =>
[
"test/buildtest_mdc2.o",
],
"test/buildtest_c_modes" =>
[
"test/buildtest_modes.o",
],
"test/buildtest_c_obj_mac" =>
[
"test/buildtest_obj_mac.o",
],
"test/buildtest_c_objects" =>
[
"test/buildtest_objects.o",
],
"test/buildtest_c_ocsp" =>
[
"test/buildtest_ocsp.o",
],
"test/buildtest_c_opensslv" =>
[
"test/buildtest_opensslv.o",
],
"test/buildtest_c_ossl_typ" =>
[
"test/buildtest_ossl_typ.o",
],
"test/buildtest_c_pem" =>
[
"test/buildtest_pem.o",
],
"test/buildtest_c_pem2" =>
[
"test/buildtest_pem2.o",
],
"test/buildtest_c_pkcs12" =>
[
"test/buildtest_pkcs12.o",
],
"test/buildtest_c_pkcs7" =>
[
"test/buildtest_pkcs7.o",
],
"test/buildtest_c_rand" =>
[
"test/buildtest_rand.o",
],
"test/buildtest_c_rand_drbg" =>
[
"test/buildtest_rand_drbg.o",
],
"test/buildtest_c_rc2" =>
[
"test/buildtest_rc2.o",
],
"test/buildtest_c_rc4" =>
[
"test/buildtest_rc4.o",
],
"test/buildtest_c_ripemd" =>
[
"test/buildtest_ripemd.o",
],
"test/buildtest_c_rsa" =>
[
"test/buildtest_rsa.o",
],
"test/buildtest_c_safestack" =>
[
"test/buildtest_safestack.o",
],
"test/buildtest_c_seed" =>
[
"test/buildtest_seed.o",
],
"test/buildtest_c_sha" =>
[
"test/buildtest_sha.o",
],
"test/buildtest_c_srp" =>
[
"test/buildtest_srp.o",
],
"test/buildtest_c_srtp" =>
[
"test/buildtest_srtp.o",
],
"test/buildtest_c_ssl" =>
[
"test/buildtest_ssl.o",
],
"test/buildtest_c_ssl2" =>
[
"test/buildtest_ssl2.o",
],
"test/buildtest_c_stack" =>
[
"test/buildtest_stack.o",
],
"test/buildtest_c_store" =>
[
"test/buildtest_store.o",
],
"test/buildtest_c_symhacks" =>
[
"test/buildtest_symhacks.o",
],
"test/buildtest_c_tls1" =>
[
"test/buildtest_tls1.o",
],
"test/buildtest_c_ts" =>
[
"test/buildtest_ts.o",
],
"test/buildtest_c_txt_db" =>
[
"test/buildtest_txt_db.o",
],
"test/buildtest_c_ui" =>
[
"test/buildtest_ui.o",
],
"test/buildtest_c_whrlpool" =>
[
"test/buildtest_whrlpool.o",
],
"test/buildtest_c_x509" =>
[
"test/buildtest_x509.o",
],
"test/buildtest_c_x509_vfy" =>
[
"test/buildtest_x509_vfy.o",
],
"test/buildtest_c_x509v3" =>
[
"test/buildtest_x509v3.o",
],
"test/buildtest_camellia.o" =>
[
"test/buildtest_camellia.c",
],
"test/buildtest_cast.o" =>
[
"test/buildtest_cast.c",
],
"test/buildtest_cmac.o" =>
[
"test/buildtest_cmac.c",
],
"test/buildtest_cms.o" =>
[
"test/buildtest_cms.c",
],
"test/buildtest_conf.o" =>
[
"test/buildtest_conf.c",
],
"test/buildtest_conf_api.o" =>
[
"test/buildtest_conf_api.c",
],
"test/buildtest_crypto.o" =>
[
"test/buildtest_crypto.c",
],
"test/buildtest_ct.o" =>
[
"test/buildtest_ct.c",
],
"test/buildtest_des.o" =>
[
"test/buildtest_des.c",
],
"test/buildtest_dh.o" =>
[
"test/buildtest_dh.c",
],
"test/buildtest_dsa.o" =>
[
"test/buildtest_dsa.c",
],
"test/buildtest_dtls1.o" =>
[
"test/buildtest_dtls1.c",
],
"test/buildtest_e_os2.o" =>
[
"test/buildtest_e_os2.c",
],
"test/buildtest_ebcdic.o" =>
[
"test/buildtest_ebcdic.c",
],
"test/buildtest_ec.o" =>
[
"test/buildtest_ec.c",
],
"test/buildtest_ecdh.o" =>
[
"test/buildtest_ecdh.c",
],
"test/buildtest_ecdsa.o" =>
[
"test/buildtest_ecdsa.c",
],
"test/buildtest_engine.o" =>
[
"test/buildtest_engine.c",
],
"test/buildtest_evp.o" =>
[
"test/buildtest_evp.c",
],
"test/buildtest_hmac.o" =>
[
"test/buildtest_hmac.c",
],
"test/buildtest_idea.o" =>
[
"test/buildtest_idea.c",
],
"test/buildtest_kdf.o" =>
[
"test/buildtest_kdf.c",
],
"test/buildtest_lhash.o" =>
[
"test/buildtest_lhash.c",
],
"test/buildtest_md4.o" =>
[
"test/buildtest_md4.c",
],
"test/buildtest_md5.o" =>
[
"test/buildtest_md5.c",
],
"test/buildtest_mdc2.o" =>
[
"test/buildtest_mdc2.c",
],
"test/buildtest_modes.o" =>
[
"test/buildtest_modes.c",
],
"test/buildtest_obj_mac.o" =>
[
"test/buildtest_obj_mac.c",
],
"test/buildtest_objects.o" =>
[
"test/buildtest_objects.c",
],
"test/buildtest_ocsp.o" =>
[
"test/buildtest_ocsp.c",
],
"test/buildtest_opensslv.o" =>
[
"test/buildtest_opensslv.c",
],
"test/buildtest_ossl_typ.o" =>
[
"test/buildtest_ossl_typ.c",
],
"test/buildtest_pem.o" =>
[
"test/buildtest_pem.c",
],
"test/buildtest_pem2.o" =>
[
"test/buildtest_pem2.c",
],
"test/buildtest_pkcs12.o" =>
[
"test/buildtest_pkcs12.c",
],
"test/buildtest_pkcs7.o" =>
[
"test/buildtest_pkcs7.c",
],
"test/buildtest_rand.o" =>
[
"test/buildtest_rand.c",
],
"test/buildtest_rand_drbg.o" =>
[
"test/buildtest_rand_drbg.c",
],
"test/buildtest_rc2.o" =>
[
"test/buildtest_rc2.c",
],
"test/buildtest_rc4.o" =>
[
"test/buildtest_rc4.c",
],
"test/buildtest_ripemd.o" =>
[
"test/buildtest_ripemd.c",
],
"test/buildtest_rsa.o" =>
[
"test/buildtest_rsa.c",
],
"test/buildtest_safestack.o" =>
[
"test/buildtest_safestack.c",
],
"test/buildtest_seed.o" =>
[
"test/buildtest_seed.c",
],
"test/buildtest_sha.o" =>
[
"test/buildtest_sha.c",
],
"test/buildtest_srp.o" =>
[
"test/buildtest_srp.c",
],
"test/buildtest_srtp.o" =>
[
"test/buildtest_srtp.c",
],
"test/buildtest_ssl.o" =>
[
"test/buildtest_ssl.c",
],
"test/buildtest_ssl2.o" =>
[
"test/buildtest_ssl2.c",
],
"test/buildtest_stack.o" =>
[
"test/buildtest_stack.c",
],
"test/buildtest_store.o" =>
[
"test/buildtest_store.c",
],
"test/buildtest_symhacks.o" =>
[
"test/buildtest_symhacks.c",
],
"test/buildtest_tls1.o" =>
[
"test/buildtest_tls1.c",
],
"test/buildtest_ts.o" =>
[
"test/buildtest_ts.c",
],
"test/buildtest_txt_db.o" =>
[
"test/buildtest_txt_db.c",
],
"test/buildtest_ui.o" =>
[
"test/buildtest_ui.c",
],
"test/buildtest_whrlpool.o" =>
[
"test/buildtest_whrlpool.c",
],
"test/buildtest_x509.o" =>
[
"test/buildtest_x509.c",
],
"test/buildtest_x509_vfy.o" =>
[
"test/buildtest_x509_vfy.c",
],
"test/buildtest_x509v3.o" =>
[
"test/buildtest_x509v3.c",
],
"test/casttest" =>
[
"test/casttest.o",
],
"test/casttest.o" =>
[
"test/casttest.c",
],
"test/chacha_internal_test" =>
[
"test/chacha_internal_test.o",
],
"test/chacha_internal_test.o" =>
[
"test/chacha_internal_test.c",
],
"test/cipher_overhead_test" =>
[
"test/cipher_overhead_test.o",
],
"test/cipher_overhead_test.o" =>
[
"test/cipher_overhead_test.c",
],
"test/cipherbytes_test" =>
[
"test/cipherbytes_test.o",
],
"test/cipherbytes_test.o" =>
[
"test/cipherbytes_test.c",
],
"test/cipherlist_test" =>
[
"test/cipherlist_test.o",
],
"test/cipherlist_test.o" =>
[
"test/cipherlist_test.c",
],
"test/ciphername_test" =>
[
"test/ciphername_test.o",
],
"test/ciphername_test.o" =>
[
"test/ciphername_test.c",
],
"test/clienthellotest" =>
[
"test/clienthellotest.o",
],
"test/clienthellotest.o" =>
[
"test/clienthellotest.c",
],
"test/cmactest" =>
[
"test/cmactest.o",
],
"test/cmactest.o" =>
[
"test/cmactest.c",
],
"test/cmsapitest" =>
[
"test/cmsapitest.o",
],
"test/cmsapitest.o" =>
[
"test/cmsapitest.c",
],
"test/conf_include_test" =>
[
"test/conf_include_test.o",
],
"test/conf_include_test.o" =>
[
"test/conf_include_test.c",
],
"test/constant_time_test" =>
[
"test/constant_time_test.o",
],
"test/constant_time_test.o" =>
[
"test/constant_time_test.c",
],
"test/crltest" =>
[
"test/crltest.o",
],
"test/crltest.o" =>
[
"test/crltest.c",
],
"test/ct_test" =>
[
"test/ct_test.o",
],
"test/ct_test.o" =>
[
"test/ct_test.c",
],
"test/ctype_internal_test" =>
[
"test/ctype_internal_test.o",
],
"test/ctype_internal_test.o" =>
[
"test/ctype_internal_test.c",
],
"test/curve448_internal_test" =>
[
"test/curve448_internal_test.o",
],
"test/curve448_internal_test.o" =>
[
"test/curve448_internal_test.c",
],
"test/d2i_test" =>
[
"test/d2i_test.o",
],
"test/d2i_test.o" =>
[
"test/d2i_test.c",
],
"test/danetest" =>
[
"test/danetest.o",
],
"test/danetest.o" =>
[
"test/danetest.c",
],
"test/destest" =>
[
"test/destest.o",
],
"test/destest.o" =>
[
"test/destest.c",
],
"test/dhtest" =>
[
"test/dhtest.o",
],
"test/dhtest.o" =>
[
"test/dhtest.c",
],
"test/drbg_cavs_data.o" =>
[
"test/drbg_cavs_data.c",
],
"test/drbg_cavs_test" =>
[
"test/drbg_cavs_data.o",
"test/drbg_cavs_test.o",
],
"test/drbg_cavs_test.o" =>
[
"test/drbg_cavs_test.c",
],
"test/drbgtest" =>
[
"test/drbgtest.o",
],
"test/drbgtest.o" =>
[
"test/drbgtest.c",
],
"test/dsa_no_digest_size_test" =>
[
"test/dsa_no_digest_size_test.o",
],
"test/dsa_no_digest_size_test.o" =>
[
"test/dsa_no_digest_size_test.c",
],
"test/dsatest" =>
[
"test/dsatest.o",
],
"test/dsatest.o" =>
[
"test/dsatest.c",
],
"test/dtls_mtu_test" =>
[
"test/dtls_mtu_test.o",
"test/ssltestlib.o",
],
"test/dtls_mtu_test.o" =>
[
"test/dtls_mtu_test.c",
],
"test/dtlstest" =>
[
"test/dtlstest.o",
"test/ssltestlib.o",
],
"test/dtlstest.o" =>
[
"test/dtlstest.c",
],
"test/dtlsv1listentest" =>
[
"test/dtlsv1listentest.o",
],
"test/dtlsv1listentest.o" =>
[
"test/dtlsv1listentest.c",
],
"test/ec_internal_test" =>
[
"test/ec_internal_test.o",
],
"test/ec_internal_test.o" =>
[
"test/ec_internal_test.c",
],
"test/ecdsatest" =>
[
"test/ecdsatest.o",
],
"test/ecdsatest.o" =>
[
"test/ecdsatest.c",
],
"test/ecstresstest" =>
[
"test/ecstresstest.o",
],
"test/ecstresstest.o" =>
[
"test/ecstresstest.c",
],
"test/ectest" =>
[
"test/ectest.o",
],
"test/ectest.o" =>
[
"test/ectest.c",
],
"test/enginetest" =>
[
"test/enginetest.o",
],
"test/enginetest.o" =>
[
"test/enginetest.c",
],
"test/errtest" =>
[
"test/errtest.o",
],
"test/errtest.o" =>
[
"test/errtest.c",
],
"test/evp_extra_test" =>
[
"test/evp_extra_test.o",
],
"test/evp_extra_test.o" =>
[
"test/evp_extra_test.c",
],
"test/evp_test" =>
[
"test/evp_test.o",
],
"test/evp_test.o" =>
[
"test/evp_test.c",
],
"test/exdatatest" =>
[
"test/exdatatest.o",
],
"test/exdatatest.o" =>
[
"test/exdatatest.c",
],
"test/exptest" =>
[
"test/exptest.o",
],
"test/exptest.o" =>
[
"test/exptest.c",
],
"test/fatalerrtest" =>
[
"test/fatalerrtest.o",
"test/ssltestlib.o",
],
"test/fatalerrtest.o" =>
[
"test/fatalerrtest.c",
],
"test/gmdifftest" =>
[
"test/gmdifftest.o",
],
"test/gmdifftest.o" =>
[
"test/gmdifftest.c",
],
"test/gosttest" =>
[
"test/gosttest.o",
"test/ssltestlib.o",
],
"test/gosttest.o" =>
[
"test/gosttest.c",
],
"test/handshake_helper.o" =>
[
"test/handshake_helper.c",
],
"test/hmactest" =>
[
"test/hmactest.o",
],
"test/hmactest.o" =>
[
"test/hmactest.c",
],
"test/ideatest" =>
[
"test/ideatest.o",
],
"test/ideatest.o" =>
[
"test/ideatest.c",
],
"test/igetest" =>
[
"test/igetest.o",
],
"test/igetest.o" =>
[
"test/igetest.c",
],
"test/lhash_test" =>
[
"test/lhash_test.o",
],
"test/lhash_test.o" =>
[
"test/lhash_test.c",
],
"test/libtestutil.a" =>
[
"test/testutil/basic_output.o",
"test/testutil/cb.o",
"test/testutil/driver.o",
"test/testutil/format_output.o",
"test/testutil/main.o",
"test/testutil/output_helpers.o",
"test/testutil/random.o",
"test/testutil/stanza.o",
"test/testutil/tap_bio.o",
"test/testutil/test_cleanup.o",
"test/testutil/tests.o",
"test/testutil/testutil_init.o",
],
"test/md2test" =>
[
"test/md2test.o",
],
"test/md2test.o" =>
[
"test/md2test.c",
],
"test/mdc2_internal_test" =>
[
"test/mdc2_internal_test.o",
],
"test/mdc2_internal_test.o" =>
[
"test/mdc2_internal_test.c",
],
"test/mdc2test" =>
[
"test/mdc2test.o",
],
"test/mdc2test.o" =>
[
"test/mdc2test.c",
],
"test/memleaktest" =>
[
"test/memleaktest.o",
],
"test/memleaktest.o" =>
[
"test/memleaktest.c",
],
"test/modes_internal_test" =>
[
"test/modes_internal_test.o",
],
"test/modes_internal_test.o" =>
[
"test/modes_internal_test.c",
],
"test/ocspapitest" =>
[
"test/ocspapitest.o",
],
"test/ocspapitest.o" =>
[
"test/ocspapitest.c",
],
"test/packettest" =>
[
"test/packettest.o",
],
"test/packettest.o" =>
[
"test/packettest.c",
],
"test/pbelutest" =>
[
"test/pbelutest.o",
],
"test/pbelutest.o" =>
[
"test/pbelutest.c",
],
"test/pemtest" =>
[
"test/pemtest.o",
],
"test/pemtest.o" =>
[
"test/pemtest.c",
],
"test/pkey_meth_kdf_test" =>
[
"test/pkey_meth_kdf_test.o",
],
"test/pkey_meth_kdf_test.o" =>
[
"test/pkey_meth_kdf_test.c",
],
"test/pkey_meth_test" =>
[
"test/pkey_meth_test.o",
],
"test/pkey_meth_test.o" =>
[
"test/pkey_meth_test.c",
],
"test/poly1305_internal_test" =>
[
"test/poly1305_internal_test.o",
],
"test/poly1305_internal_test.o" =>
[
"test/poly1305_internal_test.c",
],
"test/rc2test" =>
[
"test/rc2test.o",
],
"test/rc2test.o" =>
[
"test/rc2test.c",
],
"test/rc4test" =>
[
"test/rc4test.o",
],
"test/rc4test.o" =>
[
"test/rc4test.c",
],
"test/rc5test" =>
[
"test/rc5test.o",
],
"test/rc5test.o" =>
[
"test/rc5test.c",
],
"test/rdrand_sanitytest" =>
[
"test/rdrand_sanitytest.o",
],
"test/rdrand_sanitytest.o" =>
[
"test/rdrand_sanitytest.c",
],
"test/recordlentest" =>
[
"test/recordlentest.o",
"test/ssltestlib.o",
],
"test/recordlentest.o" =>
[
"test/recordlentest.c",
],
"test/rsa_complex" =>
[
"test/rsa_complex.o",
],
"test/rsa_complex.o" =>
[
"test/rsa_complex.c",
],
"test/rsa_mp_test" =>
[
"test/rsa_mp_test.o",
],
"test/rsa_mp_test.o" =>
[
"test/rsa_mp_test.c",
],
"test/rsa_test" =>
[
"test/rsa_test.o",
],
"test/rsa_test.o" =>
[
"test/rsa_test.c",
],
"test/sanitytest" =>
[
"test/sanitytest.o",
],
"test/sanitytest.o" =>
[
"test/sanitytest.c",
],
"test/secmemtest" =>
[
"test/secmemtest.o",
],
"test/secmemtest.o" =>
[
"test/secmemtest.c",
],
"test/servername_test" =>
[
"test/servername_test.o",
"test/ssltestlib.o",
],
"test/servername_test.o" =>
[
"test/servername_test.c",
],
"test/siphash_internal_test" =>
[
"test/siphash_internal_test.o",
],
"test/siphash_internal_test.o" =>
[
"test/siphash_internal_test.c",
],
"test/sm2_internal_test" =>
[
"test/sm2_internal_test.o",
],
"test/sm2_internal_test.o" =>
[
"test/sm2_internal_test.c",
],
"test/sm4_internal_test" =>
[
"test/sm4_internal_test.o",
],
"test/sm4_internal_test.o" =>
[
"test/sm4_internal_test.c",
],
"test/srptest" =>
[
"test/srptest.o",
],
"test/srptest.o" =>
[
"test/srptest.c",
],
"test/ssl_cert_table_internal_test" =>
[
"test/ssl_cert_table_internal_test.o",
],
"test/ssl_cert_table_internal_test.o" =>
[
"test/ssl_cert_table_internal_test.c",
],
"test/ssl_ctx_test" =>
[
"test/ssl_ctx_test.o",
],
"test/ssl_ctx_test.o" =>
[
"test/ssl_ctx_test.c",
],
"test/ssl_test" =>
[
"test/handshake_helper.o",
"test/ssl_test.o",
"test/ssl_test_ctx.o",
],
"test/ssl_test.o" =>
[
"test/ssl_test.c",
],
"test/ssl_test_ctx.o" =>
[
"test/ssl_test_ctx.c",
],
"test/ssl_test_ctx_test" =>
[
"test/ssl_test_ctx.o",
"test/ssl_test_ctx_test.o",
],
"test/ssl_test_ctx_test.o" =>
[
"test/ssl_test_ctx_test.c",
],
"test/sslapitest" =>
[
"test/sslapitest.o",
"test/ssltestlib.o",
],
"test/sslapitest.o" =>
[
"test/sslapitest.c",
],
"test/sslbuffertest" =>
[
"test/sslbuffertest.o",
"test/ssltestlib.o",
],
"test/sslbuffertest.o" =>
[
"test/sslbuffertest.c",
],
"test/sslcorrupttest" =>
[
"test/sslcorrupttest.o",
"test/ssltestlib.o",
],
"test/sslcorrupttest.o" =>
[
"test/sslcorrupttest.c",
],
"test/ssltest_old" =>
[
"test/ssltest_old.o",
],
"test/ssltest_old.o" =>
[
"test/ssltest_old.c",
],
"test/ssltestlib.o" =>
[
"test/ssltestlib.c",
],
"test/stack_test" =>
[
"test/stack_test.o",
],
"test/stack_test.o" =>
[
"test/stack_test.c",
],
"test/sysdefaulttest" =>
[
"test/sysdefaulttest.o",
],
"test/sysdefaulttest.o" =>
[
"test/sysdefaulttest.c",
],
"test/test_test" =>
[
"test/test_test.o",
],
"test/test_test.o" =>
[
"test/test_test.c",
],
"test/testutil/basic_output.o" =>
[
"test/testutil/basic_output.c",
],
"test/testutil/cb.o" =>
[
"test/testutil/cb.c",
],
"test/testutil/driver.o" =>
[
"test/testutil/driver.c",
],
"test/testutil/format_output.o" =>
[
"test/testutil/format_output.c",
],
"test/testutil/main.o" =>
[
"test/testutil/main.c",
],
"test/testutil/output_helpers.o" =>
[
"test/testutil/output_helpers.c",
],
"test/testutil/random.o" =>
[
"test/testutil/random.c",
],
"test/testutil/stanza.o" =>
[
"test/testutil/stanza.c",
],
"test/testutil/tap_bio.o" =>
[
"test/testutil/tap_bio.c",
],
"test/testutil/test_cleanup.o" =>
[
"test/testutil/test_cleanup.c",
],
"test/testutil/tests.o" =>
[
"test/testutil/tests.c",
],
"test/testutil/testutil_init.o" =>
[
"test/testutil/testutil_init.c",
],
"test/threadstest" =>
[
"test/threadstest.o",
],
"test/threadstest.o" =>
[
"test/threadstest.c",
],
"test/time_offset_test" =>
[
"test/time_offset_test.o",
],
"test/time_offset_test.o" =>
[
"test/time_offset_test.c",
],
"test/tls13ccstest" =>
[
"test/ssltestlib.o",
"test/tls13ccstest.o",
],
"test/tls13ccstest.o" =>
[
"test/tls13ccstest.c",
],
"test/tls13encryptiontest" =>
[
"test/tls13encryptiontest.o",
],
"test/tls13encryptiontest.o" =>
[
"test/tls13encryptiontest.c",
],
"test/uitest" =>
[
"test/uitest.o",
],
"test/uitest.o" =>
[
"test/uitest.c",
],
"test/v3ext" =>
[
"test/v3ext.o",
],
"test/v3ext.o" =>
[
"test/v3ext.c",
],
"test/v3nametest" =>
[
"test/v3nametest.o",
],
"test/v3nametest.o" =>
[
"test/v3nametest.c",
],
"test/verify_extra_test" =>
[
"test/verify_extra_test.o",
],
"test/verify_extra_test.o" =>
[
"test/verify_extra_test.c",
],
"test/versions" =>
[
"test/versions.o",
],
"test/versions.o" =>
[
"test/versions.c",
],
"test/wpackettest" =>
[
"test/wpackettest.o",
],
"test/wpackettest.o" =>
[
"test/wpackettest.c",
],
"test/x509_check_cert_pkey_test" =>
[
"test/x509_check_cert_pkey_test.o",
],
"test/x509_check_cert_pkey_test.o" =>
[
"test/x509_check_cert_pkey_test.c",
],
"test/x509_dup_cert_test" =>
[
"test/x509_dup_cert_test.o",
],
"test/x509_dup_cert_test.o" =>
[
"test/x509_dup_cert_test.c",
],
"test/x509_internal_test" =>
[
"test/x509_internal_test.o",
],
"test/x509_internal_test.o" =>
[
"test/x509_internal_test.c",
],
"test/x509_time_test" =>
[
"test/x509_time_test.o",
],
"test/x509_time_test.o" =>
[
"test/x509_time_test.c",
],
"test/x509aux" =>
[
"test/x509aux.o",
],
"test/x509aux.o" =>
[
"test/x509aux.c",
],
"tools/c_rehash" =>
[
"tools/c_rehash.in",
],
"util/shlib_wrap.sh" =>
[
"util/shlib_wrap.sh.in",
],
},
);
# The following data is only used when this files is use as a script
my @makevars = (
'AR',
'ARFLAGS',
'AS',
'ASFLAGS',
'CC',
'CFLAGS',
'CPP',
'CPPDEFINES',
'CPPFLAGS',
'CPPINCLUDES',
'CROSS_COMPILE',
'CXX',
'CXXFLAGS',
'HASHBANGPERL',
'LD',
'LDFLAGS',
'LDLIBS',
'MT',
'MTFLAGS',
'PERL',
'RANLIB',
'RC',
'RCFLAGS',
'RM',
);
my %disabled_info = (
'afalgeng' => {
macro => 'OPENSSL_NO_AFALGENG',
},
'asan' => {
macro => 'OPENSSL_NO_ASAN',
},
'asm' => {
macro => 'OPENSSL_NO_ASM',
},
'comp' => {
macro => 'OPENSSL_NO_COMP',
skipped => [ 'crypto/comp' ],
},
'crypto-mdebug' => {
macro => 'OPENSSL_NO_CRYPTO_MDEBUG',
},
'crypto-mdebug-backtrace' => {
macro => 'OPENSSL_NO_CRYPTO_MDEBUG_BACKTRACE',
},
'devcryptoeng' => {
macro => 'OPENSSL_NO_DEVCRYPTOENG',
},
'ec_nistp_64_gcc_128' => {
macro => 'OPENSSL_NO_EC_NISTP_64_GCC_128',
},
'egd' => {
macro => 'OPENSSL_NO_EGD',
},
'external-tests' => {
macro => 'OPENSSL_NO_EXTERNAL_TESTS',
},
'fuzz-afl' => {
macro => 'OPENSSL_NO_FUZZ_AFL',
},
'fuzz-libfuzzer' => {
macro => 'OPENSSL_NO_FUZZ_LIBFUZZER',
},
'heartbeats' => {
macro => 'OPENSSL_NO_HEARTBEATS',
},
'md2' => {
macro => 'OPENSSL_NO_MD2',
skipped => [ 'crypto/md2' ],
},
'msan' => {
macro => 'OPENSSL_NO_MSAN',
},
'rc5' => {
macro => 'OPENSSL_NO_RC5',
skipped => [ 'crypto/rc5' ],
},
'sctp' => {
macro => 'OPENSSL_NO_SCTP',
},
'ssl3' => {
macro => 'OPENSSL_NO_SSL3',
},
'ssl3-method' => {
macro => 'OPENSSL_NO_SSL3_METHOD',
},
'ubsan' => {
macro => 'OPENSSL_NO_UBSAN',
},
'unit-test' => {
macro => 'OPENSSL_NO_UNIT_TEST',
},
'weak-ssl-ciphers' => {
macro => 'OPENSSL_NO_WEAK_SSL_CIPHERS',
},
);
my @user_crossable = qw( AR AS CC CXX CPP LD MT RANLIB RC );
# If run directly, we can give some answers, and even reconfigure
unless (caller) {
use Getopt::Long;
use File::Spec::Functions;
use File::Basename;
use Pod::Usage;
my $here = dirname($0);
my $dump = undef;
my $cmdline = undef;
my $options = undef;
my $target = undef;
my $envvars = undef;
my $makevars = undef;
my $buildparams = undef;
my $reconf = undef;
my $verbose = undef;
my $help = undef;
my $man = undef;
GetOptions('dump|d' => \$dump,
'command-line|c' => \$cmdline,
'options|o' => \$options,
'target|t' => \$target,
'environment|e' => \$envvars,
'make-variables|m' => \$makevars,
'build-parameters|b' => \$buildparams,
'reconfigure|reconf|r' => \$reconf,
'verbose|v' => \$verbose,
'help' => \$help,
'man' => \$man)
or die "Errors in command line arguments\n";
unless ($dump || $cmdline || $options || $target || $envvars || $makevars
|| $buildparams || $reconf || $verbose || $help || $man) {
print STDERR <<"_____";
You must give at least one option.
For more information, do '$0 --help'
_____
exit(2);
}
if ($help) {
pod2usage(-exitval => 0,
-verbose => 1);
}
if ($man) {
pod2usage(-exitval => 0,
-verbose => 2);
}
if ($dump || $cmdline) {
print "\nCommand line (with current working directory = $here):\n\n";
print ' ',join(' ',
$config{PERL},
catfile($config{sourcedir}, 'Configure'),
@{$config{perlargv}}), "\n";
print "\nPerl information:\n\n";
print ' ',$config{perl_cmd},"\n";
print ' ',$config{perl_version},' for ',$config{perl_archname},"\n";
}
if ($dump || $options) {
my $longest = 0;
my $longest2 = 0;
foreach my $what (@disablables) {
$longest = length($what) if $longest < length($what);
$longest2 = length($disabled{$what})
if $disabled{$what} && $longest2 < length($disabled{$what});
}
print "\nEnabled features:\n\n";
foreach my $what (@disablables) {
print " $what\n"
unless grep { $_ =~ /^${what}$/ } keys %disabled;
}
print "\nDisabled features:\n\n";
foreach my $what (@disablables) {
my @what2 = grep { $_ =~ /^${what}$/ } keys %disabled;
my $what3 = $what2[0];
if ($what3) {
print " $what3", ' ' x ($longest - length($what3) + 1),
"[$disabled{$what3}]", ' ' x ($longest2 - length($disabled{$what3}) + 1);
print $disabled_info{$what3}->{macro}
if $disabled_info{$what3}->{macro};
print ' (skip ',
join(', ', @{$disabled_info{$what3}->{skipped}}),
')'
if $disabled_info{$what3}->{skipped};
print "\n";
}
}
}
if ($dump || $target) {
print "\nConfig target attributes:\n\n";
foreach (sort keys %target) {
next if $_ =~ m|^_| || $_ eq 'template';
my $quotify = sub {
map { (my $x = $_) =~ s|([\\\$\@"])|\\$1|g; "\"$x\""} @_;
};
print ' ', $_, ' => ';
if (ref($target{$_}) eq "ARRAY") {
print '[ ', join(', ', $quotify->(@{$target{$_}})), " ],\n";
} else {
print $quotify->($target{$_}), ",\n"
}
}
}
if ($dump || $envvars) {
print "\nRecorded environment:\n\n";
foreach (sort keys %{$config{perlenv}}) {
print ' ',$_,' = ',($config{perlenv}->{$_} || ''),"\n";
}
}
if ($dump || $makevars) {
print "\nMakevars:\n\n";
foreach my $var (@makevars) {
my $prefix = '';
$prefix = $config{CROSS_COMPILE}
if grep { $var eq $_ } @user_crossable;
$prefix //= '';
print ' ',$var,' ' x (16 - length $var),'= ',
(ref $config{$var} eq 'ARRAY'
? join(' ', @{$config{$var}})
: $prefix.$config{$var}),
"\n"
if defined $config{$var};
}
my @buildfile = ($config{builddir}, $config{build_file});
unshift @buildfile, $here
unless file_name_is_absolute($config{builddir});
my $buildfile = canonpath(catdir(@buildfile));
print <<"_____";
NOTE: These variables only represent the configuration view. The build file
template may have processed these variables further, please have a look at the
build file for more exact data:
$buildfile
_____
}
if ($dump || $buildparams) {
my @buildfile = ($config{builddir}, $config{build_file});
unshift @buildfile, $here
unless file_name_is_absolute($config{builddir});
print "\nbuild file:\n\n";
print " ", canonpath(catfile(@buildfile)),"\n";
print "\nbuild file templates:\n\n";
foreach (@{$config{build_file_templates}}) {
my @tmpl = ($_);
unshift @tmpl, $here
unless file_name_is_absolute($config{sourcedir});
print ' ',canonpath(catfile(@tmpl)),"\n";
}
}
if ($reconf) {
if ($verbose) {
print 'Reconfiguring with: ', join(' ',@{$config{perlargv}}), "\n";
foreach (sort keys %{$config{perlenv}}) {
print ' ',$_,' = ',($config{perlenv}->{$_} || ""),"\n";
}
}
chdir $here;
exec $^X,catfile($config{sourcedir}, 'Configure'),'reconf';
}
}
1;
__END__
=head1 NAME
configdata.pm - configuration data for OpenSSL builds
=head1 SYNOPSIS
Interactive:
perl configdata.pm [options]
As data bank module:
use configdata;
=head1 DESCRIPTION
This module can be used in two modes, interactively and as a module containing
all the data recorded by OpenSSL's Configure script.
When used interactively, simply run it as any perl script, with at least one
option, and you will get the information you ask for. See L</OPTIONS> below.
When loaded as a module, you get a few databanks with useful information to
perform build related tasks. The databanks are:
%config Configured things.
%target The OpenSSL config target with all inheritances
resolved.
%disabled The features that are disabled.
@disablables The list of features that can be disabled.
%withargs All data given through --with-THING options.
%unified_info All information that was computed from the build.info
files.
=head1 OPTIONS
=over 4
=item B<--help>
Print a brief help message and exit.
=item B<--man>
Print the manual page and exit.
=item B<--dump> | B<-d>
Print all relevant configuration data. This is equivalent to B<--command-line>
B<--options> B<--target> B<--environment> B<--make-variables>
B<--build-parameters>.
=item B<--command-line> | B<-c>
Print the current configuration command line.
=item B<--options> | B<-o>
Print the features, both enabled and disabled, and display defined macro and
skipped directories where applicable.
=item B<--target> | B<-t>
Print the config attributes for this config target.
=item B<--environment> | B<-e>
Print the environment variables and their values at the time of configuration.
=item B<--make-variables> | B<-m>
Print the main make variables generated in the current configuration
=item B<--build-parameters> | B<-b>
Print the build parameters, i.e. build file and build file templates.
=item B<--reconfigure> | B<--reconf> | B<-r>
Redo the configuration.
=item B<--verbose> | B<-v>
Verbose output.
=back
=cut
| 30.841207 | 1,736 | 0.28219 |
73f0ef4b3c1db3382a87b870dd3dec309c2bd15b | 1,327 | pm | Perl | lib/JSON/Schema/Validator/State.pm | AnotherOneAckap/p5-json-schema-validator | bad223641c23e2786f9061e56eb912da7767bed8 | [
"MIT"
]
| null | null | null | lib/JSON/Schema/Validator/State.pm | AnotherOneAckap/p5-json-schema-validator | bad223641c23e2786f9061e56eb912da7767bed8 | [
"MIT"
]
| null | null | null | lib/JSON/Schema/Validator/State.pm | AnotherOneAckap/p5-json-schema-validator | bad223641c23e2786f9061e56eb912da7767bed8 | [
"MIT"
]
| null | null | null | package JSON::Schema::Validator::State;
use strict;
use warnings;
use overload
'==' => \&num_comparision,
'""' => \&to_string,
bool => \&to_string;
sub new {
my ( $proto, %args ) = @_;
my $state = {};
$state->{path} = '$';
$state->{schema_root} = $args{schema_root};
$state->{errors} = {};
$state->{schemas_by_url} = {};
$state->{schemas_by_id} = {};
bless $state, $proto;
$state->id_lookup;
return $state;
}
sub to_string { not keys %{$_[0]->{errors}} }
sub num_comparision { shift->to_string == shift }
sub add_path {
my ( $state, $path ) = @_;
$state->{path} .= ".$path";
}
sub add_error {
my ( $state, $path, $msg ) = @_;
$state->{errors}->{$path} ||= [];
push @{ $state->{errors}->{$path} }, $msg;
}
sub id_lookup {
my ( $state, $schema, $seen ) = @_;
$schema ||= $state->{schema_root};
$seen ||= {};
return unless ref $schema eq 'HASH' || ref $schema eq 'ARRAY';
return if exists $seen->{$schema};
$seen->{$schema} = 1;
if ( ref $schema eq 'HASH' ) {
if ( exists $schema->{'$id'} ) {
$state->{schemas_by_id}{ $schema->{'$id'} } = $schema;
}
while ( my ( $k, $subschema ) = each %$schema ) {
$state->id_lookup( $subschema, $seen );
}
}
elsif ( ref $schema eq 'ARRAY' ) {
for ( @$schema ) {
$state->id_lookup( $_, $seen );
}
}
}
1;
| 18.690141 | 63 | 0.541824 |
ed21879ace8d9efd0086bacefb06e340105bcff3 | 211,319 | pl | Perl | prolog/examples/biopaxLevel3.pl | rzese/trill | 145781966a4203e43c3cfe18e62435557e764297 | [
"Artistic-2.0"
]
| 6 | 2016-02-02T07:36:34.000Z | 2021-03-17T01:23:49.000Z | prolog/examples/biopaxLevel3.pl | rzese/trill | 145781966a4203e43c3cfe18e62435557e764297 | [
"Artistic-2.0"
]
| 1 | 2019-10-19T12:53:55.000Z | 2019-10-29T15:14:51.000Z | prolog/examples/biopaxLevel3.pl | rzese/trill | 145781966a4203e43c3cfe18e62435557e764297 | [
"Artistic-2.0"
]
| 3 | 2016-04-05T10:34:18.000Z | 2019-10-30T10:46:54.000Z | :-use_module(library(trill)).
:- trill. % or :- trillp. or :- tornado.
/*
Model of metabolic pathways.
http://www.biopax.org/
*/
/** <examples>
?- prob_sub_class('TransportWithBiochemicalReaction','Entity',Prob).
?- sub_class('TransportWithBiochemicalReaction','Entity',ListExpl).
*/
owl_rdf('<?xml version="1.0"?>
<!DOCTYPE rdf:RDF [
<!ENTITY owl "http://www.w3.org/2002/07/owl#" >
<!ENTITY swrl "http://www.w3.org/2003/11/swrl#" >
<!ENTITY swrlb "http://www.w3.org/2003/11/swrlb#" >
<!ENTITY xsd "http://www.w3.org/2001/XMLSchema#" >
<!ENTITY rdfs "http://www.w3.org/2000/01/rdf-schema#" >
<!ENTITY rdf "http://www.w3.org/1999/02/22-rdf-syntax-ns#" >
<!ENTITY protege "http://protege.stanford.edu/plugins/owl/protege#" >
<!ENTITY disponte "https://sites.google.com/a/unife.it/ml/disponte#" >
<!ENTITY xsp "http://www.owl-ontologies.com/2005/08/07/xsp.owl#" >
]>
<rdf:RDF xmlns="http://www.biopax.org/release/biopax-level3.owl#"
xml:base="http://www.biopax.org/release/biopax-level3.owl"
xmlns:biopax="http://www.biopax.org/release/biopax-level3.owl#"
xmlns:rdfs="http://www.w3.org/2000/01/rdf-schema#"
xmlns:swrl="http://www.w3.org/2003/11/swrl#"
xmlns:protege="http://protege.stanford.edu/plugins/owl/protege#"
xmlns:xsp="http://www.owl-ontologies.com/2005/08/07/xsp.owl#"
xmlns:owl="http://www.w3.org/2002/07/owl#"
xmlns:xsd="http://www.w3.org/2001/XMLSchema#"
xmlns:swrlb="http://www.w3.org/2003/11/swrlb#"
xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#"
xmlns:disponte="https://sites.google.com/a/unife.it/ml/disponte#">
<owl:Ontology rdf:about="http://www.biopax.org/release/biopax-level3.owl">
<rdfs:comment rdf:datatype="&xsd;string">This is version 1.0 of the BioPAX Level 3 ontology. The goal of the BioPAX group is to develop a common exchange format for biological pathway data. More information is available at http://www.biopax.org. This ontology is freely available under the LGPL (http://www.gnu.org/copyleft/lesser.html).</rdfs:comment>
</owl:Ontology>
<!--
///////////////////////////////////////////////////////////////////////////////////////
//
// Annotation properties
//
///////////////////////////////////////////////////////////////////////////////////////
-->
<!-- https://sites.google.com/a/unife.it/ml/disponte#probability -->
<owl:AnnotationProperty rdf:about="&disponte;probability"/>
<!--
///////////////////////////////////////////////////////////////////////////////////////
//
// Object Properties
//
///////////////////////////////////////////////////////////////////////////////////////
-->
<!-- http://www.biopax.org/release/biopax-level3.owl#absoluteRegion -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#absoluteRegion">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Absolute location as defined by the referenced sequence database record. E.g. an operon has a absolute region on the DNA molecule referenced by the UnificationXref.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#bindsTo -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#bindsTo">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdf:type rdf:resource="&owl;InverseFunctionalProperty"/>
<rdf:type rdf:resource="&owl;SymmetricProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">A binding feature represents a "half" of the bond between two entities. This property points to another binding feature which represents the other half. The bond can be covalent or non-covalent.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BindingFeature"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BindingFeature"/>
<owl:inverseOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#bindsTo"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#cellType -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#cellType">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">A cell type, e.g. 'HeLa'. This should reference a term in a controlled vocabulary of cell types. Best practice is to refer to OBO Cell Ontology. http://www.obofoundry.org/cgi-bin/detail.cgi?id=cell</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BioSource"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#CellVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#cellularLocation -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#cellularLocation">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">A cellular location, e.g. 'cytoplasm'. This should reference a term in the Gene Ontology Cellular Component ontology. The location referred to by this property should be as specific as is known. If an interaction is known to occur in multiple locations, separate interactions (and physicalEntities) must be created for each different location. If the location of a participant in a complex is unspecified, it may be assumed to be the same location as that of the complex.
A molecule in two different cellular locations are considered two different physical entities.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#CellularLocationVocabulary"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#cofactor -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#cofactor">
<rdfs:comment xml:lang="en">Any cofactor(s) or coenzyme(s) required for catalysis of the conversion by the enzyme. COFACTOR is a sub-property of PARTICIPANTS.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Catalysis"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#component -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#component">
<rdf:type rdf:resource="&owl;InverseFunctionalProperty"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Complex"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#componentStoichiometry -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#componentStoichiometry">
<rdfs:comment rdf:datatype="&xsd;string">The stoichiometry of components in a complex</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Complex"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#confidence -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#confidence">
<rdfs:comment rdf:datatype="&xsd;string">Confidence in the containing instance. Usually a statistical measure.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#controlled -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#controlled">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">The entity that is controlled, e.g., in a biochemical reaction, the reaction is controlled by an enzyme. CONTROLLED is a sub-property of PARTICIPANTS.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Control"/>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<rdfs:range>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
</owl:unionOf>
</owl:Class>
</rdfs:range>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#controller -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#controller">
<rdfs:comment xml:lang="en">The controlling entity, e.g., in a biochemical reaction, an enzyme is the controlling entity of the reaction. CONTROLLER is a sub-property of PARTICIPANTS.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Control"/>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<rdfs:range>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:unionOf>
</owl:Class>
</rdfs:range>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#dataSource -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#dataSource">
<rdfs:comment rdf:datatype="&xsd;string">A free text description of the source of this data, e.g. a database or person name. This property should be used to describe the source of the data. This is meant to be used by databases that export their data to the BioPAX format or by systems that are integrating data from multiple sources. The granularity of use (specifying the data source in many or few instances) is up to the user. It is intended that this property report the last data source, not all data sources that the data has passed through from creation.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#deltaG -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#deltaG">
<rdfs:comment rdf:datatype="&xsd;string">For biochemical reactions, this property refers to the standard transformed Gibbs energy change for a reaction written in terms of biochemical reactants (sums of species), delta-G
Since Delta-G can change based on multiple factors including ionic strength and temperature a reaction can have multiple DeltaG values.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#entityFeature -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#entityFeature">
<rdf:type rdf:resource="&owl;InverseFunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Variable features that are observed for this entity - such as known PTM or methylation sites and non-covalent bonds.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#entityReference -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#entityReference">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Reference entity for this physical entity.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Dna"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegion"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Protein"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Rna"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegion"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#entityReferenceType -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#entityReferenceType">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">A controlled vocabulary term that is used to describe the type of grouping such as homology or functional group.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReferenceTypeVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#evidence -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#evidence">
<rdfs:comment rdf:datatype="&xsd;string">Scientific evidence supporting the existence of the entity as described.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#evidenceCode -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#evidenceCode">
<rdfs:comment rdf:datatype="&xsd;string">A pointer to a term in an external controlled vocabulary, such as the GO, PSI-MI or BioCyc evidence codes, that describes the nature of the support, such as 'traceable author statement' or 'yeast two-hybrid'.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EvidenceCodeVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#experimentalFeature -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#experimentalFeature">
<rdfs:comment rdf:datatype="&xsd;string">A feature of the experimental form of the participant of the interaction, such as a protein tag. It is not expected to occur in vivo or be necessary for the interaction.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#experimentalForm -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#experimentalForm">
<rdfs:comment rdf:datatype="&xsd;string">The experimental forms associated with an evidence instance.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#experimentalFormDescription -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#experimentalFormDescription">
<rdfs:comment rdf:datatype="&xsd;string">Descriptor of this experimental form from a controlled vocabulary.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalFormVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#experimentalFormEntity -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#experimentalFormEntity">
<rdfs:comment rdf:datatype="&xsd;string">The gene or physical entity that this experimental form describes.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<rdfs:range>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Gene"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:unionOf>
</owl:Class>
</rdfs:range>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#feature -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#feature">
<rdfs:comment rdf:datatype="&xsd;string">Sequence features of the owner physical entity.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#featureLocation -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#featureLocation">
<rdfs:comment rdf:datatype="&xsd;string">Location of the feature on the sequence of the interactor. One feature may have more than one location, used e.g. for features which involve sequence positions close in the folded, three-dimensional state of a protein, but non-continuous along the sequence.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#featureLocationType -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#featureLocationType">
<rdfs:comment rdf:datatype="&xsd;string">A controlled vocabulary term describing the type of the sequence location such as C-Terminal or SH2 Domain.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#interactionScore -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#interactionScore">
<rdfs:comment rdf:datatype="&xsd;string">The score of an interaction e.g. a genetic interaction score.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#GeneticInteraction"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#interactionType -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#interactionType">
<rdfs:comment rdf:datatype="&xsd;string">External controlled vocabulary annotating the interaction type, for example "phosphorylation". This is annotation useful for e.g. display on a web page or database searching, but may not be suitable for other computing tasks, like reasoning.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#InteractionVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#kEQ -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#kEQ">
<rdfs:comment rdf:datatype="&xsd;string">This quantity is dimensionless and is usually a single number. The measured equilibrium constant for a biochemical reaction, encoded by the slot KEQ, is actually the apparent equilibrium constant, K'. Concentrations in the equilibrium constant equation refer to the total concentrations of all forms of particular biochemical reactants. For example, in the equilibrium constant equation for the biochemical reaction in which ATP is hydrolyzed to ADP and inorganic phosphate:
K' = [ADP][P<sub>i</sub>]/[ATP],
The concentration of ATP refers to the total concentration of all of the following species:
[ATP] = [ATP<sup>4-</sup>] + [HATP<sup>3-</sup>] + [H<sub>2</sub>ATP<sup>2-</sup>] + [MgATP<sup>2-</sup>] + [MgHATP<sup>-</sup>] + [Mg<sub>2</sub>ATP].
The apparent equilibrium constant is formally dimensionless, and can be kept so by inclusion of as many of the terms (1 mol/dm<sup>3</sup>) in the numerator or denominator as necessary. It is a function of temperature (T), ionic strength (I), pH, and pMg (pMg = -log<sub>10</sub>[Mg<sup>2+</sup>]). Therefore, these quantities must be specified to be precise, and values for KEQ for biochemical reactions may be represented as 5-tuples of the form (K' T I pH pMg). This property may have multiple values, representing different measurements for K' obtained under the different experimental conditions listed in the 5-tuple. (This definition adapted from EcoCyc)</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#left -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#left">
<rdfs:comment rdf:datatype="&xsd;string">The participants on the left side of the conversion interaction. Since conversion interactions may proceed in either the left-to-right or right-to-left direction, occupants of the LEFT property may be either reactants or products. LEFT is a sub-property of PARTICIPANTS.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#memberEntityReference -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#memberEntityReference">
<rdfs:comment rdf:datatype="&xsd;string">An entity reference that qualifies for the definition of this group. For example a member of a PFAM protein family.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#memberFeature -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#memberFeature">
<rdf:type rdf:resource="&owl;TransitiveProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">An entity feature that belongs to this homology grouping. Example: a homologous phosphorylation site across a protein family.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity">
<rdf:type rdf:resource="&owl;TransitiveProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">This property stores the members of a generic physical entity.
For representing homology generics a better way is to use generic entity references and generic features. However not all generic logic can be captured by this, such as complex generics or rare cases where feature cardinality is variable. Usages of this property should be limited to such cases.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#modificationType -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#modificationType">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Description and classification of the feature.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ModificationFeature"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#nextStep -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#nextStep">
<rdfs:comment rdf:datatype="&xsd;string">The next step(s) of the pathway. Contains zero or more pathwayStep instances. If there is no next step, this property is empty. Multiple pathwayStep instances indicate pathway branching.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#notFeature -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#notFeature">
<rdfs:comment rdf:datatype="&xsd;string">Sequence features where the owner physical entity has a feature. If not specified, other potential features are not known.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#organism -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#organism">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">An organism, e.g. 'Homo sapiens'. This is the organism that the entity is found in. Pathways may not have an organism associated with them, for instance, reference pathways from KEGG. Sequence-based entities (DNA, protein, RNA) may contain an xref to a sequence database that contains organism information, in which case the information should be consistent with the value for ORGANISM.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BioSource"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Gene"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#ProteinReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#participant -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#participant">
<rdfs:comment rdf:datatype="&xsd;string">This property lists the entities that participate in this interaction. For example, in a biochemical reaction, the participants are the union of the reactants and the products of the reaction. This property has a number of sub-properties, such as LEFT and RIGHT used in the biochemicalInteraction class. Any participant listed in a sub-property will automatically be assumed to also be in PARTICIPANTS by a number of software systems, including Protege, so this property should not contain any instances if there are instances contained in a sub-property.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#participantStoichiometry -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#participantStoichiometry">
<rdfs:comment rdf:datatype="&xsd;string">Stoichiometry of the left and right participants.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#pathwayComponent -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#pathwayComponent">
<rdfs:comment rdf:datatype="&xsd;string">The set of interactions and/or pathwaySteps in this pathway/network. Each instance of the pathwayStep class defines: 1) a set of interactions that together define a particular step in the pathway, for example a catalysis instance and the conversion that it catalyzes; 2) an order relationship to one or more other pathway steps (via the NEXT-STEP property). Note: This ordering is not necessarily temporal - the order described may simply represent connectivity between adjacent steps. Temporal ordering information should only be inferred from the direction of each interaction.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<rdfs:range>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
</owl:unionOf>
</owl:Class>
</rdfs:range>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#pathwayOrder -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#pathwayOrder">
<rdfs:comment rdf:datatype="&xsd;string">The ordering of components (interactions and pathways) in the context of this pathway. This is useful to specific circular or branched pathways or orderings when component biochemical reactions are normally reversible, but are directed in the context of this pathway.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#phenotype -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#phenotype">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The phenotype quality used to define this genetic interaction e.g. viability.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#GeneticInteraction"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#physicalEntity -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#physicalEntity">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">The physical entity to be annotated with stoichiometry.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#product -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#product">
<rdfs:comment rdf:datatype="&xsd;string">The product of a template reaction.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TemplateReaction"/>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<rdfs:range>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Dna"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Protein"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Rna"/>
</owl:unionOf>
</owl:Class>
</rdfs:range>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#regionType -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#regionType">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#relationshipType -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#relationshipType">
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipXref"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#right -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#right">
<rdfs:comment rdf:datatype="&xsd;string">The participants on the right side of the conversion interaction. Since conversion interactions may proceed in either the left-to-right or right-to-left direction, occupants of the RIGHT property may be either reactants or products. RIGHT is a sub-property of PARTICIPANTS.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#scoreSource -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#scoreSource">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#sequenceIntervalBegin -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#sequenceIntervalBegin">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The begin position of a sequence interval.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceInterval"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceSite"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#sequenceIntervalEnd -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#sequenceIntervalEnd">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The end position of a sequence interval.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceInterval"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceSite"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#stepConversion -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#stepConversion">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The central process that take place at this step of the biochemical pathway.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalPathwayStep"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#stepProcess"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#stepProcess -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#stepProcess">
<rdfs:comment rdf:datatype="&xsd;string">An interaction or a pathway that are a part of this pathway step.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<rdfs:range>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
</owl:unionOf>
</owl:Class>
</rdfs:range>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#structure -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#structure">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">Defines the chemical structure and other information about this molecule, using an instance of class chemicalStructure.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ChemicalStructure"/>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#subRegion -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#subRegion">
<rdfs:comment rdf:datatype="&xsd;string">The sub region of a region or nucleic acid molecule. The sub region must be wholly part of the region, not outside of it.</rdfs:comment>
<rdfs:range>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:unionOf>
</owl:Class>
</rdfs:range>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#template -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#template">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The template molecule that is used in this template reaction.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TemplateReaction"/>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<rdfs:range>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Dna"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegion"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Rna"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegion"/>
</owl:unionOf>
</owl:Class>
</rdfs:range>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#tissue -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#tissue">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">An external controlled vocabulary of tissue types.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BioSource"/>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
</owl:ObjectProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#xref -->
<owl:ObjectProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#xref">
<rdfs:comment xml:lang="en">Values of this property define external cross-references from this entity to entities in external databases.</rdfs:comment>
<rdfs:range rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#BioSource"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:ObjectProperty>
<!--
///////////////////////////////////////////////////////////////////////////////////////
//
// Data properties
//
///////////////////////////////////////////////////////////////////////////////////////
-->
<!-- http://www.biopax.org/release/biopax-level3.owl#author -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#author">
<rdfs:comment xml:lang="en">The authors of this publication, one per property value.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PublicationXref"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#availability -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#availability">
<rdfs:comment xml:lang="en">Describes the availability of this data (e.g. a copyright statement).</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#catalysisDirection -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#catalysisDirection">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">This property represents the direction of this catalysis under all
physiological conditions if there is one.
Note that chemically a catalyst will increase the rate of the reaction
in both directions. In biology, however, there are cases where the
enzyme is expressed only when the controlled bidirectional conversion is
on one side of the chemical equilibrium [todo : example]. If that is the
case and the controller, under biological conditions, is always
catalyzing the conversion in one direction then this fact can be
captured using this property. If the enzyme is active for both
directions, or the conversion is not bidirectional, this property should
be left empty.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Catalysis"/>
<rdfs:range>
<rdfs:Datatype>
<owl:oneOf>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">LEFT-TO-RIGHT</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">RIGHT-TO-LEFT</rdf:first>
<rdf:rest rdf:resource="&rdf;nil"/>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</owl:oneOf>
</rdfs:Datatype>
</rdfs:range>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#chemicalFormula -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#chemicalFormula">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The chemical formula of the small molecule. Note: chemical formula can also be stored in the STRUCTURE property (in CML). In case of disagreement between the value of this property and that in the CML file, the CML value takes precedence.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#comment -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#comment">
<rdfs:comment rdf:datatype="&xsd;string">Comment on the data in the container class. This property should be used instead of the OWL documentation elements (rdfs:comment) for instances because information in 'comment' is data to be exchanged, whereas the rdfs:comment field is used for metadata about the structure of the BioPAX ontology.</rdfs:comment>
<rdfs:range rdf:resource="&xsd;string"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#controlType -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#controlType">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Defines the nature of the control relationship between the CONTROLLER and the CONTROLLED entities.
The following terms are possible values:
ACTIVATION: General activation. Compounds that activate the specified enzyme activity by an unknown mechanism. The mechanism is defined as unknown, because either the mechanism has yet to be elucidated in the experimental literature, or the paper(s) curated thus far do not define the mechanism, and a full literature search has yet to be performed.
The following term can not be used in the catalysis class:
INHIBITION: General inhibition. Compounds that inhibit the specified enzyme activity by an unknown mechanism. The mechanism is defined as unknown, because either the mechanism has yet to be elucidated in the experimental literature, or the paper(s) curated thus far do not define the mechanism, and a full literature search has yet to be performed.
The following terms can only be used in the modulation class (these definitions from EcoCyc):
INHIBITION-ALLOSTERIC
Allosteric inhibitors decrease the specified enzyme activity by binding reversibly to the enzyme and inducing a conformational change that decreases the affinity of the enzyme to its substrates without affecting its VMAX. Allosteric inhibitors can be competitive or noncompetitive inhibitors, therefore, those inhibition categories can be used in conjunction with this category.
INHIBITION-COMPETITIVE
Competitive inhibitors are compounds that competitively inhibit the specified enzyme activity by binding reversibly to the enzyme and preventing the substrate from binding. Binding of the inhibitor and substrate are mutually exclusive because it is assumed that the inhibitor and substrate can both bind only to the free enzyme. A competitive inhibitor can either bind to the active site of the enzyme, directly excluding the substrate from binding there, or it can bind to another site on the enzyme, altering the conformation of the enzyme such that the substrate can not bind to the active site.
INHIBITION-IRREVERSIBLE
Irreversible inhibitors are compounds that irreversibly inhibit the specified enzyme activity by binding to the enzyme and dissociating so slowly that it is considered irreversible. For example, alkylating agents, such as iodoacetamide, irreversibly inhibit the catalytic activity of some enzymes by modifying cysteine side chains.
INHIBITION-NONCOMPETITIVE
Noncompetitive inhibitors are compounds that noncompetitively inhibit the specified enzyme by binding reversibly to both the free enzyme and to the enzyme-substrate complex. The inhibitor and substrate may be bound to the enzyme simultaneously and do not exclude each other. However, only the enzyme-substrate complex (not the enzyme-substrate-inhibitor complex) is catalytically active.
INHIBITION-OTHER
Compounds that inhibit the specified enzyme activity by a mechanism that has been characterized, but that cannot be clearly classified as irreversible, competitive, noncompetitive, uncompetitive, or allosteric.
INHIBITION-UNCOMPETITIVE
Uncompetitive inhibitors are compounds that uncompetitively inhibit the specified enzyme activity by binding reversibly to the enzyme-substrate complex but not to the enzyme alone.
ACTIVATION-NONALLOSTERIC
Nonallosteric activators increase the specified enzyme activity by means other than allosteric.
ACTIVATION-ALLOSTERIC
Allosteric activators increase the specified enzyme activity by binding reversibly to the enzyme and inducing a conformational change that increases the affinity of the enzyme to its substrates without affecting its VMAX.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Control"/>
<rdfs:range>
<rdfs:Datatype>
<owl:oneOf>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">ACTIVATION</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">ACTIVATION-ALLOSTERIC</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">ACTIVATION-NONALLOSTERIC</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">INHIBITION</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">INHIBITION-ALLOSTERIC</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">INHIBITION-COMPETITIVE</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">INHIBITION-IRREVERSIBLE</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">INHIBITION-NONCOMPETITIVE</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">INHIBITION-OTHER</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">INHIBITION-UNCOMPETITIVE</rdf:first>
<rdf:rest rdf:resource="&rdf;nil"/>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</owl:oneOf>
</rdfs:Datatype>
</rdfs:range>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#conversionDirection -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#conversionDirection">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">This property represents the direction of the reaction. If a reaction is fundamentally irreversible, then it will run in a single direction under all contexts. Otherwise it is reversible.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<rdfs:range>
<rdfs:Datatype>
<owl:oneOf>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">LEFT-TO-RIGHT</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">REVERSIBLE</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">RIGHT-TO-LEFT</rdf:first>
<rdf:rest rdf:resource="&rdf;nil"/>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</owl:oneOf>
</rdfs:Datatype>
</rdfs:range>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#db -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#db">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">The name of the external database to which this xref refers.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#dbVersion -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#dbVersion">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">The version of the external database in which this xref was last known to be valid. Resources may have recommendations for referencing dataset versions. For instance, the Gene Ontology recommends listing the date the GO terms were downloaded.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#deltaGPrime0 -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#deltaGPrime0">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">For biochemical reactions, this property refers to the standard transformed Gibbs energy change for a reaction written in terms of biochemical reactants (sums of species), delta-G'<sup>o</sup>.
delta-G'<sup>o</sup> = -RT lnK'
and
delta-G'<sup>o</sup> = delta-H'<sup>o</sup> - T delta-S'<sup>o</sup>
delta-G'<sup>o</sup> has units of kJ/mol. Like K', it is a function of temperature (T), ionic strength (I), pH, and pMg (pMg = -log<sub>10</sub>[Mg<sup>2+</sup>]). Therefore, these quantities must be specified, and values for DELTA-G for biochemical reactions are represented as 5-tuples of the form (delta-G'<sup>o</sup> T I pH pMg).
(This definition from EcoCyc)</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
<rdfs:range rdf:resource="&xsd;float"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#deltaH -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#deltaH">
<rdfs:comment rdf:datatype="&xsd;string">For biochemical reactions, this property refers to the standard transformed enthalpy change for a reaction written in terms of biochemical reactants (sums of species), delta-H'<sup>o</sup>.
delta-G'<sup>o</sup> = delta-H'<sup>o</sup> - T delta-S'<sup>o</sup>
Units: kJ/mole
(This definition from EcoCyc)</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction"/>
<rdfs:range rdf:resource="&xsd;float"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#deltaS -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#deltaS">
<rdfs:comment rdf:datatype="&xsd;string">For biochemical reactions, this property refers to the standard transformed entropy change for a reaction written in terms of biochemical reactants (sums of species), delta-S'<sup>o</sup>.
delta-G'<sup>o</sup> = delta-H'<sup>o</sup> - T delta-S'<sup>o</sup>
(This definition from EcoCyc)</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction"/>
<rdfs:range rdf:resource="&xsd;float"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#displayName -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#displayName">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">An abbreviated name for this entity, preferably a name that is short enough to be used in a visualization application to label a graphical element that represents this entity. If no short name is available, an xref may be used for this purpose by the visualization application.</rdfs:comment>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#name"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#eCNumber -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#eCNumber">
<rdfs:comment rdf:datatype="&xsd;string">The unique number assigned to a reaction by the Enzyme Commission of the International Union of Biochemistry and Molecular Biology.
Note that not all biochemical reactions currently have EC numbers assigned to them.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#id -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#id">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">The primary identifier in the external database of the object to which this xref refers.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#idVersion -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#idVersion">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The version number of the identifier (ID). E.g. The RefSeq accession number NM_005228.3 should be split into NM_005228 as the ID and 3 as the ID-VERSION.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#intraMolecular -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#intraMolecular">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">This flag represents whether the binding feature is within the same molecule or not.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BindingFeature"/>
<rdfs:range rdf:resource="&xsd;boolean"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#ionicStrength -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#ionicStrength">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The ionic strength is defined as half of the total sum of the concentration (ci) of every ionic species (i) in the solution times the square of its charge (zi). For example, the ionic strength of a 0.1 M solution of CaCl2 is 0.5 x (0.1 x 22 + 0.2 x 12) = 0.3 M
(Definition from http://www.lsbu.ac.uk/biology/enztech/ph.html)</rdfs:comment>
<rdfs:range rdf:resource="&xsd;float"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#kPrime -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#kPrime">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The apparent equilibrium constant K'. Concentrations in the equilibrium constant equation refer to the total concentrations of all forms of particular biochemical reactants. For example, in the equilibrium constant equation for the biochemical reaction in which ATP is hydrolyzed to ADP and inorganic phosphate:
K' = [ADP][P<sub>i</sub>]/[ATP],
The concentration of ATP refers to the total concentration of all of the following species:
[ATP] = [ATP<sup>4-</sup>] + [HATP<sup>3-</sup>] + [H<sub>2</sub>ATP<sup>2-</sup>] + [MgATP<sup>2-</sup>] + [MgHATP<sup>-</sup>] + [Mg<sub>2</sub>ATP].
The apparent equilibrium constant is formally dimensionless, and can be kept so by inclusion of as many of the terms (1 mol/dm<sup>3</sup>) in the numerator or denominator as necessary. It is a function of temperature (T), ionic strength (I), pH, and pMg (pMg = -log<sub>10</sub>[Mg<sup>2+</sup>]).
(Definition from EcoCyc)</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<rdfs:range rdf:resource="&xsd;float"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#molecularWeight -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#molecularWeight">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">Defines the molecular weight of the molecule, in daltons.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
<rdfs:range rdf:resource="&xsd;float"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#name -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#name">
<rdfs:comment xml:lang="en">One or more synonyms for the name of this individual. This should include the values of the standardName and displayName property so that it is easy to find all known names in one place.</rdfs:comment>
<rdfs:range rdf:resource="&xsd;string"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#BioSource"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#pMg -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#pMg">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">A measure of the concentration of magnesium (Mg) in solution. (pMg = -log<sub>10</sub>[Mg<sup>2+</sup>])</rdfs:comment>
<rdfs:range rdf:resource="&xsd;float"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#patoData -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#patoData">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The phenotype data from PATO, formatted as PhenoXML (defined at http://www.fruitfly.org/~cjm/obd/formats.html)</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#ph -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#ph">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">A measure of acidity and alkalinity of a solution that is a number on a scale on which a value of 7 represents neutrality and lower numbers indicate increasing acidity and higher numbers increasing alkalinity and on which each unit of change represents a tenfold change in acidity or alkalinity and that is the negative logarithm of the effective hydrogen-ion concentration or hydrogen-ion activity in gram equivalents per liter of the solution. (Definition from Merriam-Webster Dictionary)</rdfs:comment>
<rdfs:range rdf:resource="&xsd;float"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#positionStatus -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#positionStatus">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The confidence status of the sequence position. This could be:
EQUAL: The SEQUENCE-POSITION is known to be at the SEQUENCE-POSITION.
GREATER-THAN: The site is greater than the SEQUENCE-POSITION.
LESS-THAN: The site is less than the SEQUENCE-POSITION.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceSite"/>
<rdfs:range>
<rdfs:Datatype>
<owl:oneOf>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">EQUAL</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">GREATER-THAN</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">LESS-THAN</rdf:first>
<rdf:rest rdf:resource="&rdf;nil"/>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</owl:oneOf>
</rdfs:Datatype>
</rdfs:range>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#sequence -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#sequence">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">Polymer sequence in uppercase letters. For DNA, usually A,C,G,T letters representing the nucleosides of adenine, cytosine, guanine and thymine, respectively; for RNA, usually A, C, U, G; for protein, usually the letters corresponding to the 20 letter IUPAC amino acid code.</rdfs:comment>
<rdfs:range rdf:resource="&xsd;string"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#ProteinReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaReference"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#sequencePosition -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#sequencePosition">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The integer listed gives the position. The first base or amino acid is position 1. In combination with the numeric value, the property 'POSITION-STATUS' allows to express fuzzy positions, e.g. 'less than 4'.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceSite"/>
<rdfs:range rdf:resource="&xsd;int"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#source -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#source">
<rdfs:comment rdf:datatype="&xsd;string">The source in which the reference was published, such as: a book title, or a journal title and volume and pages.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PublicationXref"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#spontaneous -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#spontaneous">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Specifies whether a conversion occurs spontaneously or not. If the spontaneity is not known, the SPONTANEOUS property should be left empty.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<rdfs:range rdf:resource="&xsd;boolean"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#standardName -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#standardName">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">The preferred full name for this entity.</rdfs:comment>
<rdfs:subPropertyOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#name"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#stepDirection -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#stepDirection">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Direction of the conversion in this particular pathway context.
This property can be used for annotating direction of enzymatic activity. Even if an enzyme catalyzes a reaction reversibly, the flow of matter through the pathway will force the equilibrium in a given direction for that particular pathway.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalPathwayStep"/>
<rdfs:range>
<rdfs:Datatype>
<owl:oneOf>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">LEFT-TO-RIGHT</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">REVERSIBLE</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">RIGHT-TO-LEFT</rdf:first>
<rdf:rest rdf:resource="&rdf;nil"/>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</owl:oneOf>
</rdfs:Datatype>
</rdfs:range>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#stoichiometricCoefficient -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#stoichiometricCoefficient">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Stoichiometric coefficient for one of the entities in an interaction or complex. This value can be any rational number. Generic values such as "n" or "n+1" should not be used - polymers are currently not covered.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<rdfs:range rdf:resource="&xsd;float"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#structureData -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#structureData">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">This property holds a string of data defining chemical structure or other information, in either the CML or SMILES format, as specified in property Structure-Format. If, for example, the CML format is used, then the value of this property is a string containing the XML encoding of the CML data.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ChemicalStructure"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#structureFormat -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#structureFormat">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">This property specifies which format is used to define chemical structure data.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ChemicalStructure"/>
<rdfs:range>
<rdfs:Datatype>
<owl:oneOf>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">CML</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">InChI</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">SMILES</rdf:first>
<rdf:rest rdf:resource="&rdf;nil"/>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</owl:oneOf>
</rdfs:Datatype>
</rdfs:range>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#temperature -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#temperature">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">Temperature in Celsius</rdfs:comment>
<rdfs:range rdf:resource="&xsd;float"/>
<rdfs:domain>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
</owl:unionOf>
</owl:Class>
</rdfs:domain>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#templateDirection -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#templateDirection">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The direction of the template reaction on the template.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TemplateReaction"/>
<rdfs:range>
<rdfs:Datatype>
<owl:oneOf>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">FORWARD</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">REVERSE</rdf:first>
<rdf:rest rdf:resource="&rdf;nil"/>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</owl:oneOf>
</rdfs:Datatype>
</rdfs:range>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#term -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#term">
<rdfs:comment rdf:datatype="&xsd;string">The external controlled vocabulary term.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#title -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#title">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">The title of the publication.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PublicationXref"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#url -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#url">
<rdfs:comment xml:lang="en">The URL at which the publication can be found, if it is available through the Web.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PublicationXref"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#value -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#value">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment rdf:datatype="&xsd;string">The value of the score.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<rdfs:range rdf:resource="&xsd;string"/>
</owl:DatatypeProperty>
<!-- http://www.biopax.org/release/biopax-level3.owl#year -->
<owl:DatatypeProperty rdf:about="http://www.biopax.org/release/biopax-level3.owl#year">
<rdf:type rdf:resource="&owl;FunctionalProperty"/>
<rdfs:comment xml:lang="en">The year in which this publication was published.</rdfs:comment>
<rdfs:domain rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PublicationXref"/>
<rdfs:range rdf:resource="&xsd;int"/>
</owl:DatatypeProperty>
<!--
///////////////////////////////////////////////////////////////////////////////////////
//
// Classes
//
///////////////////////////////////////////////////////////////////////////////////////
-->
<!-- http://www.biopax.org/release/biopax-level3.owl#BindingFeature -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#BindingFeature">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#FragmentFeature"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition : An entity feature that represent the bound state of a physical entity. A pair of binding features represents a bond.
Rationale: A physical entity in a molecular complex is considered as a new state of an entity as it is structurally and functionally different. Binding features provide facilities for describing these states. Similar to other features, a molecule can have bound and not-bound states.
Usage: Typically, binding features are present in pairs, each describing the binding characteristic for one of the interacting physical entities. One exception is using a binding feature with no paired feature to describe any potential binding. For example, an unbound receptor can be described by using a "not-feature" property with an unpaired binding feature as its value. BindingSiteType and featureLocation allows annotating the binding location.
IntraMolecular property should be set to "true" if the bond links two parts of the same molecule. A pair of binding features are still used where they are owned by the same physical entity.
If the binding is due to the covalent interactions, for example in the case of lipoproteins, CovalentBindingFeature subclass should be used instead of this class.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#BioSource -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#BioSource">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ChemicalStructure"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: The biological source (organism, tissue or cell type) of an Entity.
Usage: Some entities are considered source-neutral (e.g. small molecules), and the biological source of others can be deduced from their constituentss (e.g. complex, pathway).
Instances: HeLa cells, Homo sapiens, and mouse liver tissue.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#BiochemicalPathwayStep -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#BiochemicalPathwayStep">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#stepProcess"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Control"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:comment rdf:datatype="&xsd;string">Definition: Imposes ordering on a step in a biochemical pathway.
Retionale: A biochemical reaction can be reversible by itself, but can be physiologically directed in the context of a pathway, for instance due to flux of reactants and products.
Usage: Only one conversion interaction can be ordered at a time, but multiple catalysis or modulation instances can be part of one step.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ComplexAssembly"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Degradation"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A conversion in which molecules of one or more physicalEntity pools, undergo covalent modifications and become a member of one or more other physicalEntity pools. The substrates of biochemical reactions are defined in terms of sums of species. This is a convention in biochemistry, and, in principle, all EC reactions should be biochemical reactions.
Examples: ATP + H2O = ADP + Pi
Comment: In the example reaction above, ATP is considered to be an equilibrium mixture of several species, namely ATP4-, HATP3-, H2ATP2-, MgATP2-, MgHATP-, and Mg2ATP. Additional species may also need to be considered if other ions (e.g. Ca2+) that bind ATP are present. Similar considerations apply to ADP and to inorganic phosphate (Pi). When writing biochemical reactions, it is not necessary to attach charges to the biochemical reactants or to include ions such as H+ and Mg2+ in the equation. The reaction is written in the direction specified by the EC nomenclature system, if applicable, regardless of the physiological direction(s) in which the reaction proceeds. Polymerization reactions involving large polymers whose structure is not explicitly captured should generally be represented as unbalanced reactions in which the monomer is consumed but the polymer remains unchanged, e.g. glycogen + glucose = glycogen. A better coverage for polymerization will be developed.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Catalysis -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Catalysis">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Control"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#controlled"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#controlType"/>
<owl:hasValue rdf:datatype="&xsd;string">ACTIVATION</owl:hasValue>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Modulation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TemplateReactionRegulation"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A control interaction in which a physical entity (a catalyst) increases the rate of a conversion interaction by lowering its activation energy. Instances of this class describe a pairing between a catalyzing entity and a catalyzed conversion.
Rationale: Catalysis, theoretically, is always bidirectional since it acts by lowering the activation energy. Physiologically, however, it can have a direction because of the concentration of the participants. For example, the oxidative decarboxylation catalyzed by Isocitrate dehydrogenase always happens in one direction under physiological conditions since the produced carbon dioxide is constantly removed from the system.
Usage: A separate catalysis instance should be created for each different conversion that a physicalEntity may catalyze and for each different physicalEntity that may catalyze a conversion. For example, a bifunctional enzyme that catalyzes two different biochemical reactions would be linked to each of those biochemical reactions by two separate instances of the catalysis class. Also, catalysis reactions from multiple different organisms could be linked to the same generic biochemical reaction (a biochemical reaction is generic if it only includes small molecules). Generally, the enzyme catalyzing a conversion is known and the use of this class is obvious, however, in the cases where a catalyzed reaction is known to occur but the enzyme is not known, a catalysis instance can be created without a controller specified.
Synonyms: facilitation, acceleration.
Examples: The catalysis of a biochemical reaction by an enzyme, the enabling of a transport interaction by a membrane pore complex, and the facilitation of a complex assembly by a scaffold protein. Hexokinase -> (The "Glucose + ATP -> Glucose-6-phosphate +ADP" reaction). A plasma membrane Na+/K+ ATPase is an active transporter (antiport pump) using the energy of ATP to pump Na+ out of the cell and K+ in. Na+ from cytoplasm to extracellular space would be described in a transport instance. K+ from extracellular space to cytoplasm would be described in a transport instance. The ATPase pump would be stored in a catalysis instance controlling each of the above transport instances. A biochemical reaction that does not occur by itself under physiological conditions, but has been observed to occur in the presence of cell extract, likely via one or more unknown enzymes present in the extract, would be stored in the CONTROLLED property, with the CONTROLLER property empty.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#CellVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#CellVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#CellularLocationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReferenceTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EvidenceCodeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalFormVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#InteractionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference to the Cell Type Ontology (CL). Homepage at http://obofoundry.org/cgi-bin/detail.cgi?cell. Browse at http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=CL</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#CellularLocationVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#CellularLocationVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReferenceTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EvidenceCodeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalFormVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#InteractionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference to the Gene Ontology Cellular Component (GO CC) ontology. Homepage at http://www.geneontology.org. Browse at http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=GO</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#ChemicalStructure -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#ChemicalStructure">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#structureData"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#structureFormat"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: The chemical structure of a small molecule.
Usage: Structure information is stored in the property structureData, in one of three formats: the CML format (see URL www.xml-cml.org), the SMILES format (see URL www.daylight.com/dayhtml/smiles/) or the InChI format (http://www.iupac.org/inchi/). The structureFormat property specifies which format is used.
Examples: The following SMILES string describes the structure of glucose-6-phosphate:
'C(OP(=O)(O)O)[CH]1([CH](O)[CH](O)[CH](O)[CH](O)O1)'.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Complex -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Complex">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Complex"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Dna"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaRegion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Protein"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Rna"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A physical entity whose structure is comprised of other physical entities bound to each other covalently or non-covalently, at least one of which is a macromolecule (e.g. protein, DNA, or RNA) and the Stoichiometry of the components are known.
Comment: Complexes must be stable enough to function as a biological unit; in general, the temporary association of an enzyme with its substrate(s) should not be considered or represented as a complex. A complex is the physical product of an interaction (complexAssembly) and is not itself considered an interaction.
The boundaries on the size of complexes described by this class are not defined here, although possible, elements of the cell such a mitochondria would typically not be described using this class (later versions of this ontology may include a cellularComponent class to represent these). The strength of binding cannot be described currently, but may be included in future versions of the ontology, depending on community need.
Examples: Ribosome, RNA polymerase II. Other examples of this class include complexes of multiple protein monomers and complexes of proteins and small molecules.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#ComplexAssembly -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#ComplexAssembly">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Degradation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Transport"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A conversion interaction in which a set of physical entities, at least one being a macromolecule (e.g. protein, RNA, DNA), aggregate to from a complex physicalEntity. One of the participants of a complexAssembly must be an instance of the class Complex. The modification of the physicalentities involved in the ComplexAssembly is captured via BindingFeature class.
Usage: This class is also used to represent complex disassembly. The assembly or disassembly of a complex is often a spontaneous process, in which case the direction of the complexAssembly (toward either assembly or disassembly) should be specified via the SPONTANEOUS property. Conversions in which participants obtain or lose CovalentBindingFeatures ( e.g. glycolysation of proteins) should be modeled with BiochemicalReaction.
Synonyms: aggregation, complex formation
Examples: Assembly of the TFB2 and TFB3 proteins into the TFIIH complex, and assembly of the ribosome through aggregation of its subunits.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Control -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Control">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#GeneticInteraction"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#MolecularInteraction"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TemplateReaction"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An interaction in which one entity regulates, modifies, or otherwise influences a continuant entity, i.e. pathway or interaction.
Usage: Conceptually, physical entities are involved in interactions (or events) and the events are controlled or modified, not the physical entities themselves. For example, a kinase activating a protein is a frequent event in signaling pathways and is usually represented as an 'activation' arrow from the kinase to the substrate in signaling diagrams. This is an abstraction, called "Activity Flow" representation, that can be ambiguous without context. In BioPAX, this information should be captured as the kinase catalyzing (via an instance of the catalysis class) a Biochemical Reaction in which the substrate is phosphorylated.
Subclasses of control define types specific to the biological process that is being controlled and should be used instead of the generic "control" class when applicable.
A control can potentially have multiple controllers. This acts as a logical AND, i.e. both controllers are needed to regulate the controlled event. Alternatively multiple controllers can control the same event and this acts as a logical OR, i.e. any one of them is sufficient to regulate the controlled event. Using this structure it is possible to describe arbitrary control logic using BioPAX.
Rationale: Control can be temporally non-atomic, for example a pathway can control another pathway in BioPAX.
Synonyms: regulation, mediation
Examples: A small molecule that inhibits a pathway by an unknown mechanism.</rdfs:comment>
</owl:Class>
<owl:Axiom>
<disponte:probability rdf:datatype="&xsd;decimal">0.7</disponte:probability>
<owl:annotatedSource rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Control"/>
<owl:annotatedTarget rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<owl:annotatedProperty rdf:resource="&rdfs;subClassOf"/>
</owl:Axiom>
<!-- http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#xref"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UnificationXref"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DeltaG"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Used to reference terms from external controlled vocabularies (CVs) from the ontology. To support consistency and compatibility, open, freely available CVs should be used whenever possible, such as the Gene Ontology (GO)15 or other open biological CVs listed on the OBO website (http://obo.sourceforge.net/). See the section on controlled vocabularies in Section 4 for more information.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Conversion -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Conversion">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#GeneticInteraction"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An interaction in which molecules of one or more physicalEntity pools are physically transformed and become a member of one or more other physicalEntity pools.
Comments: Conversions in BioPAX are stoichiometric and closed world, i.e. it is assumed that all of the participants are listed. Both properties are due to the law of mass conservation.
Usage: Subclasses of conversion represent different types of transformation reflected by the properties of different physicalEntity. BiochemicalReactions will change the ModificationFeatures on a PhysicalEntity , Transport will change the CellularLocation and ComplexAssembly will change BindingFeatures. Generic Conversion class should only be used when the modification does not fit into one of these classes.
Example: Opening of a voltage gated channel.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#CovalentBindingFeature -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#CovalentBindingFeature">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BindingFeature"/>
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ModificationFeature"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition : An entity feature that represent the covalently bound state of a physical entity.
Rationale: Most frequent covalent modifications to proteins and DNA, such as phosphorylation and metylation are covered by the ModificationFeature class. In these cases, the added groups are simple and stateless therefore they can be captured by a controlled vocabulary. In other cases, such as ThiS-Thilacyl-disulfide, the covalently linked molecules are best represented as a molecular complex. CovalentBindingFeature should be used to model such covalently linked complexes.
Usage: Using this construct, it is possible to represent small molecules as a covalent complex of two other small molecules. The demarcation of small molecules is a general problem and is delegated to small molecule databases.The best practice is not to model using covalent complexes unless at least one of the participants is a protein, DNA or RNA.
Examples:
disulfide bond
UhpC + glc-6P -> Uhpc-glc-6p
acetyl-ACP -> decenoyl-ACP
charged tRNA</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Degradation -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Degradation">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#conversionDirection"/>
<owl:hasValue rdf:datatype="&xsd;string">LEFT-TO-RIGHT</owl:hasValue>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Transport"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A conversion in which a pool of macromolecules are degraded into their elementary units.
Usage: This conversion always has a direction of left-to-right and is irreversible. Degraded molecules are always represented on the left, degradation products on the right.
Comments: Degradation is a complex abstraction over multiple reactions. Although it obeys law of mass conservation and stoichiometric, the products are rarely specified since they are ubiquitous.
Example: Degradation of a protein to amino acids.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#DeltaG -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#DeltaG">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#deltaGPrime0"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: Standard transformed Gibbs energy change for a reaction written in terms of biochemical reactants.
Usage: Delta-G is represented as a 5-tuple of delta-G'<sup>0</sup>, temperature, ionic strength , pH, and pMg . A conversion in BioPAX may have multiple Delta-G values, representing different measurements for delta-G'<sup>0</sup> obtained under the different experimental conditions.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Dna -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Dna">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#entityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Dna"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaRegion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Protein"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Rna"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A physical entity consisting of a sequence of deoxyribonucleotide monophosphates; a deoxyribonucleic acid.
Usage: DNA should be used for pools of individual DNA molecules. For describing subregions on those molecules use DNARegion.
Examples: a chromosome, a plasmid. A specific example is chromosome 7 of Homo sapiens.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#DnaReference -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaReference">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberEntityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#subRegion"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ProteinReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A DNA reference is a grouping of several DNA entities that are common in sequence. Members can differ in celular location, sequence features, SNPs, mutations and bound partners.
Comments : Note that this is not a reference gene. Genes are non-physical,stateless continuants. Their physical manifestations can span multiple DNA molecules, sometimes even across chromosomes due to regulatory regions. Similarly a gene is not necessarily made up of deoxyribonucleic acid and can be present in multiple copies ( which are different DNA regions).</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#DnaRegion -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegion">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaRegion"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#entityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Protein"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Rna"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A region on a DNA molecule.
Usage: DNARegion is not a pool of independent molecules but a subregion on these molecules. As such, every DNARegion has a defining DNA molecule.
Examples: Protein encoding region, promoter</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#subRegion"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#DnaRegionReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ProteinReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A DNARegionReference is a grouping of several DNARegion entities that are common in sequence and genomic position. Members can differ in cellular location, sequence features, SNPs, mutations and bound partners.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Entity -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Entity">
<rdfs:comment rdf:datatype="&xsd;string">Definition: A discrete biological unit used when describing pathways.
Rationale: Entity is the most abstract class for representing interacting
elements in a pathway. It includes both occurents (interactions and
pathways) and continuants (physical entities and genes). Loosely speaking,
BioPAX Entity is an atomic scientific statement with an associated source,
evidence and references.
Synonyms: element, thing, object, bioentity, statement.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#EntityFeature -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#EntityFeature">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Description: A characteristic of a physical entity that can change while the entity still retains its biological identity.
Rationale: Two phosphorylated forms of a protein are strictly speaking different chemical molecules. It is, however, standard in biology to treat them as different states of the same entity, where the entity is loosely defined based on sequence. Entity Feature class and its subclassses captures these variable characteristics. A Physical Entity in BioPAX represents a pool of molecules rather than an individual molecule. This is a notion imported from chemistry( See PhysicalEntity). Pools are defined by a set of Entity Features in the sense that a single molecule must have all of the features in the set in order to be considered a member of the pool. Since it is impossible to list and experimentally test all potential features for an entity, features that are not listed in the selection criteria is neglected Pools can also be defined by the converse by specifying features that are known to NOT exist in a specific context. As DNA, RNA and Proteins can be hierarchicaly organized into families based on sequence homology so can entity features. The memberFeature property allows capturing such hierarchical classifications among entity features.
Usage: Subclasses of entity feature describe most common biological instances and should be preferred whenever possible. One common usecase for instantiating entity feature is, for describing active/inactive states of proteins where more specific feature information is not available.
Examples: Open/close conformational state of channel proteins, "active"/"inactive" states, excited states of photoreactive groups.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#EntityReference -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#EntityReference">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Evidence"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An entity reference is a grouping of several physical entities across different contexts and molecular states, that share common physical properties and often named and treated as a single entity with multiple states by biologists.
Rationale: Many protein, small molecule and gene databases share this point of view, and such a grouping is an important prerequisite for interoperability with those databases. Biologists would often group different pools of molecules in different contexts under the same name. For example cytoplasmic and extracellular calcium have different effects on the cell's behavior, but they are still called calcium. For DNA, RNA and Proteins the grouping is defined based on a wildtype sequence, for small molecules it is defined by the chemical structure.
Usage: Entity references store the information common to a set of molecules in various states described in the BioPAX document, including database cross-references. For instance, the P53 protein can be phosphorylated in multiple different ways. Each separate P53 protein (pool) in a phosphorylation state would be represented as a different protein (child of physicalEntity) and all things common to all P53 proteins, including all possible phosphorylation sites, the sequence common to all of them and common references to protein databases containing more information about P53 would be stored in a Entity Reference.
Comments: This grouping has three semantic implications:
1. Members of different pools share many physical and biochemical properties. This includes their chemical structure, sequence, organism and set of molecules they react with. They will also share a lot of secondary information such as their names, functional groupings, annotation terms and database identifiers.
2. A small number of transitions seperates these pools. In other words it is relatively easy and frequent for a molecule to transform from one physical entity to another that belong to the same reference entity. For example an extracellular calcium can become cytoplasmic, and p53 can become phosphorylated. However no calcium virtually becomes sodium, or no p53 becomes mdm2. In the former it is the sheer energy barrier of a nuclear reaction, in the latter sheer statistical improbability of synthesizing the same sequence without a template. If one thinks about the biochemical network as molecules transforming into each other, and remove edges that respond to transcription, translation, degradation and covalent modification of small molecules, each remaining component is a reference entity.
3. Some of the pools in the same group can overlap. p53-p@ser15 can overlap with p53-p@thr18. Most of the experiments in molecular biology will only check for one state variable, rarely multiple, and never for the all possible combinations. So almost all statements that refer to the state of the molecule talk about a pool that can overlap with other pools. However no overlaps is possible between molecules of different groups.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#EntityReferenceTypeVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#EntityReferenceTypeVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EvidenceCodeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalFormVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#InteractionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference to a term from an entity reference group ontology. As of the writing of this documentation, there is no standard ontology of these terms, though a common type is "homology".</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Evidence -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Evidence">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#confidence"/>
<owl:minCardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:minCardinality>
</owl:Restriction>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#evidenceCode"/>
<owl:minCardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:minCardinality>
</owl:Restriction>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#experimentalForm"/>
<owl:minCardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:minCardinality>
</owl:Restriction>
</owl:unionOf>
</owl:Class>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: The support for a particular assertion, such as the existence of an interaction or pathway.
Usage: At least one of confidence, evidenceCode, or experimentalForm must be instantiated when creating an evidence instance. XREF may reference a publication describing the experimental evidence using a publicationXref or may store a description of the experiment in an experimental description database using a unificationXref (if the referenced experiment is the same) or relationshipXref (if it is not identical, but similar in some way e.g. similar in protocol). Evidence is meant to provide more information than just an xref to the source paper.
Examples: A description of a molecular binding assay that was used to detect a protein-protein interaction.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#EvidenceCodeVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#EvidenceCodeVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ExperimentalFormVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#InteractionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference to the PSI Molecular Interaction ontology (MI) experimental method types, including "interaction detection method", "participant identification method", "feature detection method". Homepage at http://www.psidev.info/. Browse at http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=MI
Terms from the Pathway Tools Evidence Ontology may also be used. Homepage http://brg.ai.sri.com/evidence-ontology/</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#ExperimentalForm">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#experimentalFormDescription"/>
<owl:minCardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:minCardinality>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#KPrime"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: The form of a physical entity in a particular experiment, as it may be modified for purposes of experimental design.
Examples: A His-tagged protein in a binding assay. A protein can be tagged by multiple tags, so can have more than 1 experimental form type terms</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#ExperimentalFormVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#ExperimentalFormVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#InteractionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference to the PSI Molecular Interaction ontology (MI) participant identification method (e.g. mass spectrometry), experimental role (e.g. bait, prey), experimental preparation (e.g. expression level) type. Homepage at http://www.psidev.info/. Browse http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=MI&termId=MI%3A0002&termName=participant%20identification%20method
http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=MI&termId=MI%3A0495&termName=experimental%20role
http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=MI&termId=MI%3A0346&termName=experimental%20preparation</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#FragmentFeature -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#FragmentFeature">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ModificationFeature"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An entity feature that represents the resulting physical entity subsequent to a cleavage or degradation event.
Usage: Fragment Feature can be used to cover multiple types of modfications to the sequence of the physical entity:
1. A protein with a single cleavage site that converts the protein into two fragments (e.g. pro-insulin converted to insulin and C-peptide). TODO: CV term for sequence fragment? PSI-MI CV term for cleavage site?
2. A protein with two cleavage sites that removes an internal sequence e.g. an intein i.e. ABC -> A
3. Cleavage of a circular sequence e.g. a plasmid.
In the case of removal ( e.g. intron) the fragment that is *removed* is specified in the feature location property. In the case of a "cut" (e.g. restriction enzyme cut site) the location of the cut is specified instead.
Examples: Insulin Hormone</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Gene -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Gene">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#organism"/>
<owl:maxCardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:maxCardinality>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A continuant that encodes information that can be inherited through replication.
Rationale: Gene is an abstract continuant that can be best described as a "schema", a common conception commonly used by biologists to demark a component within genome. In BioPAX, Gene is considered a generalization over eukaryotic and prokaryotic genes and is used only in genetic interactions. Gene is often confused with DNA and RNA fragments, however, these are considered the physical encoding of a gene. N.B. Gene expression regulation makes use of DNA and RNA physical entities and not this class.
Usage: Gene should only be used for describing GeneticInteractions.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#GeneticInteraction -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#GeneticInteraction">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#interactionType"/>
<owl:maxCardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:maxCardinality>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#phenotype"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Gene"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<owl:minCardinality rdf:datatype="&xsd;nonNegativeInteger">2</owl:minCardinality>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#MolecularInteraction"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TemplateReaction"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition : Genetic interactions between genes occur when two genetic perturbations (e.g. mutations) have a combined phenotypic effect not caused by either perturbation alone. A gene participant in a genetic interaction represents the gene that is perturbed. Genetic interactions are not physical interactions but logical (AND) relationships. Their physical manifestations can be complex and span an arbitarily long duration.
Rationale: Currently, BioPAX provides a simple definition that can capture most genetic interactions described in the literature. In the future, if required, the definition can be extended to capture other logical relationships and different, participant specific phenotypes.
Example: A synthetic lethal interaction occurs when cell growth is possible without either gene A OR B, but not without both gene A AND B. If you knock out A and B together, the cell will die.</rdfs:comment>
</owl:Class>
<owl:Axiom>
<disponte:probability rdf:datatype="&xsd;decimal">0.7</disponte:probability>
<owl:annotatedSource rdf:resource="http://www.biopax.org/release/biopax-level3.owl#GeneticInteraction"/>
<owl:annotatedTarget rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<owl:annotatedProperty rdf:resource="&rdfs;subClassOf"/>
</owl:Axiom>
<!-- http://www.biopax.org/release/biopax-level3.owl#Interaction -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Interaction">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A biological relationship between two or more entities.
Rationale: In BioPAX, interactions are atomic from a database modeling perspective, i.e. interactions can not be decomposed into sub-interactions. When representing non-atomic continuants with explicit subevents the pathway class should be used instead. Interactions are not necessarily temporally atomic, for example genetic interactions cover a large span of time. Interactions as a formal concept is a continuant, it retains its identitiy regardless of time, or any differences in specific states or properties.
Usage: Interaction is a highly abstract class and in almost all cases it is more appropriate to use one of the subclasses of interaction.
It is partially possible to define generic reactions by using generic participants. A more comprehensive method is planned for BioPAX L4 for covering all generic cases like oxidization of a generic alcohol.
Synonyms: Process, relationship, event.
Examples: protein-protein interaction, biochemical reaction, enzyme catalysis</rdfs:comment>
</owl:Class>
<owl:Axiom>
<disponte:probability rdf:datatype="&xsd;decimal">0.89</disponte:probability>
<owl:annotatedSource rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<owl:annotatedTarget rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<owl:annotatedProperty rdf:resource="&owl;disjointWith"/>
</owl:Axiom>
<!-- http://www.biopax.org/release/biopax-level3.owl#InteractionVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#InteractionVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference to the PSI Molecular Interaction ontology (MI) interaction type. Homepage at http://www.psidev.info/. Browse at http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=MI&termId=MI%3A0190&termName=interaction%20type</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#KPrime -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#KPrime">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#kPrime"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PathwayStep"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: The apparent equilibrium constant, K', and associated values.
Usage: Concentrations in the equilibrium constant equation refer to the total concentrations of all forms of particular biochemical reactants. For example, in the equilibrium constant equation for the biochemical reaction in which ATP is hydrolyzed to ADP and inorganic phosphate:
K' = [ADP][P<sub>i</sub>]/[ATP],
The concentration of ATP refers to the total concentration of all of the following species:
[ATP] = [ATP<sup>4-</sup>] + [HATP<sup>3-</sup>] + [H<sub>2</sub>ATP<sup>2-</sup>] + [MgATP<sup>2-</sup>] + [MgHATP<sup>-</sup>] + [Mg<sub>2</sub>ATP].
The apparent equilibrium constant is formally dimensionless, and can be kept so by inclusion of as many of the terms (1 mol/dm<sup>3</sup>) in the numerator or denominator as necessary. It is a function of temperature (T), ionic strength (I), pH, and pMg (pMg = -log<sub>10</sub>[Mg<sup>2+</sup>]). Therefore, these quantities must be specified to be precise, and values for KEQ for biochemical reactions may be represented as 5-tuples of the form (K' T I pH pMg). This property may have multiple values, representing different measurements for K' obtained under the different experimental conditions listed in the 5-tuple. (This definition adapted from EcoCyc)
See http://www.chem.qmul.ac.uk/iubmb/thermod/ for a thermodynamics tutorial.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#ModificationFeature -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#ModificationFeature">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityFeature"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An entity feature that represents the covalently modified state of a dna, rna or a protein.
Rationale: In Biology, identity of DNA, RNA and Protein entities are defined around a wildtype sequence. Covalent modifications to this basal sequence are represented using modificaton features. Since small molecules are identified based on their chemical structure, not sequence, a covalent modification to a small molecule would result in a different molecule.
Usage: The added groups should be simple and stateless, such as phosphate or methyl groups and are captured by the modificationType controlled vocabulary. In other cases, such as covalently linked proteins, use CovalentBindingFeature instead.
Instances: A phosphorylation on a protein, a methylation on a DNA.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Modulation -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Modulation">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Control"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#controller"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#controlled"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Catalysis"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TemplateReactionRegulation"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A control interaction in which a physical entity modulates a catalysis interaction.
Rationale: Biologically, most modulation interactions describe an interaction in which a small molecule alters the ability of an enzyme to catalyze a specific reaction. Instances of this class describe a pairing between a modulating entity and a catalysis interaction.
Usage: A typical modulation instance has a small molecule as the controller entity and a catalysis instance as the controlled entity. A separate modulation instance should be created for each different catalysis instance that a physical entity may modulate, and for each different physical entity that may modulate a catalysis instance.
Examples: Allosteric activation and competitive inhibition of an enzyme's ability to catalyze a specific reaction.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#MolecularInteraction -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#MolecularInteraction">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An interaction in which participants bind physically to each other, directly or indirectly through intermediary molecules.
Rationale: There is a large body of interaction data, mostly produced by high throughput systems, that does not satisfy the level of detail required to model them with ComplexAssembly class. Specifically, what is lacking is the stoichiometric information and completeness (closed-world) of participants required to model them as chemical processes. Nevertheless interaction data is extremely useful and can be captured in BioPAX using this class.
Usage: This class should be used by default for representing molecular interactions such as those defined by PSI-MI level 2.5. The participants in a molecular interaction should be listed in the PARTICIPANT slot. Note that this is one of the few cases in which the PARTICPANT slot should be directly populated with instances (see comments on the PARTICPANTS property in the interaction class description). If all participants are known with exact stoichiometry, ComplexAssembly class should be used instead.
Example: Two proteins observed to interact in a yeast-two-hybrid experiment where there is not enough experimental evidence to suggest that the proteins are forming a complex by themselves without any indirect involvement of other proteins. This is the case for most large-scale yeast two-hybrid screens.</rdfs:comment>
</owl:Class>
<owl:Axiom>
<disponte:probability rdf:datatype="&xsd;decimal">0.2</disponte:probability>
<owl:annotatedSource rdf:resource="http://www.biopax.org/release/biopax-level3.owl#MolecularInteraction"/>
<owl:annotatedProperty rdf:resource="&rdfs;subClassOf"/>
<owl:annotatedTarget>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:Restriction>
</owl:annotatedTarget>
</owl:Axiom>
<!-- http://www.biopax.org/release/biopax-level3.owl#Pathway -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Pathway">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A set or series of interactions, often forming a network, which biologists have found useful to group together for organizational, historic, biophysical or other reasons.
Usage: Pathways can be used for demarcating any subnetwork of a BioPAX model. It is also possible to define a pathway without specifying the interactions within the pathway. In this case, the pathway instance could consist simply of a name and could be treated as a 'black box'. Pathways can also soverlap, i.e. a single interaction might belong to multiple pathways. Pathways can also contain sub-pathways. Pathways are continuants.
Synonyms: network, module, cascade,
Examples: glycolysis, valine biosynthesis, EGFR signaling</rdfs:comment>
</owl:Class>
<owl:Axiom>
<disponte:probability rdf:datatype="&xsd;decimal">0.89</disponte:probability>
<owl:annotatedSource rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<owl:annotatedTarget rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<owl:annotatedProperty rdf:resource="&owl;disjointWith"/>
</owl:Axiom>
<owl:Axiom>
<disponte:probability rdf:datatype="&xsd;decimal">0.9</disponte:probability>
<owl:annotatedTarget rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<owl:annotatedSource rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Pathway"/>
<owl:annotatedProperty rdf:resource="&rdfs;subClassOf"/>
</owl:Axiom>
<!-- http://www.biopax.org/release/biopax-level3.owl#PathwayStep -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#PathwayStep">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Provenance"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A step in an ordered pathway.
Rationale: Some pathways can have a temporal order. For example, if the pathway boundaries are based on a perturbation phenotype link, the pathway might start with the perturbing agent and end at gene expression leading to the observed changes. Pathway steps can represent directed compound graphs.
Usage: Multiple interactions may occur in a pathway step, each should be listed in the stepProcess property. Order relationships between pathway steps may be established with the nextStep slot. If the reaction contained in the step is a reversible biochemical reaction but physiologically has a direction in the context of this pathway, use the subclass BiochemicalPathwayStep.
Example: A metabolic pathway may contain a pathway step composed of one biochemical reaction (BR1) and one catalysis (CAT1) instance, where CAT1 describes the catalysis of BR1. The M phase of the cell cycle, defined as a pathway, precedes the G1 phase, also defined as a pathway.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#PhenotypeVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: The phenotype measured in the experiment e.g. growth rate or viability of a cell. This is only the type, not the value e.g. for a synthetic lethal interaction, the phenotype is viability, specified by ID: PATO:0000169, "viability", not the value (specified by ID: PATO:0000718, "lethal (sensu genetics)". A single term in a phenotype controlled vocabulary can be referenced using the xref, or the PhenoXML describing the PATO EQ model phenotype description can be stored as a string in PATO-DATA.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Entity"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A pool of molecules or molecular complexes.
Comments: Each PhysicalEntity is defined by a sequence or structure based on an EntityReference AND any set of Features that are given. For example, ser46 phosphorylated p53 is a physical entity in BioPAX defined by the p53 sequence and the phosphorylation feature on the serine at position 46 in the sequence. Features are any combination of cellular location, covalent and non-covalent bonds with other molecules and covalent modifications.
For a specific molecule to be a member of the pool it has to satisfy all of the specified features. Unspecified features are treated as unknowns or unneccesary. Features that are known to not be on the molecules should be explicitly stated with the "not feature" property.
A physical entity in BioPAX never represents a specific molecular instance.
Physical Entity can be heterogenous and potentially overlap, i.e. a single molecule can be counted as a member of multiple pools. This makes BioPAX semantics different than regular chemical notation but is necessary for dealing with combinatorial complexity.
Synonyms: part, interactor, object, species
Examples: extracellular calcium, ser 64 phosphorylated p53</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Protein -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Protein">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#entityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ProteinReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Protein"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Rna"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A physical entity consisting of a sequence of amino acids; a protein monomer; a single polypeptide chain.
Examples: The epidermal growth factor receptor (EGFR) protein.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#ProteinReference -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#ProteinReference">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberEntityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ProteinReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
<rdfs:comment rdf:datatype="&xsd;string">A protein reference is a grouping of several protein entities that are encoded by the same gene. Members can differ in celular location, sequence features and bound partners. Currently conformational states (such as open and closed) are not covered.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Provenance -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Provenance">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#xref"/>
<owl:allValuesFrom>
<owl:Class>
<owl:unionOf rdf:parseType="Collection">
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#PublicationXref"/>
<rdf:Description rdf:about="http://www.biopax.org/release/biopax-level3.owl#UnificationXref"/>
</owl:unionOf>
</owl:Class>
</owl:allValuesFrom>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Score"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: The direct source of pathway data or score.
Usage: This does not store the trail of sources from the generation of the data to this point, only the last known source, such as a database, tool or algorithm. The xref property may contain a publicationXref referencing a publication describing the data source (e.g. a database publication). A unificationXref may be used when pointing to an entry in a database of databases describing this database.
Examples: A database, scoring method or person name.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#PublicationXref -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#PublicationXref">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UnificationXref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An xref that defines a reference to a publication such as a book, journal article, web page, or software manual.
Usage: The reference may or may not be in a database, although references to PubMed are preferred when possible. The publication should make a direct reference to the instance it is attached to. Publication xrefs should make use of PubMed IDs wherever possible. The DB property of an xref to an entry in PubMed should use the string "PubMed" and not "MEDLINE".
Examples: PubMed:10234245</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#RelationshipTypeVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: Vocabulary for defining relationship Xref types. A reference to the PSI Molecular Interaction ontology (MI) Cross Reference type. Homepage at http://www.psidev.info/. Browse at http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=MI&termId=MI%3A0353&termName=cross-reference%20type</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#RelationshipXref -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#RelationshipXref">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An xref that defines a reference to an entity in an external resource that does not have the same biological identity as the referring entity.
Usage: There is currently no controlled vocabulary of relationship types for BioPAX, although one will be created in the future if a need develops.
Examples: A link between a gene G in a BioPAX data collection, and the protein product P of that gene in an external database. This is not a unification xref because G and P are different biological entities (one is a gene and one is a protein). Another example is a relationship xref for a protein that refers to the Gene Ontology biological process, e.g. 'immune response,' that the protein is involved in.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Rna -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Rna">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#entityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Rna"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegion"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A physical entity consisting of a sequence of ribonucleotide monophosphates; a ribonucleic acid.
Usage: RNA should be used for pools of individual RNA molecules. For describing subregions on those molecules use RNARegion.
Examples: messengerRNA, microRNA, ribosomalRNA. A specific example is the let-7 microRNA.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#RnaReference -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaReference">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#subRegion"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberEntityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
<rdfs:comment rdf:datatype="&xsd;string">Defintion: A RNA reference is a grouping of several RNA entities that are either encoded by the same gene or replicates of the same genome. Members can differ in celular location, sequence features and bound partners. Currently conformational states (such as hairpin) are not covered.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#RnaRegion -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegion">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#entityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegion"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A region on a RNA molecule.
Usage: RNARegion is not a pool of independent molecules but a subregion on these molecules. As such, every RNARegion has a defining RNA molecule.
Examples: CDS, 3' UTR, Hairpin</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#subRegion"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#RnaRegionReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A RNARegion reference is a grouping of several RNARegion entities that are common in sequence and genomic position. Members can differ in celular location, sequence features, mutations and bound partners.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Score -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Score">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#value"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A score associated with a publication reference describing how the score was determined, the name of the method and a comment briefly describing the method.
Usage: The xref must contain at least one publication that describes the method used to determine the score value. There is currently no standard way of describing values, so any string is valid.
Examples: The statistical significance of a result, e.g. "p<0.05".</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#SequenceInterval -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#SequenceInterval">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceSite"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An interval on a sequence.
Usage: Interval is defined as an ordered pair of SequenceSites. All of the sequence from the begin site to the end site (inclusive) is described, not any subset.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#SequenceLocation -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A location on a nucleotide or amino acid sequence.
Usage: For most purposes it is more appropriate to use subclasses of this class. Direct instances of SequenceLocation can be used for uknown locations that can not be classified neither as an interval nor a site.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#SequenceModificationVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definiiton: A reference to the PSI Molecular Interaction ontology (MI) of covalent sequence modifications. Homepage at http://www.psidev.info/. Browse at http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=MI&termId=MI%3A0252&termName=biological%20feature. Only children that are covelent modifications at specific positions can be used.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#SequenceRegionVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference to a controlled vocabulary of sequence regions, such as InterPro or Sequence Ontology (SO). Homepage at http://www.sequenceontology.org/. Browse at http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=SO</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#SequenceSite -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#SequenceSite">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SequenceLocation"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: Describes a site on a sequence, i.e. the position of a single nucleotide or amino acid.
Usage: A sequence site is always defined based on the reference sequence of the owning entity. For DNARegion and RNARegion it is relative to the region itself not the genome or full RNA molecule.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#SmallMolecule -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#feature"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BindingFeature"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#notFeature"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BindingFeature"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#entityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberPhysicalEntity"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMolecule"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A pool of molecules that are neither complexes nor are genetically encoded.
Rationale: Identity of small molecules are based on structure, rather than sequence as in the case of DNA, RNA or Protein. A small molecule reference is a grouping of several small molecule entities that have the same chemical structure.
Usage : Smalle Molecules can have a cellular location and binding features. They can't have modification features as covalent modifications of small molecules are not considered as state changes but treated as different molecules.
Some non-genomic macromolecules, such as large complex carbohydrates are currently covered by small molecules despite they lack a static structure. Better coverage for such molecules require representation of generic stoichiometry and polymerization, currently planned for BioPAX level 4.
Examples: glucose, penicillin, phosphatidylinositol</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#EntityReference"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#memberEntityReference"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#SmallMoleculeReference"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:comment rdf:datatype="&xsd;string">A small molecule reference is a grouping of several small molecule entities that have the same chemical structure. Members can differ in celular location and bound partners. Covalent modifications of small molecules are not considered as state changes but treated as different molecules.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Stoichiometry -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Stoichiometry">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#stoichiometricCoefficient"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#physicalEntity"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<owl:disjointWith rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: Stoichiometric coefficient of a physical entity in the context of a conversion or complex.
Usage: For each participating element there must be 0 or 1 stoichiometry element. A non-existing stoichiometric element is treated as unknown.
This is an n-ary bridge for left, right and component properties. Relative stoichiometries ( e.g n, n+1) often used for describing polymerization is not supported.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#TemplateReaction -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#TemplateReaction">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Interaction"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#participant"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:comment rdf:datatype="&xsd;string">Definiton: An interaction where a macromolecule is polymerized from a
template macromolecule.
Rationale: This is an abstraction over multiple (not explicitly stated) biochemical
reactions. The ubiquitous molecules (NTP and amino acids) consumed are also usually
omitted. Template reaction is non-stoichiometric, does not obey law of
mass conservation and temporally non-atomic. It, however, provides a
mechanism to capture processes that are central to all living organisms.
Usage: Regulation of TemplateReaction, e.g. via a transcription factor can be
captured using TemplateReactionRegulation. TemplateReaction can also be
indirect for example, it is not necessary to represent intermediary mRNA
for describing expression of a protein. It was decided to not subclass
TemplateReaction to subtypes such as transcription of translation for the
sake of simplicity. If needed these subclasses can be added in the
future.
Examples: Transcription, translation, replication, reverse transcription. E.g.
DNA to RNA is transcription, RNA to protein is translation and DNA to
protein is protein expression from DNA.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#TemplateReactionRegulation -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#TemplateReactionRegulation">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Control"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#controlled"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TemplateReaction"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#controlType"/>
<owl:allValuesFrom>
<rdfs:Datatype>
<owl:oneOf>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">ACTIVATION</rdf:first>
<rdf:rest>
<rdf:Description>
<rdf:type rdf:resource="&rdf;List"/>
<rdf:first rdf:datatype="&xsd;string">INHIBITION</rdf:first>
<rdf:rest rdf:resource="&rdf;nil"/>
</rdf:Description>
</rdf:rest>
</rdf:Description>
</owl:oneOf>
</rdfs:Datatype>
</owl:allValuesFrom>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#controller"/>
<owl:allValuesFrom rdf:resource="http://www.biopax.org/release/biopax-level3.owl#PhysicalEntity"/>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:comment rdf:datatype="&xsd;string">Definition: Regulation of an expression reaction by a controlling element such as a transcription factor or microRNA.
Usage: To represent the binding of the transcription factor to a regulatory element in the TemplateReaction, create a complex of the transcription factor and the regulatory element and set that as the controller.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#TissueVocabulary">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#ControlledVocabulary"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference to the BRENDA (BTO). Homepage at http://www.brenda-enzymes.info/. Browse at http://www.ebi.ac.uk/ontology-lookup/browse.do?ontName=BTO</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Transport -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Transport">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Conversion"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: An conversion in which molecules of one or more physicalEntity pools change their subcellular location and become a member of one or more other physicalEntity pools. A transport interaction does not include the transporter entity, even if one is required in order for the transport to occur. Instead, transporters are linked to transport interactions via the catalysis class.
Usage: If there is a simultaneous chemical modification of the participant(s), use transportWithBiochemicalReaction class.
Synonyms: translocation.
Examples: The movement of Na+ into the cell through an open voltage-gated channel.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#TransportWithBiochemicalReaction -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#TransportWithBiochemicalReaction">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction"/>
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Transport"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A conversion interaction that is both a biochemicalReaction and a transport. In transportWithBiochemicalReaction interactions, one or more of the substrates changes both their location and their physical structure. Active transport reactions that use ATP as an energy source fall under this category, even if the only covalent change is the hydrolysis of ATP to ADP.
Rationale: This class was added to support a large number of transport events in pathway databases that have a biochemical reaction during the transport process. It is not expected that other double inheritance subclasses will be added to the ontology at the same level as this class.
Examples: In the PEP-dependent phosphotransferase system, transportation of sugar into an E. coli cell is accompanied by the sugar's phosphorylation as it crosses the plasma membrane.</rdfs:comment>
</owl:Class>
<owl:Axiom>
<disponte:probability rdf:datatype="&xsd;decimal">0.9</disponte:probability>
<owl:annotatedTarget rdf:resource="http://www.biopax.org/release/biopax-level3.owl#BiochemicalReaction"/>
<owl:annotatedSource rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TransportWithBiochemicalReaction"/>
<owl:annotatedProperty rdf:resource="&rdfs;subClassOf"/>
</owl:Axiom>
<owl:Axiom>
<disponte:probability rdf:datatype="&xsd;decimal">0.8</disponte:probability>
<owl:annotatedTarget rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Transport"/>
<owl:annotatedSource rdf:resource="http://www.biopax.org/release/biopax-level3.owl#TransportWithBiochemicalReaction"/>
<owl:annotatedProperty rdf:resource="&rdfs;subClassOf"/>
</owl:Axiom>
<!-- http://www.biopax.org/release/biopax-level3.owl#UnificationXref -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#UnificationXref">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#Xref"/>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#db"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:subClassOf>
<owl:Restriction>
<owl:onProperty rdf:resource="http://www.biopax.org/release/biopax-level3.owl#id"/>
<owl:cardinality rdf:datatype="&xsd;nonNegativeInteger">1</owl:cardinality>
</owl:Restriction>
</rdfs:subClassOf>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A unification xref defines a reference to an entity in an external resource that has the same biological identity as the referring entity
Rationale: Unification xrefs are critically important for data integration. In the future they may be replaced by direct miriam links and rdf:id based identity management.
Usage: For example, if one wished to link from a database record, C, describing a chemical compound in a BioPAX data collection to a record, C', describing the same chemical compound in an external database, one would use a unification xref since records C and C' describe the same biological identity. Generally, unification xrefs should be used whenever possible, although there are cases where they might not be useful, such as application to application data exchange.Identity of interactions can be computed based on the identity of its participants. An xref in a protein pointing to a gene, e.g. in the LocusLink database17, would not be a unification xref since the two entities do not have the same biological identity (one is a protein, the other is a gene). Instead, this link should be a captured as a relationship xref. References to an external controlled vocabulary term within the OpenControlledVocabulary class should use a unification xref where possible (e.g. GO:0005737).
Examples: An xref in a protein instance pointing to an entry in the Swiss-Prot database, and an xref in an RNA instance pointing to the corresponding RNA sequence in the RefSeq database..</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#UtilityClass -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#UtilityClass">
<rdfs:comment rdf:datatype="&xsd;string">Definition: This is a placeholder for classes, used for annotating the "Entity" and its subclasses. Mostly, these are not an "Entity" themselves. Examples include references to external databases, controlled vocabularies, evidence and provenance.
Rationale: Utility classes are created when simple slots are insufficient to describe an aspect of an entity or to increase compatibility of this ontology with other standards.
Usage: The utilityClass class is actually a metaclass and is only present to organize the other helper classes under one class hierarchy; instances of utilityClass should never be created.</rdfs:comment>
</owl:Class>
<!-- http://www.biopax.org/release/biopax-level3.owl#Xref -->
<owl:Class rdf:about="http://www.biopax.org/release/biopax-level3.owl#Xref">
<rdfs:subClassOf rdf:resource="http://www.biopax.org/release/biopax-level3.owl#UtilityClass"/>
<rdfs:comment rdf:datatype="&xsd;string">Definition: A reference from an instance of a class in this ontology to an object in an external resource.
Rationale: Xrefs in the future can be removed in the future in favor of explicit miram links.
Usage: For most cases one of the subclasses of xref should be used.</rdfs:comment>
</owl:Class>
</rdf:RDF>
<!-- Generated by the OWL API (version 3.5.0) http://owlapi.sourceforge.net -->
').
| 68.878422 | 1,159 | 0.693194 |
ed40ecdc7a01845d018991bc3c25e96b5355117b | 567 | pl | Perl | windows10/git-bash-zsh/usr/share/perl5/core_perl/unicore/lib/Nv/700.pl | Allen-LPL/dotfiles | 9bc894fc6c9d32b1a0c84812c66fb5133484eff4 | [
"MIT"
]
| 1,318 | 2019-07-11T10:34:39.000Z | 2022-03-29T15:05:19.000Z | windows10/git-bash-zsh/usr/share/perl5/core_perl/unicore/lib/Nv/700.pl | Allen-LPL/dotfiles | 9bc894fc6c9d32b1a0c84812c66fb5133484eff4 | [
"MIT"
]
| 387 | 2019-09-05T16:33:09.000Z | 2022-03-31T10:43:39.000Z | windows10/git-bash-zsh/usr/share/perl5/core_perl/unicore/lib/Nv/700.pl | Allen-LPL/dotfiles | 9bc894fc6c9d32b1a0c84812c66fb5133484eff4 | [
"MIT"
]
| 66 | 2019-11-11T15:33:12.000Z | 2022-03-01T07:55:55.000Z | # !!!!!!! DO NOT EDIT THIS FILE !!!!!!!
# This file is machine-generated by lib/unicore/mktables from the Unicode
# database, Version 13.0.0. Any changes made here will be lost!
# !!!!!!! INTERNAL PERL USE ONLY !!!!!!!
# This file is for internal use by core Perl only. The format and even the
# name or existence of this file are subject to change without notice. Don't
# use it directly. Use Unicode::UCD to access the Unicode character data
# base.
return <<'END';
V12
65823
65824
66297
66298
68056
68057
69240
69241
126089
126090
126233
126234
END
| 21 | 77 | 0.705467 |
ed454996e5b441ed16b0a8c978dca58c1df9b2c4 | 22,799 | pm | Perl | modules/EnsEMBL/Web/Document/Image.pm | nerdstrike/ensembl-webcode | ab69513124329e1b2d686c7d2c9f1d7689996a0b | [
"Apache-2.0",
"MIT"
]
| null | null | null | modules/EnsEMBL/Web/Document/Image.pm | nerdstrike/ensembl-webcode | ab69513124329e1b2d686c7d2c9f1d7689996a0b | [
"Apache-2.0",
"MIT"
]
| null | null | null | modules/EnsEMBL/Web/Document/Image.pm | nerdstrike/ensembl-webcode | ab69513124329e1b2d686c7d2c9f1d7689996a0b | [
"Apache-2.0",
"MIT"
]
| null | null | null | =head1 LICENSE
Copyright [1999-2013] Wellcome Trust Sanger Institute and the EMBL-European Bioinformatics Institute
Licensed under the Apache License, Version 2.0 (the "License");
you may not use this file except in compliance with the License.
You may obtain a copy of the License at
http://www.apache.org/licenses/LICENSE-2.0
Unless required by applicable law or agreed to in writing, software
distributed under the License is distributed on an "AS IS" BASIS,
WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
See the License for the specific language governing permissions and
limitations under the License.
=cut
# $Id$
package EnsEMBL::Web::Document::Image;
use strict;
use POSIX qw(ceil);
use Bio::EnsEMBL::VDrawableContainer;
use EnsEMBL::Web::TmpFile::Image;
sub new {
my ($class, $hub, $component, $image_configs) = @_;
my $self = {
hub => $hub,
component => $component,
image_configs => $image_configs || [],
drawable_container => undef,
centred => 0,
imagemap => 'no',
image_type => 'image',
image_name => undef,
introduction => undef,
tailnote => undef,
caption => undef,
button_title => undef,
button_name => undef,
button_id => undef,
format => 'png',
};
if ($image_configs) {
$self->{'toolbars'}{$_} = $image_configs->[0]->toolbars->{$_} for qw(top bottom);
}
bless $self, $class;
return $self;
}
sub hub :lvalue { $_[0]->{'hub'}; }
sub component :lvalue { $_[0]->{'component'}; }
sub drawable_container :lvalue { $_[0]->{'drawable_container'}; }
sub centred :lvalue { $_[0]->{'centred'}; }
sub imagemap :lvalue { $_[0]->{'imagemap'}; }
sub button :lvalue { $_[0]->{'button'}; }
sub button_id :lvalue { $_[0]->{'button_id'}; }
sub button_name :lvalue { $_[0]->{'button_name'}; }
sub button_title :lvalue { $_[0]->{'button_title'}; }
sub image_type :lvalue { $_[0]->{'image_type'}; }
sub image_name :lvalue { $_[0]->{'image_name'}; }
sub introduction :lvalue { $_[0]->{'introduction'}; }
sub tailnote :lvalue { $_[0]->{'tailnote'}; }
sub caption :lvalue { $_[0]->{'caption'}; }
sub format :lvalue { $_[0]->{'format'}; }
sub toolbars :lvalue { $_[0]->{'toolbars'}; }
sub image_width { return $_[0]->{'image_configs'}[0]->get_parameter('image_width'); }
sub has_toolbars { return 1 if ($_[0]->{'toolbars'}{'top'} || $_[0]->{'toolbars'}{'bottom'}); }
sub render_toolbar {
my ($self, $height) = @_;
my $icon_mapping = EnsEMBL::Web::Constants::ICON_MAPPINGS('image');
return unless $icon_mapping;
my ($toolbar, $export, $top, $bottom, $image_resize, $image_sizes);
my $hub = $self->hub;
my $component = $self->component;
## Config panel link
if ($hub->get_viewconfig($component)) {
my $config_url = $hub->url('Config', { action => $component, function => undef });
my $data_url = $hub->url({ type => 'UserData', action => 'ManageData', function => undef });
my $share_url = $hub->url('Share', { action => $component, function => undef, __clear => 1, create => 1, share_type => 'image', time => time });
$toolbar .= sprintf '<a href="%s" class="config modal_link force" title="%s" rel="modal_config_%s"></a>', $config_url, $icon_mapping->{'config'}{'title'}, lc $component;
$toolbar .= qq(<a href="$data_url" class="data modal_link" title="$icon_mapping->{'userdata'}{'title'}" rel="modal_user_data"></a>) if $self->{'image_configs'}[0]->get_node('user_data');
$toolbar .= qq(<a href="$share_url" class="share popup" title="$icon_mapping->{'share'}{'title'}"></a>);
}
## Increase/decrease image size icon
if (grep $_->image_resize, @{$self->{'image_configs'}}) {
my $resize_url = $hub->url;
# add best fit option
$image_sizes .= qq{<div><a href="$resize_url" class="image_resize"><div>Best Fit</div></a></div>};
# get current image_width and provide size of +- 100 three times
for (my $counter = ($self->image_width-300);$counter <= ($self->image_width+300); $counter+=100) {
my $selected_size = 'class="current"' if($counter eq $self->image_width);
my $hidden_width = ($counter < 500) ? "style='display:none'" : '';
$image_sizes .= qq{<div $hidden_width><a href="$resize_url" class="image_resize"><div $selected_size>$counter px</div></a></div>};
}
$image_resize = qq{
<div class="toggle image_resize_menu">
<div class="header">Resize image to:</div>
$image_sizes
</div>
};
$toolbar .= qq{<a href="$resize_url" class="resize popup" title="Resize this image"></a>};
}
## Image export popup menu
if ($self->{'export'}) {
my @formats = (
{ f => 'pdf', label => 'PDF'},
{ f => 'svg', label => 'SVG' },
{ f => 'eps', label => 'PostScript' },
{ f => 'png-5', label => 'PNG (x5)' },
{ f => 'png-2', label => 'PNG (x2)' },
{ f => 'png', label => 'PNG' },
{ f => 'png-0.5', label => 'PNG (x0.5)' },
{ f => 'gff', label => 'Text (GFF)', text => 1 }
);
splice @formats, 3, 0, { f => 'png-10', label => 'PNG (x10)' } unless $height > 32000; ## PNG renderer will crash if image too tall!
my $url = $ENV{'REQUEST_URI'};
$url =~ s/;$//;
$url .= ($url =~ /\?/ ? ';' : '?') . 'export=';
foreach (@formats) {
my $href = $url . $_->{'f'};
if ($_->{'text'}) {
next if $self->{'export'} =~ /no_text/;
$export .= qq{<div><div>$_->{'label'}</div><a href="$href;download=1"><img src="/i/16/download.png" alt="download" title="Download" /></a></div>};
} elsif ($_->{'f'} eq 'pdf') {
# option not to include pdf export
next if $self->{'export'} =~ /no_pdf/;
$export .= qq{
<div>
<div>$_->{'label'}</div>
<a class="view" href="$href" rel="external"><img src="/i/16/eye.png" alt="view" title="View image" /></a>
<a href="$href;download=1"><img src="/i/16/download.png" alt="download" title="Download" /></a>
</div>
};
}else {
$export .= qq{
<div>
<div>$_->{'label'}</div>
<a class="view" href="$href" rel="external"><img src="/i/16/eye.png" alt="view" title="View image" /></a>
<a href="$href;download=1"><img src="/i/16/download.png" alt="download" title="Download" /></a>
</div>
};
}
}
$export = qq{
<div class="toggle iexport_menu">
<div class="header">Export as:</div>
$export
</div>
};
$toolbar .= sprintf '<a href="%spdf" class="export popup %s" title="%s"></a>', $url, $self->{'export'}, $icon_mapping->{'image'}{'title'};
}
if ($toolbar) {
$top = $self->toolbars->{'top'} ? qq{<div class="image_toolbar top print_hide">$toolbar</div>$export$image_resize} : '';
$bottom = ($self->toolbars->{'bottom'} || $height > 999) ? sprintf '<div class="image_toolbar bottom print_hide">%s</div>%s', $toolbar, $top ? '' : "$export$image_resize" : '';
}
return ($top, $bottom);
}
#----------------------------------------------------------------------------
# FUNCTIONS FOR CONFIGURING AND CREATING KARYOTYPE IMAGES
#----------------------------------------------------------------------------
sub karyotype {
my ($self, $hub, $object, $highs, $config_name) = @_;
my @highlights = ref($highs) eq 'ARRAY' ? @$highs : ($highs);
$config_name ||= 'Vkaryotype';
my $chr_name;
my $image_config = $hub->get_imageconfig($config_name);
# set some dimensions based on number and size of chromosomes
if ($image_config->get_parameter('all_chromosomes') eq 'yes') {
my $total_chrs = @{$hub->species_defs->ENSEMBL_CHROMOSOMES};
my $rows = $hub->param('rows') || ceil($total_chrs / 18);
my $chr_length = $hub->param('chr_length') || 200;
$chr_name = 'ALL';
if ($chr_length) {
$image_config->set_parameters({
image_height => $chr_length,
image_width => $chr_length + 25,
});
}
$image_config->set_parameters({
container_width => $hub->species_defs->MAX_CHR_LENGTH,
rows => $rows,
slice_number => '0|1',
});
} else {
$chr_name = $object->seq_region_name if $object;
my $seq_region_length = $object ? $object->seq_region_length : '';
$image_config->set_parameters({
container_width => $seq_region_length,
slice_number => '0|1'
});
$image_config->{'_rows'} = 1;
}
$image_config->{'_aggregate_colour'} = $hub->param('aggregate_colour') if $hub->param('aggregate_colour');
# get some adaptors for chromosome data
my ($sa, $ka, $da);
my $species = $hub->param('species') || $hub->species;
return unless $species;
my $db = $hub->databases->get_DBAdaptor('core', $species);
eval {
$sa = $db->get_SliceAdaptor,
$ka = $db->get_KaryotypeBandAdaptor,
$da = $db->get_DensityFeatureAdaptor
};
return $@ if $@;
# create the container object and add it to the image
$self->drawable_container = Bio::EnsEMBL::VDrawableContainer->new({
web_species => $species,
sa => $sa,
ka => $ka,
da => $da,
chr => $chr_name,
format => $hub->param('export')
}, $image_config, \@highlights) if($hub->param('_format') ne 'Excel');
return undef; # successful
}
sub add_pointers {
my ($self, $hub, $extra) = @_;
my $config_name = $extra->{'config_name'};
my @data = @{$extra->{'features'}};
my $species = $hub->species;
my $color = lc($extra->{'color'} || $hub->param('col')) || 'red'; # set sensible defaults
my $style = lc($extra->{'style'} || $hub->param('style')) || 'rharrow'; # set style before doing chromosome layout, as layout may need tweaking for some pointer styles
my $high = { style => $style };
my ($p_value_sorted, $max_colour);
my $i = 1;
# colour gradient
my @gradient = @{$extra->{'gradient'} || []};
if ($color eq 'gradient' && scalar @gradient) {
my @colour_scale = $hub->colourmap->build_linear_gradient(@gradient); # making an array of the colour scale
foreach my $colour (@colour_scale) {
$p_value_sorted->{$i} = $colour;
$i = sprintf("%.1f", $i + 0.1);
$max_colour = $colour;
}
}
foreach my $row (@data) {
my $chr = $row->{'chr'} || $row->{'region'};
my $point = {
start => $row->{'start'},
end => $row->{'end'},
id => $row->{'label'},
col => $p_value_sorted->{sprintf("%.1f", $row->{'p_value'})} || $max_colour || $color,
href => $row->{'href'},
html_id => $row->{'html_id'} || '',
};
push @{$high->{$chr}}, $point;
}
return $high;
}
sub set_button {
my ($self, $type, %pars) = @_;
$self->button = $type;
$self->{'button_id'} = $pars{'id'} if exists $pars{'id'};
$self->{'button_name'} = $pars{'id'} if exists $pars{'id'};
$self->{'button_name'} = $pars{'name'} if exists $pars{'name'};
$self->{'URL'} = $pars{'URL'} if exists $pars{'URL'};
$self->{'hidden'} = $pars{'hidden'} if exists $pars{'hidden'};
$self->{'button_title'} = $pars{'title'} if exists $pars{'title'};
$self->{'hidden_extra'} = $pars{'extra'} if exists $pars{'extra'};
}
####################################################################################################
#
# Renderers
#
####################################################################################################
# Having a usemap causes drag selecting to become a real pain, so disabled
sub extra_html {
my $self = shift;
my $class = 'imagemap' . ($self->drawable_container->isa('Bio::EnsEMBL::VDrawableContainer') ? ' vertical' : '');
my $extra = qq{class="$class"};
# if ($self->imagemap eq 'yes') {
# my $map_name = $self->{'token'};
# $extra .= qq{usemap="#$map_name" };
# }
return $extra;
}
sub extra_style {
my $self = shift;
return $self->{'border'} ? sprintf('border: %s %dpx %s;', $self->{'border_colour'} || '#000', $self->{'border'}, $self->{'border_style'} || 'solid') : '';
}
sub render_image_tag {
my ($self, $image) = @_;
my $url = $image->URL;
my $width = $image->width;
my $height = $image->height;
my $html;
if ($width > 5000) {
$html = qq{
<p style="text-align:left">
The image produced was $width pixels wide,
which may be too large for some web browsers to display.
If you would like to see the image, please right-click (MAC: Ctrl-click)
on the link below and choose the 'Save Image' option from the pop-up menu.</p>
<p><a href="$url">Image download</a></p>
};
} else {
$html = sprintf(
'<img src="%s" alt="" style="width: %dpx; height: %dpx; %s display: block" %s />',
$url,
$width,
$height,
$self->extra_style,
$self->extra_html
);
$self->{'width'} = $width;
$self->{'height'} = $height;
}
return $html;
}
sub render_image_button {
my ($self, $image) = @_;
return sprintf(
'<input style="width: %dpx; height: %dpx; %s display: block" type="image" name="%s" src="%s" alt="%s" title="%s" %s />',
$image->width,
$image->height,
$self->extra_style,
$self->{'button_name'},
$image->URL,
$self->{'button_title'},
$self->{'button_title'}
);
}
sub render_image_map {
my ($self, $image) = @_;
my $imagemap = $self->drawable_container->render('imagemap');
my $map_name = $image->token;
my $map = qq{
<map name="$map_name">
$imagemap
</map>
};
$map .= '<input type="hidden" class="panel_type" value="ImageMap" />';
return $map;
}
sub hover_labels {
my $self = shift;
my $img_url = $self->hub->species_defs->img_url;
my ($html, %done);
foreach my $label (map values %{$_->{'hover_labels'} || {}}, @{$self->{'image_configs'}}) {
next if $done{$label->{'class'}};
my $desc = join '', map "<p>$_</p>", split /; /, $label->{'desc'};
my $subset = $label->{'subset'};
my $renderers;
foreach (@{$label->{'renderers'}}) {
my $text = $_->{'text'};
if ($_->{'current'}) {
$renderers .= qq(<li class="current"><img src="${img_url}render/$_->{'val'}.gif" alt="$text" title="$text" /><img src="${img_url}tick.png" class="tick" alt="Selected" title="Selected" /> $text</li>);
} else {
$renderers .= qq(<li><a href="$_->{'url'}" class="config" rel="$label->{'component'}"><img src="${img_url}render/$_->{'val'}.gif" alt="$text" title="$text" /> $text</a></li>);
}
}
$renderers .= qq{<li class="subset subset_$subset->[0]"><a class="modal_link force" href="$subset->[1]#$subset->[0]" rel="$subset->[2]"><img src="${img_url}16/setting.png" /> Configure track options</a></li>} if $subset;
$html .= sprintf(qq(
<div class="hover_label floating_popup %s">
<p class="header">%s</p>
%s
%s
%s
<a href="$label->{'fav'}[1]" class="config favourite%s" rel="$label->{'component'}" title="Favourite track"></a>
<a href="$label->{'off'}" class="config" rel="$label->{'component'}"><img src="${img_url}16/cross.png" alt="Turn track off" title="Turn track off" /></a>
<div class="desc">%s</div>
<div class="config">%s</div>
<div class="url">%s</div>
<div class="spinner"></div>
</div>),
$label->{'class'},
$label->{'header'},
$label->{'desc'} ? qq(<img class="desc" src="${img_url}16/info.png" alt="Info" title="Info" />) : '',
$renderers ? qq(<img class="config" src="${img_url}16/setting.png" alt="Change track style" title="Change track style" />) : '',
$label->{'conf_url'} ? qq(<img class="url" src="${img_url}16/link.png" alt="Link" title="URL to turn this track on" />) : '',
$label->{'fav'}[0] ? ' selected' : '',
$desc,
$renderers ? qq(<p>Change track style:</p><ul>$renderers</ul>) : '',
$label->{'conf_url'} ? qq(<p>Copy <a href="$label->{'conf_url'}">this link</a> to force this track to be turned on</p>) : ''
);
}
return $html;
}
sub track_boundaries {
my $self = shift;
my $container = $self->drawable_container;
my $config = $container->{'config'};
my $spacing = $config->get_parameter('spacing');
my $top = $config->get_parameter('margin') * 2 - $spacing;
my @sortable_tracks = grep { $_->get('display') ne 'off' } $config->get_sortable_tracks;
my %track_ids = map { $_->id => 1 } @sortable_tracks;
my %strand_map = ( f => 1, r => -1 );
my @boundaries;
foreach my $glyphset (@{$container->{'glyphsets'}}) {
next unless scalar @{$glyphset->{'glyphs'}};
my $height = $glyphset->height + $spacing;
my $type = $glyphset->type;
my $node;
if ($track_ids{$type}) {
while (scalar @sortable_tracks) {
my $track = $sortable_tracks[0];
my $strand = $track->get('drawing_strand');
last if $type eq $track->id && (($strand && $strand_map{$strand} == $glyphset->strand) || !$strand);
shift @sortable_tracks;
}
$node = shift @sortable_tracks;
}
push @boundaries, [ $top, $height, $type, $node->get('drawing_strand'), $node->get('order') ] if $node && $node->get('sortable') && !scalar keys %{$glyphset->{'tags'}};
$top += $height;
}
return \@boundaries;
}
sub moveable_tracks {
my ($self, $image) = @_;
my $config = $self->drawable_container->{'config'};
return unless $config->get_parameter('sortable_tracks') eq 'drag';
my $species = $config->species;
my $url = $image->URL;
my ($top, $html);
foreach (@{$self->track_boundaries}) {
my ($t, $h, $type, $strand, $order) = @$_;
$html .= sprintf(
'<li class="%s%s" style="height:%spx;background:url(%s) 0 %spx%s">
<p class="handle" style="height:%spx"%s></p>
<i class="%s"></i>
</li>',
$type, $strand ? " $strand" : '',
$h, $url, 3 - $t,
$h == 0 ? ';display:none' : '',
$h - 1,
$strand ? sprintf(' title="%s strand"', $strand eq 'f' ? 'Forward' : 'Reverse') : '',
$order
);
$top ||= $t - 3 if $h;
}
return qq(<div class="boundaries_wrapper" style="top:${top}px"><div class="up"></div><ul class="$species boundaries">$html</ul><div class="down"></div></div>) if $html;
}
sub render {
my ($self, $format) = @_;
return unless $self->drawable_container;
if ($format) {
print $self->drawable_container->render($format);
return;
}
my $html = $self->introduction;
my $image = EnsEMBL::Web::TmpFile::Image->new;
my $content = $self->drawable_container->render('png');
my $caption_style = 'image-caption';
$image->content($content);
$image->save;
my ($top_toolbar, $bottom_toolbar) = $self->has_toolbars ? $self->render_toolbar($image->height) : ();
if ($self->button eq 'form') {
my $image_html = $self->render_image_button($image);
my $inputs;
$self->{'hidden'}{'total_height'} = $image->height;
$image_html .= sprintf '<div class="%s">%s</div>', $caption_style, $self->caption if $self->caption;
foreach (keys %{$self->{'hidden'}}) {
$inputs .= sprintf(
'<input type="hidden" name="%s" id="%s%s" value="%s" />',
$_,
$_,
$self->{'hidden_extra'} || $self->{'counter'},
$self->{'hidden'}{$_}
);
}
$html .= sprintf(
$self->centred ?
'<div class="autocenter_wrapper"><form style="width:%spx" class="autocenter" action="%s" method="get"><div>%s</div><div class="autocenter">%s</div></form></div>' :
'<form style="width:%spx" action="%s" method="get"><div>%s</div>%s%s%s</form>',
$image->width,
$self->{'URL'},
$inputs,
$top_toolbar,
$image_html,
$bottom_toolbar,
);
$self->{'counter'}++;
} elsif ($self->button eq 'yes') {
$html .= $self->render_image_button($image);
$html .= sprintf '<div class="%s">%s</div>', $caption_style, $self->caption if $self->caption;
} elsif ($self->button eq 'drag') {
my $img = $self->render_image_tag($image);
# continue with tag html
# This has to have a vertical padding of 0px as it is used in a number of places
# butted up to another container - if you need a vertical padding of 10px add it
# outside this module
my $wrapper = sprintf('
%s
<div class="drag_select" style="margin:%s;">
%s
%s
%s
%s
</div>
%s',
$top_toolbar,
$self->centred ? '0px auto' : '0px',
$img,
$self->imagemap eq 'yes' ? $self->render_image_map($image) : '',
$self->moveable_tracks($image),
$self->hover_labels,
$bottom_toolbar,
);
my $template = $self->centred ? '
<div class="image_container" style="width:%spx;text-align:center">
<div style="text-align:center;margin:auto">
%s
%s
</div>
</div>
' : '
<div class="image_container" style="width:%spx">
%s
%s
</div>
%s
';
$html .= sprintf $template, $image->width, $wrapper, $self->caption ? sprintf '<div class="%s">%s</div>', $caption_style, $self->caption : '';
} else {
$html .= join('',
$self->render_image_tag($image),
$self->imagemap eq 'yes' ? $self->render_image_map($image) : '',
$self->moveable_tracks($image),
$self->hover_labels,
$self->caption ? sprintf('<div class="%s">%s</div>', $caption_style, $self->caption) : ''
);
}
$html .= $self->tailnote;
if ($self->{'image_configs'}[0]) {
$html .= qq(<input type="hidden" class="image_config" value="$self->{'image_configs'}[0]{'type'}" />);
$html .= '<span class="hidden drop_upload"></span>' if $self->{'image_configs'}[0]->get_node('user_data');
}
$self->{'width'} = $image->width;
$self->hub->species_defs->timer_push('Image->render ending', undef, 'draw');
return $html;
}
1;
| 34.807634 | 224 | 0.536295 |
ed2d2bcf0f2c7d7484e9c08914ed41da2fbc001a | 871 | pm | Perl | lib/Effect/ImageService/Plugin/Set.pm | Archeia/Effect-Games | 163d20c8ee1482b260143109ff4bcaf737b4b33e | [
"MIT"
]
| 264 | 2015-01-14T02:30:31.000Z | 2022-03-09T02:30:51.000Z | lib/Effect/ImageService/Plugin/Set.pm | kinvix/Effect-Games | 163d20c8ee1482b260143109ff4bcaf737b4b33e | [
"MIT"
]
| 1 | 2018-03-13T18:48:32.000Z | 2021-09-27T00:54:56.000Z | lib/Effect/ImageService/Plugin/Set.pm | kinvix/Effect-Games | 163d20c8ee1482b260143109ff4bcaf737b4b33e | [
"MIT"
]
| 78 | 2015-03-27T16:45:29.000Z | 2021-12-27T07:50:09.000Z | package Effect::ImageService::Plugin::Set;
# Effect Games Engine and IDE v1.0
# Copyright (c) 2005 - 2011 Joseph Huckaby
# Source Code released under the MIT License:
# http://www.opensource.org/licenses/mit-license.php
use strict;
use XML::API::Tools;
use Effect::ImageService::Plugin;
our @ISA = ("Effect::ImageService::Plugin");
sub handler {
##
# Handle image transform
# Params passed directly to ImageMagick Set()
##
my $self = shift;
my $img = $self->{session}->{media_handle};
if (!$img) { die "Set transform requires pre-generated media handle"; }
if ($self->{params}->{Format}) {
$self->{params}->{Magick} = $self->{params}->{Format};
delete $self->{params}->{Format};
}
$self->log_debug(4, "Setting image attributes: " . serialize_object($self->{params}) );
my $error = $img->Set( %{$self->{params}} );
die $error if $error;
}
1;
| 24.194444 | 88 | 0.662457 |
ed36f546776617ea53f11874ce1d9215824003ed | 3,018 | pl | Perl | data/processed/survey_0.75_0.5_150_result.pl | VincentDerk/Paper-AC-Decisions-Learning | abd1dc8893fbb11b43ebb49a25e26c0183bdba62 | [
"Apache-2.0"
]
| null | null | null | data/processed/survey_0.75_0.5_150_result.pl | VincentDerk/Paper-AC-Decisions-Learning | abd1dc8893fbb11b43ebb49a25e26c0183bdba62 | [
"Apache-2.0"
]
| null | null | null | data/processed/survey_0.75_0.5_150_result.pl | VincentDerk/Paper-AC-Decisions-Learning | abd1dc8893fbb11b43ebb49a25e26c0183bdba62 | [
"Apache-2.0"
]
| null | null | null | body_1(0,multi) :- true.
body_20(19,multi) :- true.
body_36(33,multi) :- a("young"), s("M").
body_52(49,multi) :- a("young"), s("F").
body_67(64,multi) :- a("adult"), s("M").
body_82(79,multi) :- a("adult"), s("F").
body_97(94,multi) :- a("old"), s("M").
body_112(109,multi) :- a("old"), s("F").
body_125(124,multi) :- e("high").
body_139(138,multi) :- e("uni").
body_152(151,multi) :- e("high").
body_166(165,multi) :- e("uni").
body_181(178,multi) :- o("emp"), r("small").
body_202(199,multi) :- o("emp"), r("big").
body_222(219,multi) :- o("self"), r("small").
body_242(239,multi) :- o("self"), r("big").
query(a("old")).
query(t("other")).
query(s("F")).
query(o("emp")).
query(t("car")).
query(a("adult")).
query(e("high")).
query(r("small")).
query(t("train")).
query(a("young")).
query(s("M")).
query(r("big")).
query(e("uni")).
query(o("self")).
utility(\+(a("old")),38).
utility(o("emp"),-19).
utility(r("small"),-27).
utility(s("M"),-50).
utility(r("big"),49).
utility(\+(r("big")),-29).
utility(\+(e("uni")),-25).
body_113(112,multi) :- body_1(0,multi).
body_131(130,multi) :- body_36(33,multi).
body_144(143,multi) :- body_166(165,multi).
body_157(156,multi) :- body_202(199,multi).
body_176(175,multi) :- body_67(64,multi).
body_189(188,multi) :- body_139(138,multi).
body_202(201,multi) :- body_242(239,multi).
body_219(218,multi) :- body_112(109,multi).
body_232(231,multi) :- body_82(79,multi).
body_245(244,multi) :- body_52(49,multi).
body_258(257,multi) :- body_181(178,multi).
body_276(275,multi) :- body_20(19,multi).
body_289(288,multi) :- body_152(151,multi).
body_302(301,multi) :- body_222(219,multi).
body_320(319,multi) :- body_125(124,multi).
body_333(332,multi) :- body_97(94,multi).
utility(a("young"),-9.045763158775554).
utility(o("self"),40.017182953569844).
utility(a("old"),-14.370411319295538).
utility(\+(t("car")),0.249009907629781).
utility(\+(s("F")),33.42802364233007).
utility(t("train"),-7.959346323746481).
utility(e("high"),-44.31557194463744).
utility(\+(a("adult")),-29.416174478071138).
0.25::r("small"); 0.75::r("big") :- body_289(288,multi).
0.48::t("car"); 0.42::t("train"); 0.1::t("other") :- body_258(257,multi).
0.75::e("high"); 0.25::e("uni") :- body_131(130,multi).
0.7::e("high"); 0.3::e("uni") :- body_232(231,multi).
0.7::t("car"); 0.21::t("train"); 0.09::t("other") :- body_202(201,multi).
0.88::e("high"); 0.12::e("uni") :- body_333(332,multi).
0.56::t("car"); 0.36::t("train"); 0.08::t("other") :- body_302(301,multi).
0.2::r("small"); 0.8::r("big") :- body_144(143,multi).
0.3::a("young"); 0.5::a("adult"); 0.2::a("old") :- body_113(112,multi).
0.58::t("car"); 0.24::t("train"); 0.18::t("other") :- body_157(156,multi).
0.6::s("M"); 0.4::s("F") :- body_276(275,multi).
0.64::e("high"); 0.36::e("uni") :- body_245(244,multi).
0.9::e("high"); 0.1::e("uni") :- body_219(218,multi).
0.72::e("high"); 0.28::e("uni") :- body_176(175,multi).
0.92::o("emp"); 0.08::o("self") :- body_189(188,multi).
0.96::o("emp"); 0.04::o("self") :- body_320(319,multi).
| 35.093023 | 74 | 0.604374 |
ed215e19622b4862304306ce3f96d2ffe4c9dd13 | 48,593 | pm | Perl | Source/Manip/TZ/amtiju00.pm | ssp/Pester | f2d8ec2f62bfb83656f77f3ee41b54149287904a | [
"BSD-2-Clause"
]
| 59 | 2015-01-11T18:44:25.000Z | 2022-03-07T22:56:02.000Z | Source/Manip/TZ/amtiju00.pm | ssp/Pester | f2d8ec2f62bfb83656f77f3ee41b54149287904a | [
"BSD-2-Clause"
]
| 11 | 2015-06-19T11:01:00.000Z | 2018-06-05T21:30:17.000Z | Source/Manip/TZ/amtiju00.pm | ssp/Pester | f2d8ec2f62bfb83656f77f3ee41b54149287904a | [
"BSD-2-Clause"
]
| 7 | 2015-09-21T21:04:59.000Z | 2022-02-13T18:26:47.000Z | package #
Date::Manip::TZ::amtiju00;
# Copyright (c) 2008-2014 Sullivan Beck. All rights reserved.
# This program is free software; you can redistribute it and/or modify it
# under the same terms as Perl itself.
# This file was automatically generated. Any changes to this file will
# be lost the next time 'tzdata' is run.
# Generated on: Fri Nov 21 10:41:39 EST 2014
# Data version: tzdata2014j
# Code version: tzcode2014j
# This module contains data from the zoneinfo time zone database. The original
# data was obtained from the URL:
# ftp://ftp.iana.org/tz
use strict;
use warnings;
require 5.010000;
our (%Dates,%LastRule);
END {
undef %Dates;
undef %LastRule;
}
our ($VERSION);
$VERSION='6.48';
END { undef $VERSION; }
%Dates = (
1 =>
[
[ [1,1,2,0,0,0],[1,1,1,16,11,56],'-07:48:04',[-7,-48,-4],
'LMT',0,[1922,1,1,7,59,59],[1922,1,1,0,11,55],
'0001010200:00:00','0001010116:11:56','1922010107:59:59','1922010100:11:55' ],
],
1922 =>
[
[ [1922,1,1,8,0,0],[1922,1,1,1,0,0],'-07:00:00',[-7,0,0],
'MST',0,[1924,1,1,6,59,59],[1923,12,31,23,59,59],
'1922010108:00:00','1922010101:00:00','1924010106:59:59','1923123123:59:59' ],
],
1924 =>
[
[ [1924,1,1,7,0,0],[1923,12,31,23,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1927,6,11,6,59,59],[1927,6,10,22,59,59],
'1924010107:00:00','1923123123:00:00','1927061106:59:59','1927061022:59:59' ],
],
1927 =>
[
[ [1927,6,11,7,0,0],[1927,6,11,0,0,0],'-07:00:00',[-7,0,0],
'MST',0,[1930,11,15,6,59,59],[1930,11,14,23,59,59],
'1927061107:00:00','1927061100:00:00','1930111506:59:59','1930111423:59:59' ],
],
1930 =>
[
[ [1930,11,15,7,0,0],[1930,11,14,23,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1931,4,1,7,59,59],[1931,3,31,23,59,59],
'1930111507:00:00','1930111423:00:00','1931040107:59:59','1931033123:59:59' ],
],
1931 =>
[
[ [1931,4,1,8,0,0],[1931,4,1,1,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1931,9,30,6,59,59],[1931,9,29,23,59,59],
'1931040108:00:00','1931040101:00:00','1931093006:59:59','1931092923:59:59' ],
[ [1931,9,30,7,0,0],[1931,9,29,23,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1942,4,24,7,59,59],[1942,4,23,23,59,59],
'1931093007:00:00','1931092923:00:00','1942042407:59:59','1942042323:59:59' ],
],
1942 =>
[
[ [1942,4,24,8,0,0],[1942,4,24,1,0,0],'-07:00:00',[-7,0,0],
'PWT',1,[1945,8,14,22,59,59],[1945,8,14,15,59,59],
'1942042408:00:00','1942042401:00:00','1945081422:59:59','1945081415:59:59' ],
],
1945 =>
[
[ [1945,8,14,23,0,0],[1945,8,14,16,0,0],'-07:00:00',[-7,0,0],
'PPT',1,[1945,11,12,6,59,59],[1945,11,11,23,59,59],
'1945081423:00:00','1945081416:00:00','1945111206:59:59','1945111123:59:59' ],
[ [1945,11,12,7,0,0],[1945,11,11,23,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1948,4,5,7,59,59],[1948,4,4,23,59,59],
'1945111207:00:00','1945111123:00:00','1948040507:59:59','1948040423:59:59' ],
],
1948 =>
[
[ [1948,4,5,8,0,0],[1948,4,5,1,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1949,1,14,6,59,59],[1949,1,13,23,59,59],
'1948040508:00:00','1948040501:00:00','1949011406:59:59','1949011323:59:59' ],
],
1949 =>
[
[ [1949,1,14,7,0,0],[1949,1,13,23,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1954,4,25,9,59,59],[1954,4,25,1,59,59],
'1949011407:00:00','1949011323:00:00','1954042509:59:59','1954042501:59:59' ],
],
1954 =>
[
[ [1954,4,25,10,0,0],[1954,4,25,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1954,9,26,8,59,59],[1954,9,26,1,59,59],
'1954042510:00:00','1954042503:00:00','1954092608:59:59','1954092601:59:59' ],
[ [1954,9,26,9,0,0],[1954,9,26,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1955,4,24,9,59,59],[1955,4,24,1,59,59],
'1954092609:00:00','1954092601:00:00','1955042409:59:59','1955042401:59:59' ],
],
1955 =>
[
[ [1955,4,24,10,0,0],[1955,4,24,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1955,9,25,8,59,59],[1955,9,25,1,59,59],
'1955042410:00:00','1955042403:00:00','1955092508:59:59','1955092501:59:59' ],
[ [1955,9,25,9,0,0],[1955,9,25,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1956,4,29,9,59,59],[1956,4,29,1,59,59],
'1955092509:00:00','1955092501:00:00','1956042909:59:59','1956042901:59:59' ],
],
1956 =>
[
[ [1956,4,29,10,0,0],[1956,4,29,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1956,9,30,8,59,59],[1956,9,30,1,59,59],
'1956042910:00:00','1956042903:00:00','1956093008:59:59','1956093001:59:59' ],
[ [1956,9,30,9,0,0],[1956,9,30,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1957,4,28,9,59,59],[1957,4,28,1,59,59],
'1956093009:00:00','1956093001:00:00','1957042809:59:59','1957042801:59:59' ],
],
1957 =>
[
[ [1957,4,28,10,0,0],[1957,4,28,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1957,9,29,8,59,59],[1957,9,29,1,59,59],
'1957042810:00:00','1957042803:00:00','1957092908:59:59','1957092901:59:59' ],
[ [1957,9,29,9,0,0],[1957,9,29,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1958,4,27,9,59,59],[1958,4,27,1,59,59],
'1957092909:00:00','1957092901:00:00','1958042709:59:59','1958042701:59:59' ],
],
1958 =>
[
[ [1958,4,27,10,0,0],[1958,4,27,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1958,9,28,8,59,59],[1958,9,28,1,59,59],
'1958042710:00:00','1958042703:00:00','1958092808:59:59','1958092801:59:59' ],
[ [1958,9,28,9,0,0],[1958,9,28,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1959,4,26,9,59,59],[1959,4,26,1,59,59],
'1958092809:00:00','1958092801:00:00','1959042609:59:59','1959042601:59:59' ],
],
1959 =>
[
[ [1959,4,26,10,0,0],[1959,4,26,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1959,9,27,8,59,59],[1959,9,27,1,59,59],
'1959042610:00:00','1959042603:00:00','1959092708:59:59','1959092701:59:59' ],
[ [1959,9,27,9,0,0],[1959,9,27,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1960,4,24,9,59,59],[1960,4,24,1,59,59],
'1959092709:00:00','1959092701:00:00','1960042409:59:59','1960042401:59:59' ],
],
1960 =>
[
[ [1960,4,24,10,0,0],[1960,4,24,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1960,9,25,8,59,59],[1960,9,25,1,59,59],
'1960042410:00:00','1960042403:00:00','1960092508:59:59','1960092501:59:59' ],
[ [1960,9,25,9,0,0],[1960,9,25,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1976,4,25,9,59,59],[1976,4,25,1,59,59],
'1960092509:00:00','1960092501:00:00','1976042509:59:59','1976042501:59:59' ],
],
1976 =>
[
[ [1976,4,25,10,0,0],[1976,4,25,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1976,10,31,8,59,59],[1976,10,31,1,59,59],
'1976042510:00:00','1976042503:00:00','1976103108:59:59','1976103101:59:59' ],
[ [1976,10,31,9,0,0],[1976,10,31,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1977,4,24,9,59,59],[1977,4,24,1,59,59],
'1976103109:00:00','1976103101:00:00','1977042409:59:59','1977042401:59:59' ],
],
1977 =>
[
[ [1977,4,24,10,0,0],[1977,4,24,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1977,10,30,8,59,59],[1977,10,30,1,59,59],
'1977042410:00:00','1977042403:00:00','1977103008:59:59','1977103001:59:59' ],
[ [1977,10,30,9,0,0],[1977,10,30,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1978,4,30,9,59,59],[1978,4,30,1,59,59],
'1977103009:00:00','1977103001:00:00','1978043009:59:59','1978043001:59:59' ],
],
1978 =>
[
[ [1978,4,30,10,0,0],[1978,4,30,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1978,10,29,8,59,59],[1978,10,29,1,59,59],
'1978043010:00:00','1978043003:00:00','1978102908:59:59','1978102901:59:59' ],
[ [1978,10,29,9,0,0],[1978,10,29,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1979,4,29,9,59,59],[1979,4,29,1,59,59],
'1978102909:00:00','1978102901:00:00','1979042909:59:59','1979042901:59:59' ],
],
1979 =>
[
[ [1979,4,29,10,0,0],[1979,4,29,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1979,10,28,8,59,59],[1979,10,28,1,59,59],
'1979042910:00:00','1979042903:00:00','1979102808:59:59','1979102801:59:59' ],
[ [1979,10,28,9,0,0],[1979,10,28,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1980,4,27,9,59,59],[1980,4,27,1,59,59],
'1979102809:00:00','1979102801:00:00','1980042709:59:59','1980042701:59:59' ],
],
1980 =>
[
[ [1980,4,27,10,0,0],[1980,4,27,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1980,10,26,8,59,59],[1980,10,26,1,59,59],
'1980042710:00:00','1980042703:00:00','1980102608:59:59','1980102601:59:59' ],
[ [1980,10,26,9,0,0],[1980,10,26,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1981,4,26,9,59,59],[1981,4,26,1,59,59],
'1980102609:00:00','1980102601:00:00','1981042609:59:59','1981042601:59:59' ],
],
1981 =>
[
[ [1981,4,26,10,0,0],[1981,4,26,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1981,10,25,8,59,59],[1981,10,25,1,59,59],
'1981042610:00:00','1981042603:00:00','1981102508:59:59','1981102501:59:59' ],
[ [1981,10,25,9,0,0],[1981,10,25,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1982,4,25,9,59,59],[1982,4,25,1,59,59],
'1981102509:00:00','1981102501:00:00','1982042509:59:59','1982042501:59:59' ],
],
1982 =>
[
[ [1982,4,25,10,0,0],[1982,4,25,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1982,10,31,8,59,59],[1982,10,31,1,59,59],
'1982042510:00:00','1982042503:00:00','1982103108:59:59','1982103101:59:59' ],
[ [1982,10,31,9,0,0],[1982,10,31,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1983,4,24,9,59,59],[1983,4,24,1,59,59],
'1982103109:00:00','1982103101:00:00','1983042409:59:59','1983042401:59:59' ],
],
1983 =>
[
[ [1983,4,24,10,0,0],[1983,4,24,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1983,10,30,8,59,59],[1983,10,30,1,59,59],
'1983042410:00:00','1983042403:00:00','1983103008:59:59','1983103001:59:59' ],
[ [1983,10,30,9,0,0],[1983,10,30,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1984,4,29,9,59,59],[1984,4,29,1,59,59],
'1983103009:00:00','1983103001:00:00','1984042909:59:59','1984042901:59:59' ],
],
1984 =>
[
[ [1984,4,29,10,0,0],[1984,4,29,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1984,10,28,8,59,59],[1984,10,28,1,59,59],
'1984042910:00:00','1984042903:00:00','1984102808:59:59','1984102801:59:59' ],
[ [1984,10,28,9,0,0],[1984,10,28,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1985,4,28,9,59,59],[1985,4,28,1,59,59],
'1984102809:00:00','1984102801:00:00','1985042809:59:59','1985042801:59:59' ],
],
1985 =>
[
[ [1985,4,28,10,0,0],[1985,4,28,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1985,10,27,8,59,59],[1985,10,27,1,59,59],
'1985042810:00:00','1985042803:00:00','1985102708:59:59','1985102701:59:59' ],
[ [1985,10,27,9,0,0],[1985,10,27,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1986,4,27,9,59,59],[1986,4,27,1,59,59],
'1985102709:00:00','1985102701:00:00','1986042709:59:59','1986042701:59:59' ],
],
1986 =>
[
[ [1986,4,27,10,0,0],[1986,4,27,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1986,10,26,8,59,59],[1986,10,26,1,59,59],
'1986042710:00:00','1986042703:00:00','1986102608:59:59','1986102601:59:59' ],
[ [1986,10,26,9,0,0],[1986,10,26,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1987,4,5,9,59,59],[1987,4,5,1,59,59],
'1986102609:00:00','1986102601:00:00','1987040509:59:59','1987040501:59:59' ],
],
1987 =>
[
[ [1987,4,5,10,0,0],[1987,4,5,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1987,10,25,8,59,59],[1987,10,25,1,59,59],
'1987040510:00:00','1987040503:00:00','1987102508:59:59','1987102501:59:59' ],
[ [1987,10,25,9,0,0],[1987,10,25,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1988,4,3,9,59,59],[1988,4,3,1,59,59],
'1987102509:00:00','1987102501:00:00','1988040309:59:59','1988040301:59:59' ],
],
1988 =>
[
[ [1988,4,3,10,0,0],[1988,4,3,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1988,10,30,8,59,59],[1988,10,30,1,59,59],
'1988040310:00:00','1988040303:00:00','1988103008:59:59','1988103001:59:59' ],
[ [1988,10,30,9,0,0],[1988,10,30,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1989,4,2,9,59,59],[1989,4,2,1,59,59],
'1988103009:00:00','1988103001:00:00','1989040209:59:59','1989040201:59:59' ],
],
1989 =>
[
[ [1989,4,2,10,0,0],[1989,4,2,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1989,10,29,8,59,59],[1989,10,29,1,59,59],
'1989040210:00:00','1989040203:00:00','1989102908:59:59','1989102901:59:59' ],
[ [1989,10,29,9,0,0],[1989,10,29,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1990,4,1,9,59,59],[1990,4,1,1,59,59],
'1989102909:00:00','1989102901:00:00','1990040109:59:59','1990040101:59:59' ],
],
1990 =>
[
[ [1990,4,1,10,0,0],[1990,4,1,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1990,10,28,8,59,59],[1990,10,28,1,59,59],
'1990040110:00:00','1990040103:00:00','1990102808:59:59','1990102801:59:59' ],
[ [1990,10,28,9,0,0],[1990,10,28,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1991,4,7,9,59,59],[1991,4,7,1,59,59],
'1990102809:00:00','1990102801:00:00','1991040709:59:59','1991040701:59:59' ],
],
1991 =>
[
[ [1991,4,7,10,0,0],[1991,4,7,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1991,10,27,8,59,59],[1991,10,27,1,59,59],
'1991040710:00:00','1991040703:00:00','1991102708:59:59','1991102701:59:59' ],
[ [1991,10,27,9,0,0],[1991,10,27,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1992,4,5,9,59,59],[1992,4,5,1,59,59],
'1991102709:00:00','1991102701:00:00','1992040509:59:59','1992040501:59:59' ],
],
1992 =>
[
[ [1992,4,5,10,0,0],[1992,4,5,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1992,10,25,8,59,59],[1992,10,25,1,59,59],
'1992040510:00:00','1992040503:00:00','1992102508:59:59','1992102501:59:59' ],
[ [1992,10,25,9,0,0],[1992,10,25,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1993,4,4,9,59,59],[1993,4,4,1,59,59],
'1992102509:00:00','1992102501:00:00','1993040409:59:59','1993040401:59:59' ],
],
1993 =>
[
[ [1993,4,4,10,0,0],[1993,4,4,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1993,10,31,8,59,59],[1993,10,31,1,59,59],
'1993040410:00:00','1993040403:00:00','1993103108:59:59','1993103101:59:59' ],
[ [1993,10,31,9,0,0],[1993,10,31,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1994,4,3,9,59,59],[1994,4,3,1,59,59],
'1993103109:00:00','1993103101:00:00','1994040309:59:59','1994040301:59:59' ],
],
1994 =>
[
[ [1994,4,3,10,0,0],[1994,4,3,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1994,10,30,8,59,59],[1994,10,30,1,59,59],
'1994040310:00:00','1994040303:00:00','1994103008:59:59','1994103001:59:59' ],
[ [1994,10,30,9,0,0],[1994,10,30,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1995,4,2,9,59,59],[1995,4,2,1,59,59],
'1994103009:00:00','1994103001:00:00','1995040209:59:59','1995040201:59:59' ],
],
1995 =>
[
[ [1995,4,2,10,0,0],[1995,4,2,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1995,10,29,8,59,59],[1995,10,29,1,59,59],
'1995040210:00:00','1995040203:00:00','1995102908:59:59','1995102901:59:59' ],
[ [1995,10,29,9,0,0],[1995,10,29,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1996,4,7,9,59,59],[1996,4,7,1,59,59],
'1995102909:00:00','1995102901:00:00','1996040709:59:59','1996040701:59:59' ],
],
1996 =>
[
[ [1996,4,7,10,0,0],[1996,4,7,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1996,10,27,8,59,59],[1996,10,27,1,59,59],
'1996040710:00:00','1996040703:00:00','1996102708:59:59','1996102701:59:59' ],
[ [1996,10,27,9,0,0],[1996,10,27,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1997,4,6,9,59,59],[1997,4,6,1,59,59],
'1996102709:00:00','1996102701:00:00','1997040609:59:59','1997040601:59:59' ],
],
1997 =>
[
[ [1997,4,6,10,0,0],[1997,4,6,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1997,10,26,8,59,59],[1997,10,26,1,59,59],
'1997040610:00:00','1997040603:00:00','1997102608:59:59','1997102601:59:59' ],
[ [1997,10,26,9,0,0],[1997,10,26,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1998,4,5,9,59,59],[1998,4,5,1,59,59],
'1997102609:00:00','1997102601:00:00','1998040509:59:59','1998040501:59:59' ],
],
1998 =>
[
[ [1998,4,5,10,0,0],[1998,4,5,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1998,10,25,8,59,59],[1998,10,25,1,59,59],
'1998040510:00:00','1998040503:00:00','1998102508:59:59','1998102501:59:59' ],
[ [1998,10,25,9,0,0],[1998,10,25,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[1999,4,4,9,59,59],[1999,4,4,1,59,59],
'1998102509:00:00','1998102501:00:00','1999040409:59:59','1999040401:59:59' ],
],
1999 =>
[
[ [1999,4,4,10,0,0],[1999,4,4,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[1999,10,31,8,59,59],[1999,10,31,1,59,59],
'1999040410:00:00','1999040403:00:00','1999103108:59:59','1999103101:59:59' ],
[ [1999,10,31,9,0,0],[1999,10,31,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2000,4,2,9,59,59],[2000,4,2,1,59,59],
'1999103109:00:00','1999103101:00:00','2000040209:59:59','2000040201:59:59' ],
],
2000 =>
[
[ [2000,4,2,10,0,0],[2000,4,2,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2000,10,29,8,59,59],[2000,10,29,1,59,59],
'2000040210:00:00','2000040203:00:00','2000102908:59:59','2000102901:59:59' ],
[ [2000,10,29,9,0,0],[2000,10,29,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2001,4,1,9,59,59],[2001,4,1,1,59,59],
'2000102909:00:00','2000102901:00:00','2001040109:59:59','2001040101:59:59' ],
],
2001 =>
[
[ [2001,4,1,10,0,0],[2001,4,1,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2001,10,28,8,59,59],[2001,10,28,1,59,59],
'2001040110:00:00','2001040103:00:00','2001102808:59:59','2001102801:59:59' ],
[ [2001,10,28,9,0,0],[2001,10,28,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2002,4,7,9,59,59],[2002,4,7,1,59,59],
'2001102809:00:00','2001102801:00:00','2002040709:59:59','2002040701:59:59' ],
],
2002 =>
[
[ [2002,4,7,10,0,0],[2002,4,7,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2002,10,27,8,59,59],[2002,10,27,1,59,59],
'2002040710:00:00','2002040703:00:00','2002102708:59:59','2002102701:59:59' ],
[ [2002,10,27,9,0,0],[2002,10,27,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2003,4,6,9,59,59],[2003,4,6,1,59,59],
'2002102709:00:00','2002102701:00:00','2003040609:59:59','2003040601:59:59' ],
],
2003 =>
[
[ [2003,4,6,10,0,0],[2003,4,6,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2003,10,26,8,59,59],[2003,10,26,1,59,59],
'2003040610:00:00','2003040603:00:00','2003102608:59:59','2003102601:59:59' ],
[ [2003,10,26,9,0,0],[2003,10,26,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2004,4,4,9,59,59],[2004,4,4,1,59,59],
'2003102609:00:00','2003102601:00:00','2004040409:59:59','2004040401:59:59' ],
],
2004 =>
[
[ [2004,4,4,10,0,0],[2004,4,4,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2004,10,31,8,59,59],[2004,10,31,1,59,59],
'2004040410:00:00','2004040403:00:00','2004103108:59:59','2004103101:59:59' ],
[ [2004,10,31,9,0,0],[2004,10,31,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2005,4,3,9,59,59],[2005,4,3,1,59,59],
'2004103109:00:00','2004103101:00:00','2005040309:59:59','2005040301:59:59' ],
],
2005 =>
[
[ [2005,4,3,10,0,0],[2005,4,3,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2005,10,30,8,59,59],[2005,10,30,1,59,59],
'2005040310:00:00','2005040303:00:00','2005103008:59:59','2005103001:59:59' ],
[ [2005,10,30,9,0,0],[2005,10,30,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2006,4,2,9,59,59],[2006,4,2,1,59,59],
'2005103009:00:00','2005103001:00:00','2006040209:59:59','2006040201:59:59' ],
],
2006 =>
[
[ [2006,4,2,10,0,0],[2006,4,2,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2006,10,29,8,59,59],[2006,10,29,1,59,59],
'2006040210:00:00','2006040203:00:00','2006102908:59:59','2006102901:59:59' ],
[ [2006,10,29,9,0,0],[2006,10,29,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2007,4,1,9,59,59],[2007,4,1,1,59,59],
'2006102909:00:00','2006102901:00:00','2007040109:59:59','2007040101:59:59' ],
],
2007 =>
[
[ [2007,4,1,10,0,0],[2007,4,1,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2007,10,28,8,59,59],[2007,10,28,1,59,59],
'2007040110:00:00','2007040103:00:00','2007102808:59:59','2007102801:59:59' ],
[ [2007,10,28,9,0,0],[2007,10,28,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2008,4,6,9,59,59],[2008,4,6,1,59,59],
'2007102809:00:00','2007102801:00:00','2008040609:59:59','2008040601:59:59' ],
],
2008 =>
[
[ [2008,4,6,10,0,0],[2008,4,6,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2008,10,26,8,59,59],[2008,10,26,1,59,59],
'2008040610:00:00','2008040603:00:00','2008102608:59:59','2008102601:59:59' ],
[ [2008,10,26,9,0,0],[2008,10,26,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2009,4,5,9,59,59],[2009,4,5,1,59,59],
'2008102609:00:00','2008102601:00:00','2009040509:59:59','2009040501:59:59' ],
],
2009 =>
[
[ [2009,4,5,10,0,0],[2009,4,5,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2009,10,25,8,59,59],[2009,10,25,1,59,59],
'2009040510:00:00','2009040503:00:00','2009102508:59:59','2009102501:59:59' ],
[ [2009,10,25,9,0,0],[2009,10,25,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2010,3,14,9,59,59],[2010,3,14,1,59,59],
'2009102509:00:00','2009102501:00:00','2010031409:59:59','2010031401:59:59' ],
],
2010 =>
[
[ [2010,3,14,10,0,0],[2010,3,14,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2010,11,7,8,59,59],[2010,11,7,1,59,59],
'2010031410:00:00','2010031403:00:00','2010110708:59:59','2010110701:59:59' ],
[ [2010,11,7,9,0,0],[2010,11,7,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2011,3,13,9,59,59],[2011,3,13,1,59,59],
'2010110709:00:00','2010110701:00:00','2011031309:59:59','2011031301:59:59' ],
],
2011 =>
[
[ [2011,3,13,10,0,0],[2011,3,13,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2011,11,6,8,59,59],[2011,11,6,1,59,59],
'2011031310:00:00','2011031303:00:00','2011110608:59:59','2011110601:59:59' ],
[ [2011,11,6,9,0,0],[2011,11,6,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2012,3,11,9,59,59],[2012,3,11,1,59,59],
'2011110609:00:00','2011110601:00:00','2012031109:59:59','2012031101:59:59' ],
],
2012 =>
[
[ [2012,3,11,10,0,0],[2012,3,11,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2012,11,4,8,59,59],[2012,11,4,1,59,59],
'2012031110:00:00','2012031103:00:00','2012110408:59:59','2012110401:59:59' ],
[ [2012,11,4,9,0,0],[2012,11,4,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2013,3,10,9,59,59],[2013,3,10,1,59,59],
'2012110409:00:00','2012110401:00:00','2013031009:59:59','2013031001:59:59' ],
],
2013 =>
[
[ [2013,3,10,10,0,0],[2013,3,10,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2013,11,3,8,59,59],[2013,11,3,1,59,59],
'2013031010:00:00','2013031003:00:00','2013110308:59:59','2013110301:59:59' ],
[ [2013,11,3,9,0,0],[2013,11,3,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2014,3,9,9,59,59],[2014,3,9,1,59,59],
'2013110309:00:00','2013110301:00:00','2014030909:59:59','2014030901:59:59' ],
],
2014 =>
[
[ [2014,3,9,10,0,0],[2014,3,9,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2014,11,2,8,59,59],[2014,11,2,1,59,59],
'2014030910:00:00','2014030903:00:00','2014110208:59:59','2014110201:59:59' ],
[ [2014,11,2,9,0,0],[2014,11,2,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2015,3,8,9,59,59],[2015,3,8,1,59,59],
'2014110209:00:00','2014110201:00:00','2015030809:59:59','2015030801:59:59' ],
],
2015 =>
[
[ [2015,3,8,10,0,0],[2015,3,8,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2015,11,1,8,59,59],[2015,11,1,1,59,59],
'2015030810:00:00','2015030803:00:00','2015110108:59:59','2015110101:59:59' ],
[ [2015,11,1,9,0,0],[2015,11,1,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2016,3,13,9,59,59],[2016,3,13,1,59,59],
'2015110109:00:00','2015110101:00:00','2016031309:59:59','2016031301:59:59' ],
],
2016 =>
[
[ [2016,3,13,10,0,0],[2016,3,13,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2016,11,6,8,59,59],[2016,11,6,1,59,59],
'2016031310:00:00','2016031303:00:00','2016110608:59:59','2016110601:59:59' ],
[ [2016,11,6,9,0,0],[2016,11,6,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2017,3,12,9,59,59],[2017,3,12,1,59,59],
'2016110609:00:00','2016110601:00:00','2017031209:59:59','2017031201:59:59' ],
],
2017 =>
[
[ [2017,3,12,10,0,0],[2017,3,12,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2017,11,5,8,59,59],[2017,11,5,1,59,59],
'2017031210:00:00','2017031203:00:00','2017110508:59:59','2017110501:59:59' ],
[ [2017,11,5,9,0,0],[2017,11,5,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2018,3,11,9,59,59],[2018,3,11,1,59,59],
'2017110509:00:00','2017110501:00:00','2018031109:59:59','2018031101:59:59' ],
],
2018 =>
[
[ [2018,3,11,10,0,0],[2018,3,11,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2018,11,4,8,59,59],[2018,11,4,1,59,59],
'2018031110:00:00','2018031103:00:00','2018110408:59:59','2018110401:59:59' ],
[ [2018,11,4,9,0,0],[2018,11,4,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2019,3,10,9,59,59],[2019,3,10,1,59,59],
'2018110409:00:00','2018110401:00:00','2019031009:59:59','2019031001:59:59' ],
],
2019 =>
[
[ [2019,3,10,10,0,0],[2019,3,10,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2019,11,3,8,59,59],[2019,11,3,1,59,59],
'2019031010:00:00','2019031003:00:00','2019110308:59:59','2019110301:59:59' ],
[ [2019,11,3,9,0,0],[2019,11,3,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2020,3,8,9,59,59],[2020,3,8,1,59,59],
'2019110309:00:00','2019110301:00:00','2020030809:59:59','2020030801:59:59' ],
],
2020 =>
[
[ [2020,3,8,10,0,0],[2020,3,8,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2020,11,1,8,59,59],[2020,11,1,1,59,59],
'2020030810:00:00','2020030803:00:00','2020110108:59:59','2020110101:59:59' ],
[ [2020,11,1,9,0,0],[2020,11,1,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2021,3,14,9,59,59],[2021,3,14,1,59,59],
'2020110109:00:00','2020110101:00:00','2021031409:59:59','2021031401:59:59' ],
],
2021 =>
[
[ [2021,3,14,10,0,0],[2021,3,14,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2021,11,7,8,59,59],[2021,11,7,1,59,59],
'2021031410:00:00','2021031403:00:00','2021110708:59:59','2021110701:59:59' ],
[ [2021,11,7,9,0,0],[2021,11,7,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2022,3,13,9,59,59],[2022,3,13,1,59,59],
'2021110709:00:00','2021110701:00:00','2022031309:59:59','2022031301:59:59' ],
],
2022 =>
[
[ [2022,3,13,10,0,0],[2022,3,13,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2022,11,6,8,59,59],[2022,11,6,1,59,59],
'2022031310:00:00','2022031303:00:00','2022110608:59:59','2022110601:59:59' ],
[ [2022,11,6,9,0,0],[2022,11,6,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2023,3,12,9,59,59],[2023,3,12,1,59,59],
'2022110609:00:00','2022110601:00:00','2023031209:59:59','2023031201:59:59' ],
],
2023 =>
[
[ [2023,3,12,10,0,0],[2023,3,12,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2023,11,5,8,59,59],[2023,11,5,1,59,59],
'2023031210:00:00','2023031203:00:00','2023110508:59:59','2023110501:59:59' ],
[ [2023,11,5,9,0,0],[2023,11,5,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2024,3,10,9,59,59],[2024,3,10,1,59,59],
'2023110509:00:00','2023110501:00:00','2024031009:59:59','2024031001:59:59' ],
],
2024 =>
[
[ [2024,3,10,10,0,0],[2024,3,10,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2024,11,3,8,59,59],[2024,11,3,1,59,59],
'2024031010:00:00','2024031003:00:00','2024110308:59:59','2024110301:59:59' ],
[ [2024,11,3,9,0,0],[2024,11,3,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2025,3,9,9,59,59],[2025,3,9,1,59,59],
'2024110309:00:00','2024110301:00:00','2025030909:59:59','2025030901:59:59' ],
],
2025 =>
[
[ [2025,3,9,10,0,0],[2025,3,9,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2025,11,2,8,59,59],[2025,11,2,1,59,59],
'2025030910:00:00','2025030903:00:00','2025110208:59:59','2025110201:59:59' ],
[ [2025,11,2,9,0,0],[2025,11,2,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2026,3,8,9,59,59],[2026,3,8,1,59,59],
'2025110209:00:00','2025110201:00:00','2026030809:59:59','2026030801:59:59' ],
],
2026 =>
[
[ [2026,3,8,10,0,0],[2026,3,8,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2026,11,1,8,59,59],[2026,11,1,1,59,59],
'2026030810:00:00','2026030803:00:00','2026110108:59:59','2026110101:59:59' ],
[ [2026,11,1,9,0,0],[2026,11,1,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2027,3,14,9,59,59],[2027,3,14,1,59,59],
'2026110109:00:00','2026110101:00:00','2027031409:59:59','2027031401:59:59' ],
],
2027 =>
[
[ [2027,3,14,10,0,0],[2027,3,14,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2027,11,7,8,59,59],[2027,11,7,1,59,59],
'2027031410:00:00','2027031403:00:00','2027110708:59:59','2027110701:59:59' ],
[ [2027,11,7,9,0,0],[2027,11,7,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2028,3,12,9,59,59],[2028,3,12,1,59,59],
'2027110709:00:00','2027110701:00:00','2028031209:59:59','2028031201:59:59' ],
],
2028 =>
[
[ [2028,3,12,10,0,0],[2028,3,12,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2028,11,5,8,59,59],[2028,11,5,1,59,59],
'2028031210:00:00','2028031203:00:00','2028110508:59:59','2028110501:59:59' ],
[ [2028,11,5,9,0,0],[2028,11,5,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2029,3,11,9,59,59],[2029,3,11,1,59,59],
'2028110509:00:00','2028110501:00:00','2029031109:59:59','2029031101:59:59' ],
],
2029 =>
[
[ [2029,3,11,10,0,0],[2029,3,11,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2029,11,4,8,59,59],[2029,11,4,1,59,59],
'2029031110:00:00','2029031103:00:00','2029110408:59:59','2029110401:59:59' ],
[ [2029,11,4,9,0,0],[2029,11,4,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2030,3,10,9,59,59],[2030,3,10,1,59,59],
'2029110409:00:00','2029110401:00:00','2030031009:59:59','2030031001:59:59' ],
],
2030 =>
[
[ [2030,3,10,10,0,0],[2030,3,10,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2030,11,3,8,59,59],[2030,11,3,1,59,59],
'2030031010:00:00','2030031003:00:00','2030110308:59:59','2030110301:59:59' ],
[ [2030,11,3,9,0,0],[2030,11,3,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2031,3,9,9,59,59],[2031,3,9,1,59,59],
'2030110309:00:00','2030110301:00:00','2031030909:59:59','2031030901:59:59' ],
],
2031 =>
[
[ [2031,3,9,10,0,0],[2031,3,9,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2031,11,2,8,59,59],[2031,11,2,1,59,59],
'2031030910:00:00','2031030903:00:00','2031110208:59:59','2031110201:59:59' ],
[ [2031,11,2,9,0,0],[2031,11,2,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2032,3,14,9,59,59],[2032,3,14,1,59,59],
'2031110209:00:00','2031110201:00:00','2032031409:59:59','2032031401:59:59' ],
],
2032 =>
[
[ [2032,3,14,10,0,0],[2032,3,14,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2032,11,7,8,59,59],[2032,11,7,1,59,59],
'2032031410:00:00','2032031403:00:00','2032110708:59:59','2032110701:59:59' ],
[ [2032,11,7,9,0,0],[2032,11,7,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2033,3,13,9,59,59],[2033,3,13,1,59,59],
'2032110709:00:00','2032110701:00:00','2033031309:59:59','2033031301:59:59' ],
],
2033 =>
[
[ [2033,3,13,10,0,0],[2033,3,13,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2033,11,6,8,59,59],[2033,11,6,1,59,59],
'2033031310:00:00','2033031303:00:00','2033110608:59:59','2033110601:59:59' ],
[ [2033,11,6,9,0,0],[2033,11,6,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2034,3,12,9,59,59],[2034,3,12,1,59,59],
'2033110609:00:00','2033110601:00:00','2034031209:59:59','2034031201:59:59' ],
],
2034 =>
[
[ [2034,3,12,10,0,0],[2034,3,12,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2034,11,5,8,59,59],[2034,11,5,1,59,59],
'2034031210:00:00','2034031203:00:00','2034110508:59:59','2034110501:59:59' ],
[ [2034,11,5,9,0,0],[2034,11,5,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2035,3,11,9,59,59],[2035,3,11,1,59,59],
'2034110509:00:00','2034110501:00:00','2035031109:59:59','2035031101:59:59' ],
],
2035 =>
[
[ [2035,3,11,10,0,0],[2035,3,11,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2035,11,4,8,59,59],[2035,11,4,1,59,59],
'2035031110:00:00','2035031103:00:00','2035110408:59:59','2035110401:59:59' ],
[ [2035,11,4,9,0,0],[2035,11,4,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2036,3,9,9,59,59],[2036,3,9,1,59,59],
'2035110409:00:00','2035110401:00:00','2036030909:59:59','2036030901:59:59' ],
],
2036 =>
[
[ [2036,3,9,10,0,0],[2036,3,9,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2036,11,2,8,59,59],[2036,11,2,1,59,59],
'2036030910:00:00','2036030903:00:00','2036110208:59:59','2036110201:59:59' ],
[ [2036,11,2,9,0,0],[2036,11,2,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2037,3,8,9,59,59],[2037,3,8,1,59,59],
'2036110209:00:00','2036110201:00:00','2037030809:59:59','2037030801:59:59' ],
],
2037 =>
[
[ [2037,3,8,10,0,0],[2037,3,8,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2037,11,1,8,59,59],[2037,11,1,1,59,59],
'2037030810:00:00','2037030803:00:00','2037110108:59:59','2037110101:59:59' ],
[ [2037,11,1,9,0,0],[2037,11,1,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2038,3,14,9,59,59],[2038,3,14,1,59,59],
'2037110109:00:00','2037110101:00:00','2038031409:59:59','2038031401:59:59' ],
],
2038 =>
[
[ [2038,3,14,10,0,0],[2038,3,14,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2038,11,7,8,59,59],[2038,11,7,1,59,59],
'2038031410:00:00','2038031403:00:00','2038110708:59:59','2038110701:59:59' ],
[ [2038,11,7,9,0,0],[2038,11,7,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2039,3,13,9,59,59],[2039,3,13,1,59,59],
'2038110709:00:00','2038110701:00:00','2039031309:59:59','2039031301:59:59' ],
],
2039 =>
[
[ [2039,3,13,10,0,0],[2039,3,13,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2039,11,6,8,59,59],[2039,11,6,1,59,59],
'2039031310:00:00','2039031303:00:00','2039110608:59:59','2039110601:59:59' ],
[ [2039,11,6,9,0,0],[2039,11,6,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2040,3,11,9,59,59],[2040,3,11,1,59,59],
'2039110609:00:00','2039110601:00:00','2040031109:59:59','2040031101:59:59' ],
],
2040 =>
[
[ [2040,3,11,10,0,0],[2040,3,11,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2040,11,4,8,59,59],[2040,11,4,1,59,59],
'2040031110:00:00','2040031103:00:00','2040110408:59:59','2040110401:59:59' ],
[ [2040,11,4,9,0,0],[2040,11,4,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2041,3,10,9,59,59],[2041,3,10,1,59,59],
'2040110409:00:00','2040110401:00:00','2041031009:59:59','2041031001:59:59' ],
],
2041 =>
[
[ [2041,3,10,10,0,0],[2041,3,10,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2041,11,3,8,59,59],[2041,11,3,1,59,59],
'2041031010:00:00','2041031003:00:00','2041110308:59:59','2041110301:59:59' ],
[ [2041,11,3,9,0,0],[2041,11,3,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2042,3,9,9,59,59],[2042,3,9,1,59,59],
'2041110309:00:00','2041110301:00:00','2042030909:59:59','2042030901:59:59' ],
],
2042 =>
[
[ [2042,3,9,10,0,0],[2042,3,9,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2042,11,2,8,59,59],[2042,11,2,1,59,59],
'2042030910:00:00','2042030903:00:00','2042110208:59:59','2042110201:59:59' ],
[ [2042,11,2,9,0,0],[2042,11,2,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2043,3,8,9,59,59],[2043,3,8,1,59,59],
'2042110209:00:00','2042110201:00:00','2043030809:59:59','2043030801:59:59' ],
],
2043 =>
[
[ [2043,3,8,10,0,0],[2043,3,8,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2043,11,1,8,59,59],[2043,11,1,1,59,59],
'2043030810:00:00','2043030803:00:00','2043110108:59:59','2043110101:59:59' ],
[ [2043,11,1,9,0,0],[2043,11,1,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2044,3,13,9,59,59],[2044,3,13,1,59,59],
'2043110109:00:00','2043110101:00:00','2044031309:59:59','2044031301:59:59' ],
],
2044 =>
[
[ [2044,3,13,10,0,0],[2044,3,13,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2044,11,6,8,59,59],[2044,11,6,1,59,59],
'2044031310:00:00','2044031303:00:00','2044110608:59:59','2044110601:59:59' ],
[ [2044,11,6,9,0,0],[2044,11,6,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2045,3,12,9,59,59],[2045,3,12,1,59,59],
'2044110609:00:00','2044110601:00:00','2045031209:59:59','2045031201:59:59' ],
],
2045 =>
[
[ [2045,3,12,10,0,0],[2045,3,12,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2045,11,5,8,59,59],[2045,11,5,1,59,59],
'2045031210:00:00','2045031203:00:00','2045110508:59:59','2045110501:59:59' ],
[ [2045,11,5,9,0,0],[2045,11,5,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2046,3,11,9,59,59],[2046,3,11,1,59,59],
'2045110509:00:00','2045110501:00:00','2046031109:59:59','2046031101:59:59' ],
],
2046 =>
[
[ [2046,3,11,10,0,0],[2046,3,11,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2046,11,4,8,59,59],[2046,11,4,1,59,59],
'2046031110:00:00','2046031103:00:00','2046110408:59:59','2046110401:59:59' ],
[ [2046,11,4,9,0,0],[2046,11,4,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2047,3,10,9,59,59],[2047,3,10,1,59,59],
'2046110409:00:00','2046110401:00:00','2047031009:59:59','2047031001:59:59' ],
],
2047 =>
[
[ [2047,3,10,10,0,0],[2047,3,10,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2047,11,3,8,59,59],[2047,11,3,1,59,59],
'2047031010:00:00','2047031003:00:00','2047110308:59:59','2047110301:59:59' ],
[ [2047,11,3,9,0,0],[2047,11,3,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2048,3,8,9,59,59],[2048,3,8,1,59,59],
'2047110309:00:00','2047110301:00:00','2048030809:59:59','2048030801:59:59' ],
],
2048 =>
[
[ [2048,3,8,10,0,0],[2048,3,8,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2048,11,1,8,59,59],[2048,11,1,1,59,59],
'2048030810:00:00','2048030803:00:00','2048110108:59:59','2048110101:59:59' ],
[ [2048,11,1,9,0,0],[2048,11,1,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2049,3,14,9,59,59],[2049,3,14,1,59,59],
'2048110109:00:00','2048110101:00:00','2049031409:59:59','2049031401:59:59' ],
],
2049 =>
[
[ [2049,3,14,10,0,0],[2049,3,14,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2049,11,7,8,59,59],[2049,11,7,1,59,59],
'2049031410:00:00','2049031403:00:00','2049110708:59:59','2049110701:59:59' ],
[ [2049,11,7,9,0,0],[2049,11,7,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2050,3,13,9,59,59],[2050,3,13,1,59,59],
'2049110709:00:00','2049110701:00:00','2050031309:59:59','2050031301:59:59' ],
],
2050 =>
[
[ [2050,3,13,10,0,0],[2050,3,13,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2050,11,6,8,59,59],[2050,11,6,1,59,59],
'2050031310:00:00','2050031303:00:00','2050110608:59:59','2050110601:59:59' ],
[ [2050,11,6,9,0,0],[2050,11,6,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2051,3,12,9,59,59],[2051,3,12,1,59,59],
'2050110609:00:00','2050110601:00:00','2051031209:59:59','2051031201:59:59' ],
],
2051 =>
[
[ [2051,3,12,10,0,0],[2051,3,12,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2051,11,5,8,59,59],[2051,11,5,1,59,59],
'2051031210:00:00','2051031203:00:00','2051110508:59:59','2051110501:59:59' ],
[ [2051,11,5,9,0,0],[2051,11,5,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2052,3,10,9,59,59],[2052,3,10,1,59,59],
'2051110509:00:00','2051110501:00:00','2052031009:59:59','2052031001:59:59' ],
],
2052 =>
[
[ [2052,3,10,10,0,0],[2052,3,10,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2052,11,3,8,59,59],[2052,11,3,1,59,59],
'2052031010:00:00','2052031003:00:00','2052110308:59:59','2052110301:59:59' ],
[ [2052,11,3,9,0,0],[2052,11,3,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2053,3,9,9,59,59],[2053,3,9,1,59,59],
'2052110309:00:00','2052110301:00:00','2053030909:59:59','2053030901:59:59' ],
],
2053 =>
[
[ [2053,3,9,10,0,0],[2053,3,9,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2053,11,2,8,59,59],[2053,11,2,1,59,59],
'2053030910:00:00','2053030903:00:00','2053110208:59:59','2053110201:59:59' ],
[ [2053,11,2,9,0,0],[2053,11,2,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2054,3,8,9,59,59],[2054,3,8,1,59,59],
'2053110209:00:00','2053110201:00:00','2054030809:59:59','2054030801:59:59' ],
],
2054 =>
[
[ [2054,3,8,10,0,0],[2054,3,8,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2054,11,1,8,59,59],[2054,11,1,1,59,59],
'2054030810:00:00','2054030803:00:00','2054110108:59:59','2054110101:59:59' ],
[ [2054,11,1,9,0,0],[2054,11,1,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2055,3,14,9,59,59],[2055,3,14,1,59,59],
'2054110109:00:00','2054110101:00:00','2055031409:59:59','2055031401:59:59' ],
],
2055 =>
[
[ [2055,3,14,10,0,0],[2055,3,14,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2055,11,7,8,59,59],[2055,11,7,1,59,59],
'2055031410:00:00','2055031403:00:00','2055110708:59:59','2055110701:59:59' ],
[ [2055,11,7,9,0,0],[2055,11,7,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2056,3,12,9,59,59],[2056,3,12,1,59,59],
'2055110709:00:00','2055110701:00:00','2056031209:59:59','2056031201:59:59' ],
],
2056 =>
[
[ [2056,3,12,10,0,0],[2056,3,12,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2056,11,5,8,59,59],[2056,11,5,1,59,59],
'2056031210:00:00','2056031203:00:00','2056110508:59:59','2056110501:59:59' ],
[ [2056,11,5,9,0,0],[2056,11,5,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2057,3,11,9,59,59],[2057,3,11,1,59,59],
'2056110509:00:00','2056110501:00:00','2057031109:59:59','2057031101:59:59' ],
],
2057 =>
[
[ [2057,3,11,10,0,0],[2057,3,11,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2057,11,4,8,59,59],[2057,11,4,1,59,59],
'2057031110:00:00','2057031103:00:00','2057110408:59:59','2057110401:59:59' ],
[ [2057,11,4,9,0,0],[2057,11,4,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2058,3,10,9,59,59],[2058,3,10,1,59,59],
'2057110409:00:00','2057110401:00:00','2058031009:59:59','2058031001:59:59' ],
],
2058 =>
[
[ [2058,3,10,10,0,0],[2058,3,10,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2058,11,3,8,59,59],[2058,11,3,1,59,59],
'2058031010:00:00','2058031003:00:00','2058110308:59:59','2058110301:59:59' ],
[ [2058,11,3,9,0,0],[2058,11,3,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2059,3,9,9,59,59],[2059,3,9,1,59,59],
'2058110309:00:00','2058110301:00:00','2059030909:59:59','2059030901:59:59' ],
],
2059 =>
[
[ [2059,3,9,10,0,0],[2059,3,9,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2059,11,2,8,59,59],[2059,11,2,1,59,59],
'2059030910:00:00','2059030903:00:00','2059110208:59:59','2059110201:59:59' ],
[ [2059,11,2,9,0,0],[2059,11,2,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2060,3,14,9,59,59],[2060,3,14,1,59,59],
'2059110209:00:00','2059110201:00:00','2060031409:59:59','2060031401:59:59' ],
],
2060 =>
[
[ [2060,3,14,10,0,0],[2060,3,14,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2060,11,7,8,59,59],[2060,11,7,1,59,59],
'2060031410:00:00','2060031403:00:00','2060110708:59:59','2060110701:59:59' ],
[ [2060,11,7,9,0,0],[2060,11,7,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2061,3,13,9,59,59],[2061,3,13,1,59,59],
'2060110709:00:00','2060110701:00:00','2061031309:59:59','2061031301:59:59' ],
],
2061 =>
[
[ [2061,3,13,10,0,0],[2061,3,13,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2061,11,6,8,59,59],[2061,11,6,1,59,59],
'2061031310:00:00','2061031303:00:00','2061110608:59:59','2061110601:59:59' ],
[ [2061,11,6,9,0,0],[2061,11,6,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2062,3,12,9,59,59],[2062,3,12,1,59,59],
'2061110609:00:00','2061110601:00:00','2062031209:59:59','2062031201:59:59' ],
],
2062 =>
[
[ [2062,3,12,10,0,0],[2062,3,12,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2062,11,5,8,59,59],[2062,11,5,1,59,59],
'2062031210:00:00','2062031203:00:00','2062110508:59:59','2062110501:59:59' ],
[ [2062,11,5,9,0,0],[2062,11,5,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2063,3,11,9,59,59],[2063,3,11,1,59,59],
'2062110509:00:00','2062110501:00:00','2063031109:59:59','2063031101:59:59' ],
],
2063 =>
[
[ [2063,3,11,10,0,0],[2063,3,11,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2063,11,4,8,59,59],[2063,11,4,1,59,59],
'2063031110:00:00','2063031103:00:00','2063110408:59:59','2063110401:59:59' ],
[ [2063,11,4,9,0,0],[2063,11,4,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2064,3,9,9,59,59],[2064,3,9,1,59,59],
'2063110409:00:00','2063110401:00:00','2064030909:59:59','2064030901:59:59' ],
],
2064 =>
[
[ [2064,3,9,10,0,0],[2064,3,9,3,0,0],'-07:00:00',[-7,0,0],
'PDT',1,[2064,11,2,8,59,59],[2064,11,2,1,59,59],
'2064030910:00:00','2064030903:00:00','2064110208:59:59','2064110201:59:59' ],
[ [2064,11,2,9,0,0],[2064,11,2,1,0,0],'-08:00:00',[-8,0,0],
'PST',0,[2065,3,8,9,59,59],[2065,3,8,1,59,59],
'2064110209:00:00','2064110201:00:00','2065030809:59:59','2065030801:59:59' ],
],
);
%LastRule = (
'zone' => {
'dstoff' => '-07:00:00',
'stdoff' => '-08:00:00',
},
'rules' => {
'03' => {
'flag' => 'ge',
'dow' => '7',
'num' => '8',
'type' => 'w',
'time' => '02:00:00',
'isdst' => '1',
'abb' => 'PDT',
},
'11' => {
'flag' => 'ge',
'dow' => '7',
'num' => '1',
'type' => 'w',
'time' => '02:00:00',
'isdst' => '0',
'abb' => 'PST',
},
},
);
1;
| 48.984879 | 88 | 0.498652 |
73d03de4fbfc6220b1d7cf9c3f08f5983cca8b53 | 1,097 | al | Perl | Demo/permissions/SDK.PermissionSet.al | juliandittmann/AL.TheThingsStackSDK | 56fe13d9315f2e1f2d406cd12205c7b0dcd10199 | [
"MIT"
]
| 1 | 2021-12-08T22:14:51.000Z | 2021-12-08T22:14:51.000Z | Demo/permissions/SDK.PermissionSet.al | juliandittmann/AL.TheThingsStackSDK | 56fe13d9315f2e1f2d406cd12205c7b0dcd10199 | [
"MIT"
]
| null | null | null | Demo/permissions/SDK.PermissionSet.al | juliandittmann/AL.TheThingsStackSDK | 56fe13d9315f2e1f2d406cd12205c7b0dcd10199 | [
"MIT"
]
| null | null | null | permissionset 52350 "jdi TTS Demo SDK"
{
Caption = 'The Things Stack SDK Demo';
Assignable = true;
Access = Public;
IncludedPermissionSets = "jdi TTS SDK";
Permissions =
tabledata "jdi TTS Demo API Key" = RIMD,
tabledata "jdi TTS Demo Application" = RIMD,
tabledata "jdi TTS Demo Device" = RIMD,
tabledata "jdi TTS Demo Gateway" = RIMD,
tabledata "jdi TTS Demo Setup" = RIMD,
tabledata "jdi TTS Demo Storage" = RIMD,
page "jdi TTS Demo Setup Card" = X,
page "jdi TTS Demo API Key Card" = X,
page "jdi TTS Demo API Key List" = X,
page "jdi TTS Demo Application List" = X,
page "jdi TTS Demo Device List" = X,
page "jdi TTS Demo Gateway List" = X,
page "jdi TTS Demo Storage List" = X,
codeunit "jdi TTS Demo Install" = X,
codeunit "jdi TTS Demo Upgrade" = X,
codeunit "jdi TTS Demo GetApplications" = X,
codeunit "jdi TTS Demo GetDevices" = X,
codeunit "jdi TTS Demo GetGateways" = X,
codeunit "jdi TTS Demo GetStorage" = X;
} | 40.62963 | 52 | 0.603464 |
73f26b01886be4f848c390e6311f9a50063f32e2 | 1,221 | pm | Perl | lib/O2/Util/Password.pm | haakonsk/O2-Framework | 50f2f2def517b90dec647b914128ad8f949f51d9 | [
"MIT"
]
| 1 | 2016-05-24T08:13:09.000Z | 2016-05-24T08:13:09.000Z | lib/O2/Util/Password.pm | haakonsk/O2-Framework | 50f2f2def517b90dec647b914128ad8f949f51d9 | [
"MIT"
]
| null | null | null | lib/O2/Util/Password.pm | haakonsk/O2-Framework | 50f2f2def517b90dec647b914128ad8f949f51d9 | [
"MIT"
]
| null | null | null | package O2::Util::Password;
use strict;
# Methods for handling passwords
#---------------------------------------------------------------------------------------------------------------------------------------------------
sub new {
my ($pkg, %init) = @_;
return bless \%init, $pkg;
}
#---------------------------------------------------------------------------------------------------------------------------------------------------
# returns random passord of $length characters. avoids characterss that loook the same (like 0O, Il1, 5S or B8)
sub generatePassword {
my ($obj, $length, $chars) = @_;
$length ||= 6;
my $password = '';
$chars ||= "abcdefghjkmnpqrstuvwxyz679";
foreach my $i (1..$length) {
$password .= substr $chars, int(rand length $chars), 1;
}
return $password;
}
#---------------------------------------------------------------------------------------------------------------------------------------------------
sub generateRandomNumber {
my ($obj, $length) = @_;
return $obj->generatePassword($length, '0123456789');
}
#---------------------------------------------------------------------------------------------------------------------------------------------------
1;
| 39.387097 | 148 | 0.333333 |
ed45b1ff3980ad7a85ebe6aaa9fe4366ea0b77cf | 63 | pl | Perl | tutorial-01/examples/kb1.pl | thedhruvrawat/lics | 08aeeeb5bb41f6095e29bed459ae4056454bcc55 | [
"MIT"
]
| null | null | null | tutorial-01/examples/kb1.pl | thedhruvrawat/lics | 08aeeeb5bb41f6095e29bed459ae4056454bcc55 | [
"MIT"
]
| 17 | 2020-03-24T17:34:07.000Z | 2022-02-19T01:41:16.000Z | tutorial-01/examples/kb1.pl | thedhruvrawat/lics | 08aeeeb5bb41f6095e29bed459ae4056454bcc55 | [
"MIT"
]
| null | null | null | woman(mia).
woman(jody).
woman(yolanda).
playsAirGuitar(jody).
| 12.6 | 21 | 0.746032 |
73e6b2ebb429892ccf51f62ab98162bfbb428401 | 365 | t | Perl | t/11_mailboxes.t | karenetheridge/Net-IMAP-Simple | c78b718df03d4828998208d478e9e95166a68761 | [
"FSFAP"
]
| null | null | null | t/11_mailboxes.t | karenetheridge/Net-IMAP-Simple | c78b718df03d4828998208d478e9e95166a68761 | [
"FSFAP"
]
| null | null | null | t/11_mailboxes.t | karenetheridge/Net-IMAP-Simple | c78b718df03d4828998208d478e9e95166a68761 | [
"FSFAP"
]
| null | null | null | use strict;
use Test;
use Net::IMAP::Simple;
plan tests => our $tests = 2;
our $imap;
sub run_tests {
$imap->create_mailbox("anotherthingy");
my @e = $imap->mailboxes;
my @E = qw(testing anotherthingy);
for my $__e (@E) {
ok(1) if grep { $_ eq $__e } @e; # would use ~~ but would rule out 5.8 boxes
}
}
do "t/test_runner.pm";
| 15.869565 | 84 | 0.580822 |
ed13b9a92ad7840e1b18865cda6d04df6290f0d5 | 2,699 | pl | Perl | doc/tpdb_trs/Prolog/talp_maria/query.pl | ComputationWithBoundedResources/ara-inference | 970fcf905d89c3a769615cd81cc77e1903469dd5 | [
"MIT"
]
| 1 | 2018-09-03T09:26:13.000Z | 2018-09-03T09:26:13.000Z | doc/tpdb_trs/Prolog/talp_maria/query.pl | ComputationWithBoundedResources/ara-inference | 970fcf905d89c3a769615cd81cc77e1903469dd5 | [
"MIT"
]
| null | null | null | doc/tpdb_trs/Prolog/talp_maria/query.pl | ComputationWithBoundedResources/ara-inference | 970fcf905d89c3a769615cd81cc77e1903469dd5 | [
"MIT"
]
| null | null | null | %query: query(i).
/*-----------------------------------------------------------------------------
Program: simple query to a (Prolog) database
Author: D.H.D.Warren
Date: 1977
From Warren's thesis
To test: do. (first solution) or main. (all solutions)
-----------------------------------------------------------------------------*/
%:- entry(query(Q),[free(Q)]).
query([C1,D1,C2,D2]) :-
density(C1,D1),
density(C2,D2),
D1 > D2,
T1 is 20*D1,
T2 is 21*D2,
T1 < T2.
density(C,D) :- pop(C,P), area(C,A), D is (P*100)/A.
pop(china, 8250). area(china, 3380).
pop(india, 5863). area(india, 1139).
pop(ussr, 2521). area(ussr, 8708).
pop(usa, 2119). area(usa, 3609).
pop(indonesia, 1276). area(indonesia, 570).
pop(japan, 1097). area(japan, 148).
pop(brazil, 1042). area(brazil, 3288).
pop(bangladesh, 750). area(bangladesh,55).
pop(pakistan, 682). area(pakistan, 311).
pop(w_germany, 620). area(w_germany, 96).
pop(nigeria, 613). area(nigeria, 373).
pop(mexico, 581). area(mexico, 764).
pop(uk, 559). area(uk, 86).
pop(italy, 554). area(italy, 116).
pop(france, 525). area(france, 213).
pop(phillipines,415). area(phillipines,90).
pop(thailand, 410). area(thailand, 200).
pop(turkey, 383). area(turkey, 296).
pop(egypt, 364). area(egypt, 386).
pop(spain, 352). area(spain, 190).
pop(poland, 337). area(poland, 121).
pop(s_korea, 335). area(s_korea, 37).
pop(iran, 320). area(iran, 628).
pop(ethiopia, 272). area(ethiopia, 350).
pop(argentina, 251). area(argentina, 1080).
/*
% ---------------------------------------------------------------------
% to test:
:- noparallelize.
do :-
write('Warren`s thesis query'), nl, nl,
time(_),
query(X),
report(X,T).
main :-
write('Warren`s thesis query'), nl, nl,
time(_),
bagof(X,X^query(X),L),
time(T),
write('All solutions: '),
write(L),nl,
write('Solved in '), write(T), write(' msec.'), nl.
time(T) :- statistics(runtime,[_,T|_]).
report(X,T) :-
time(T),
write('The solution is: '),
write(X),nl,
write('Solved in '), write(T), write(' msec.'), nl.
%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%
% This piece has been included for the simulation process %
no_trace_main:-
time(_),
query(X),
time(T),
write('Executed in '), write(T), write(' mS.'), nl,
write('Result '), write(X), nl.
trace_main(Eventfile):-
start_event_trace,
query(X),
stop_event_trace,
save_trace(Eventfile),
write('Result '), write(X),nl.
save_trace(X) :-
write('Saving trace in file '), write(X), write('... '),
open(X,write,Y),
save_event_trace(Y),
close(X),
write('done.'), nl.
time(T) :- statistics(runtime,[_,T]).
%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%
*/
| 25.462264 | 79 | 0.549833 |
ed294635eab524144d3c57f4c2a1d9dc731c8c36 | 2,517 | pm | Perl | lib/MongoDB/InsertManyResult.pm | nunorc/mongo-perl-driver | 8fcdf41bb8e92771df0b68fc52aadf95d2586e62 | [
"Apache-2.0"
]
| null | null | null | lib/MongoDB/InsertManyResult.pm | nunorc/mongo-perl-driver | 8fcdf41bb8e92771df0b68fc52aadf95d2586e62 | [
"Apache-2.0"
]
| null | null | null | lib/MongoDB/InsertManyResult.pm | nunorc/mongo-perl-driver | 8fcdf41bb8e92771df0b68fc52aadf95d2586e62 | [
"Apache-2.0"
]
| null | null | null | #
# Copyright 2014 MongoDB, Inc.
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
#
package MongoDB::InsertManyResult;
# ABSTRACT: MongoDB single insert result object
use version;
our $VERSION = 'v1.5.0';
use Moo;
use MongoDB::_Constants;
use MongoDB::_Types qw(
ArrayOfHashRef
);
use Types::Standard qw(
HashRef
Num
);
use namespace::clean;
with $_ for qw(
MongoDB::Role::_PrivateConstructor
MongoDB::Role::_WriteResult
);
=attr inserted_count
The number of documents inserted.
=cut
has inserted_count => (
is => 'lazy',
builder => '_build_inserted_count',
isa => Num,
);
sub _build_inserted_count
{
my ($self) = @_;
return scalar @{ $self->inserted };
}
=attr inserted
An array reference containing information about inserted documents (if any).
Documents are just as in C<upserted>.
=cut
has inserted => (
is => 'ro',
default => sub { [] },
isa => ArrayOfHashRef,
);
=attr inserted_ids
A hash reference built lazily from C<inserted> mapping indexes to object
IDs.
=cut
has inserted_ids => (
is => 'lazy',
builder => '_build_inserted_ids',
isa => HashRef,
);
sub _build_inserted_ids {
my ($self) = @_;
return { map { $_->{index}, $_->{_id} } @{ $self->inserted } };
}
1;
__END__
=method acknowledged
Indicates whether this write result was acknowledged. Always
true for this class.
=cut
=method assert
Throws an error if write errors or write concern errors occurred.
Otherwise, returns the invocant.
=cut
=method assert_no_write_error
Throws a MongoDB::WriteError if write errors occurred.
Otherwise, returns the invocant.
=cut
=method assert_no_write_concern_error
Throws a MongoDB::WriteConcernError if write concern errors occurred.
Otherwise, returns the invocant.
=cut
=head1 SYNOPSIS
my $result = $coll->insert( $document );
if ( $result->acknowledged ) {
...
}
=head1 DESCRIPTION
This class encapsulates the result from the insertion of a single document.
=cut
| 18.783582 | 76 | 0.702424 |
73d9f75337df209e4bc62de54e709ecd8522d59b | 1,246 | pl | Perl | scripts/matrix_to_text.pl | wkrzemien/j-pet-mlem | 4ed746f3fe79890e4141158cd49d1869938105de | [
"Apache-2.0"
]
| null | null | null | scripts/matrix_to_text.pl | wkrzemien/j-pet-mlem | 4ed746f3fe79890e4141158cd49d1869938105de | [
"Apache-2.0"
]
| 5 | 2018-08-08T08:26:04.000Z | 2020-05-13T13:33:39.000Z | scripts/matrix_to_text.pl | wkrzemien/j-pet-mlem | 4ed746f3fe79890e4141158cd49d1869938105de | [
"Apache-2.0"
]
| 5 | 2018-06-04T21:04:29.000Z | 2021-07-03T14:19:39.000Z | #!/usr/bin/perl -w
=pod
/// uint32_t magic = 'PETt'
/// uint32_t n_pixels_2
/// uint32_t n_emissions // per pixel
/// while (!eof)
/// uint16_t lor_a, lor_b // pair
/// uint32_t pixel_pair_count
/// for(.. count ..)
/// uint16_t t_pixel_x, t_pixel_y
/// uint32_t pixel_hits
=cut
use strict;
while(my $file=shift @ARGV) {
print STDERR $file,"\n";
open(FILE,"<$file") or warn "cannot open file `$file' for reading.";
my $buffer;
read FILE,$buffer,4;
my $magic=unpack "a4", $buffer;
print "magic=$magic\n";
my ($pixels_2,$n_emissions,$n_detectors);
if($magic eq "PETP" ) {
print "PETP\n";
read FILE,$buffer,12;
($pixels_2,$n_emissions,$n_detectors)=unpack "III", $buffer;
} elsif($magic eq "PETs" ) {
print "PETs\n";
read FILE,$buffer,8;
($pixels_2,$n_emissions)=unpack "II", $buffer;
$n_detectors="unknown";
}
print "#$magic $pixels_2 $n_emissions $n_detectors\n";
while(!(eof FILE)) {
read FILE,$buffer,8;
my ($lor_i,$lor_j,$count)=unpack "SSI",$buffer;
print "($lor_i , $lor_j) $count\n";
for(my $i=0;$i<$count;++$i) {
read FILE, $buffer,8;
my ($pix_x,$pix_y,$pix_count)=unpack "SSI",$buffer;
print "$pix_x $pix_y $pix_count\n";
}
}
}
| 23.509434 | 73 | 0.605939 |
ed25d5a355470defd92714abf5874abc605dc3db | 1,781 | pm | Perl | auto-lib/Paws/CostExplorer/CoverageByTime.pm | meis/aws-sdk-perl | 6d61ffcf351e446f06d7e84e53caa08d98573959 | [
"Apache-2.0"
]
| null | null | null | auto-lib/Paws/CostExplorer/CoverageByTime.pm | meis/aws-sdk-perl | 6d61ffcf351e446f06d7e84e53caa08d98573959 | [
"Apache-2.0"
]
| 1 | 2021-05-26T19:13:58.000Z | 2021-05-26T19:13:58.000Z | auto-lib/Paws/CostExplorer/CoverageByTime.pm | meis/aws-sdk-perl | 6d61ffcf351e446f06d7e84e53caa08d98573959 | [
"Apache-2.0"
]
| null | null | null | package Paws::CostExplorer::CoverageByTime;
use Moose;
has Groups => (is => 'ro', isa => 'ArrayRef[Paws::CostExplorer::ReservationCoverageGroup]');
has TimePeriod => (is => 'ro', isa => 'Paws::CostExplorer::DateInterval');
has Total => (is => 'ro', isa => 'Paws::CostExplorer::Coverage');
1;
### main pod documentation begin ###
=head1 NAME
Paws::CostExplorer::CoverageByTime
=head1 USAGE
This class represents one of two things:
=head3 Arguments in a call to a service
Use the attributes of this class as arguments to methods. You shouldn't make instances of this class.
Each attribute should be used as a named argument in the calls that expect this type of object.
As an example, if Att1 is expected to be a Paws::CostExplorer::CoverageByTime object:
$service_obj->Method(Att1 => { Groups => $value, ..., Total => $value });
=head3 Results returned from an API call
Use accessors for each attribute. If Att1 is expected to be an Paws::CostExplorer::CoverageByTime object:
$result = $service_obj->Method(...);
$result->Att1->Groups
=head1 DESCRIPTION
Reservation coverage for a specified period, in hours.
=head1 ATTRIBUTES
=head2 Groups => ArrayRef[L<Paws::CostExplorer::ReservationCoverageGroup>]
The groups of instances that the reservation covered.
=head2 TimePeriod => L<Paws::CostExplorer::DateInterval>
The period that this coverage was used over.
=head2 Total => L<Paws::CostExplorer::Coverage>
The total reservation coverage, in hours.
=head1 SEE ALSO
This class forms part of L<Paws>, describing an object used in L<Paws::CostExplorer>
=head1 BUGS and CONTRIBUTIONS
The source code is located here: L<https://github.com/pplu/aws-sdk-perl>
Please report bugs to: L<https://github.com/pplu/aws-sdk-perl/issues>
=cut
| 25.811594 | 105 | 0.733296 |
ed080d128347956bb04135f8637013c7c9c6708e | 7,992 | t | Perl | t/worksheet/worksheet_cond_format_24.t | lcorbasson/excel-writer-xlsx | c8f60933dffdffd8a4a65360a88a4e206310916a | [
"Artistic-1.0-Perl"
]
| 1 | 2020-08-18T17:23:15.000Z | 2020-08-18T17:23:15.000Z | t/worksheet/worksheet_cond_format_24.t | lcorbasson/excel-writer-xlsx | c8f60933dffdffd8a4a65360a88a4e206310916a | [
"Artistic-1.0-Perl"
]
| null | null | null | t/worksheet/worksheet_cond_format_24.t | lcorbasson/excel-writer-xlsx | c8f60933dffdffd8a4a65360a88a4e206310916a | [
"Artistic-1.0-Perl"
]
| null | null | null | ###############################################################################
#
# Tests for Excel::Writer::XLSX::Worksheet methods.
#
# Copyright 2000-2020, John McNamara, jmcnamara@cpan.org
#
use lib 't/lib';
use TestFunctions qw(_expected_to_aref _got_to_aref _is_deep_diff _new_worksheet);
use strict;
use warnings;
use Test::More tests => 1;
###############################################################################
#
# Tests setup.
#
my $expected;
my $got;
my $caption;
my $worksheet;
###############################################################################
#
# Test the _assemble_xml_file() method.
#
# Test conditional formats.
#
$caption = " \tWorksheet: _assemble_xml_file()";
$worksheet = _new_worksheet(\$got);
$worksheet->select();
# Start test code.
$worksheet->write( 'A1', 1 );
$worksheet->write( 'A2', 2 );
$worksheet->write( 'A3', 3 );
$worksheet->write( 'A4', 4 );
$worksheet->write( 'A5', 5 );
$worksheet->write( 'A6', 6 );
$worksheet->write( 'A7', 7 );
$worksheet->write( 'A8', 8 );
$worksheet->write( 'A9', 9 );
$worksheet->write( 'A12', 75 );
$worksheet->conditional_formatting( 'A1',
{
type => 'icon_set',
icon_style => '3_arrows',
reverse_icons => 1,
}
);
$worksheet->conditional_formatting( 'A2',
{
type => 'icon_set',
icon_style => '3_flags',
icons_only => 1,
}
);
$worksheet->conditional_formatting( 'A3',
{
type => 'icon_set',
icon_style => '3_traffic_lights_rimmed',
icons_only => 1,
reverse_icons => 1,
}
);
$worksheet->conditional_formatting( 'A4',
{
type => 'icon_set',
icon_style => '3_symbols_circled',
icons => [ {value => 80},
{value => 20},
],
}
);
$worksheet->conditional_formatting( 'A5',
{
type => 'icon_set',
icon_style => '4_arrows',
icons => [ {criteria => '>'},
{criteria => '>'},
{criteria => '>'},
],
}
);
$worksheet->conditional_formatting( 'A6',
{
type => 'icon_set',
icon_style => '4_red_to_black',
icons => [ {criteria => '>=', type => 'number', value => 90},
{criteria => '<', type => 'percentile', value => 50},
{criteria => '<=', type => 'percent', value => 25},
],
}
);
$worksheet->conditional_formatting( 'A7',
{
type => 'icon_set',
icon_style => '4_traffic_lights',
icons => [ {value => '=$A$12'} ],
}
);
$worksheet->conditional_formatting( 'A8',
{
type => 'icon_set',
icon_style => '5_arrows_gray',
icons => [ {type => 'formula', value => '=$A$12'} ],
}
);
$worksheet->conditional_formatting( 'A9',
{
type => 'icon_set',
icon_style => '5_quarters',
icons => [ { type => 'percentile', value => 70 },
{ type => 'percentile', value => 50 },
{ type => 'percentile', value => 30 },
{ type => 'percentile', value => 10 },
{ type => 'percentile', value => -1 },
],
reverse_icons => 1,
}
);
# End test code.
$worksheet->_assemble_xml_file();
$expected = _expected_to_aref();
$got = _got_to_aref( $got );
_is_deep_diff( $got, $expected, $caption );
__DATA__
<?xml version="1.0" encoding="UTF-8" standalone="yes"?>
<worksheet xmlns="http://schemas.openxmlformats.org/spreadsheetml/2006/main" xmlns:r="http://schemas.openxmlformats.org/officeDocument/2006/relationships">
<dimension ref="A1:A12"/>
<sheetViews>
<sheetView tabSelected="1" workbookViewId="0"/>
</sheetViews>
<sheetFormatPr defaultRowHeight="15"/>
<sheetData>
<row r="1" spans="1:1">
<c r="A1">
<v>1</v>
</c>
</row>
<row r="2" spans="1:1">
<c r="A2">
<v>2</v>
</c>
</row>
<row r="3" spans="1:1">
<c r="A3">
<v>3</v>
</c>
</row>
<row r="4" spans="1:1">
<c r="A4">
<v>4</v>
</c>
</row>
<row r="5" spans="1:1">
<c r="A5">
<v>5</v>
</c>
</row>
<row r="6" spans="1:1">
<c r="A6">
<v>6</v>
</c>
</row>
<row r="7" spans="1:1">
<c r="A7">
<v>7</v>
</c>
</row>
<row r="8" spans="1:1">
<c r="A8">
<v>8</v>
</c>
</row>
<row r="9" spans="1:1">
<c r="A9">
<v>9</v>
</c>
</row>
<row r="12" spans="1:1">
<c r="A12">
<v>75</v>
</c>
</row>
</sheetData>
<conditionalFormatting sqref="A1">
<cfRule type="iconSet" priority="1">
<iconSet iconSet="3Arrows" reverse="1">
<cfvo type="percent" val="0"/>
<cfvo type="percent" val="33"/>
<cfvo type="percent" val="67"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<conditionalFormatting sqref="A2">
<cfRule type="iconSet" priority="2">
<iconSet iconSet="3Flags" showValue="0">
<cfvo type="percent" val="0"/>
<cfvo type="percent" val="33"/>
<cfvo type="percent" val="67"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<conditionalFormatting sqref="A3">
<cfRule type="iconSet" priority="3">
<iconSet iconSet="3TrafficLights2" showValue="0" reverse="1">
<cfvo type="percent" val="0"/>
<cfvo type="percent" val="33"/>
<cfvo type="percent" val="67"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<conditionalFormatting sqref="A4">
<cfRule type="iconSet" priority="4">
<iconSet iconSet="3Symbols">
<cfvo type="percent" val="0"/>
<cfvo type="percent" val="20"/>
<cfvo type="percent" val="80"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<conditionalFormatting sqref="A5">
<cfRule type="iconSet" priority="5">
<iconSet iconSet="4Arrows">
<cfvo type="percent" val="0"/>
<cfvo type="percent" val="25" gte="0"/>
<cfvo type="percent" val="50" gte="0"/>
<cfvo type="percent" val="75" gte="0"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<conditionalFormatting sqref="A6">
<cfRule type="iconSet" priority="6">
<iconSet iconSet="4RedToBlack">
<cfvo type="percent" val="0"/>
<cfvo type="percent" val="25"/>
<cfvo type="percentile" val="50"/>
<cfvo type="num" val="90"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<conditionalFormatting sqref="A7">
<cfRule type="iconSet" priority="7">
<iconSet iconSet="4TrafficLights">
<cfvo type="percent" val="0"/>
<cfvo type="percent" val="25"/>
<cfvo type="percent" val="50"/>
<cfvo type="percent" val="$A$12"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<conditionalFormatting sqref="A8">
<cfRule type="iconSet" priority="8">
<iconSet iconSet="5ArrowsGray">
<cfvo type="percent" val="0"/>
<cfvo type="percent" val="20"/>
<cfvo type="percent" val="40"/>
<cfvo type="percent" val="60"/>
<cfvo type="formula" val="$A$12"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<conditionalFormatting sqref="A9">
<cfRule type="iconSet" priority="9">
<iconSet iconSet="5Quarters" reverse="1">
<cfvo type="percent" val="0"/>
<cfvo type="percentile" val="10"/>
<cfvo type="percentile" val="30"/>
<cfvo type="percentile" val="50"/>
<cfvo type="percentile" val="70"/>
</iconSet>
</cfRule>
</conditionalFormatting>
<pageMargins left="0.7" right="0.7" top="0.75" bottom="0.75" header="0.3" footer="0.3"/>
</worksheet>
| 26.909091 | 155 | 0.496496 |
ed21a5f1feb77987ceceaaa7195abb4149e57013 | 996 | t | Perl | test/recipes/30-test_evp.t | sandeepboga/openssl | ab8493e32ec37c193c6493e2dae450e4e3431303 | [
"Apache-2.0"
]
| 2 | 2019-07-29T08:08:47.000Z | 2019-07-29T08:08:51.000Z | test/recipes/30-test_evp.t | sandeepboga/openssl | ab8493e32ec37c193c6493e2dae450e4e3431303 | [
"Apache-2.0"
]
| null | null | null | test/recipes/30-test_evp.t | sandeepboga/openssl | ab8493e32ec37c193c6493e2dae450e4e3431303 | [
"Apache-2.0"
]
| null | null | null | #! /usr/bin/env perl
# Copyright 2015-2018 The OpenSSL Project Authors. All Rights Reserved.
#
# Licensed under the Apache License 2.0 (the "License"). You may not use
# this file except in compliance with the License. You can obtain a copy
# in the file LICENSE in the source distribution or at
# https://www.openssl.org/source/license.html
use strict;
use warnings;
use OpenSSL::Test qw(:DEFAULT data_file bldtop_dir srctop_file);
setup("test_evp");
my @configs = qw( default-and-legacy.cnf fips.cnf );
my @files = qw( evpciph.txt evpdigest.txt evpencod.txt evpkdf.txt
evppkey_kdf.txt evpmac.txt evppbe.txt evppkey.txt
evppkey_ecc.txt evpcase.txt evpaessiv.txt evpccmcavs.txt );
plan tests => scalar(@configs) * scalar(@files);
$ENV{OPENSSL_MODULES} = bldtop_dir("providers");
foreach (@configs) {
$ENV{OPENSSL_CONF} = srctop_file("test", $_);
foreach my $f ( @files ) {
ok(run(test(["evp_test", data_file("$f")])),
"running evp_test $f");
}
}
| 29.294118 | 73 | 0.699799 |
ed11dd00739adad97c3fa349de1952134df48463 | 593 | pm | Perl | lib/Monitorel/Worker/Dequeue.pm | yuuki/Monitorel | 9e853f6d10bfd40f66b1cce98664235db91d8d84 | [
"Artistic-1.0"
]
| 1 | 2017-07-04T08:04:33.000Z | 2017-07-04T08:04:33.000Z | lib/Monitorel/Worker/Dequeue.pm | yuuki/Monitorel | 9e853f6d10bfd40f66b1cce98664235db91d8d84 | [
"Artistic-1.0"
]
| null | null | null | lib/Monitorel/Worker/Dequeue.pm | yuuki/Monitorel | 9e853f6d10bfd40f66b1cce98664235db91d8d84 | [
"Artistic-1.0"
]
| null | null | null | package Monitorel::Worker::Dequeue;
use strict;
use warnings;
use Parallel::Prefork;
sub run {
my ($class, $workers, $max_worker_num) = @_;
$max_worker_num ||= 4;
my $pm = Parallel::Prefork->new({
max_workers => $max_worker_num,
trap_signals => {
TERM => 'TERM',
HUP => 'TERM',
INT => 'TERM',
USR1 => undef,
}
});
while ($pm->signal_received !~ /^(?:TERM|INT)$/) {
$pm->start and next;
$class->dequeue($workers);
$pm->finish;
}
$pm->wait_all_children;
}
1;
| 17.441176 | 54 | 0.500843 |
73d1a5779ba3cb681677d3589f99da7cafe121f7 | 3,936 | pl | Perl | Script/qltruonghoc_test.pl | SummerSad/DoAn02-LogicBacNhat | e70298cac3d07965c463b8c40168d2aae508cbe3 | [
"MIT"
]
| null | null | null | Script/qltruonghoc_test.pl | SummerSad/DoAn02-LogicBacNhat | e70298cac3d07965c463b8c40168d2aae508cbe3 | [
"MIT"
]
| null | null | null | Script/qltruonghoc_test.pl | SummerSad/DoAn02-LogicBacNhat | e70298cac3d07965c463b8c40168d2aae508cbe3 | [
"MIT"
]
| 1 | 2019-11-25T13:05:51.000Z | 2019-11-25T13:05:51.000Z | :- [qltruonghoc, writeln].
:- writeln('Go cau_1., cau_2, ... cau_25. de xem cau hoi va cau tra loi').
cau_1 :-
writeln('Nguyen Dinh Thuc la giao vien dung hay sai ?'),
giao_vien('Nguyen Dinh Thuc') -> writeln('Dung'); writeln('Sai').
cau_2 :-
writeln('Giao vien Le Hoai Bac la giao su dung hay sai ?'),
giao_su('Le Hoai Bac') -> writeln('Dung'); writeln('Sai').
cau_3 :-
writeln('Giao vien Le Quang Vinh la pho giao su dung hay sai ?'),
pho_giao_su('Le Quang Vinh') -> writeln('Dung'); writeln('Sai').
cau_4 :-
writeln('Giao vien Hien Ho la nghien cuu sinh dung hay sai ?'),
nghien_cuu_sinh('Hien Ho') -> writeln('Dung'); writeln('Sai').
cau_5 :-
writeln('Cho biet ngay sinh cua giao vien Ha Anh Tuan'),
ngay_sinh('Ha Anh Tuan', NgaySinh) -> writeln(NgaySinh); writeln('Khong biet').
cau_6 :-
writeln('Cho biet ngay sinh cua giao vien Cong Phuong'),
ngay_sinh('Cong Phuong', NgaySinh) -> writeln(NgaySinh); writeln('Khong biet').
cau_7 :-
writeln('Cho biet dia chi cua giao vien Anh Duc'),
dia_chi('Anh Duc', DiaChi) -> writeln(DiaChi); writeln('Khong biet').
cau_8 :-
writeln('Cho biet que quan cua giao vien Bich Phuong'),
que_quan('Bich Phuong', QueQuan) -> writeln(QueQuan); writeln('Khong biet').
cau_9 :-
writeln('Cho biet tien luong cua giao vien Bui Tien Dung'),
luong('Bui Tien Dung', Luong) -> writeln(Luong); writeln('Khong biet').
cau_10 :-
writeln('Cho biet tien luong cua giao vien Luong Dinh Hoa'),
luong('Luong Dinh Hoa', Luong) -> writeln(Luong); writeln('Khong biet').
cau_11 :-
writeln('Cho biet Nguyen Dinh Thuc thuoc bo mon nao'),
giao_vien_thuoc_bo_mon('Nguyen Dinh Thuc', BM) -> writeln(BM); writeln('Khong biet').
cau_12 :-
writeln('Cho biet giao vien Ha Anh Tuan thuoc doan the nao'),
giao_vien_thuoc_doan_the('Ha Anh Tuan', DoanThe) -> writeln(DoanThe); writeln('Khong biet').
cau_13 :-
writeln('Cho biet giao vien Bui Tien Dung thuoc phong ban nao'),
giao_vien_thuoc_phong_ban('Bui Tien Dung', PhongBan) -> writeln(PhongBan); writeln('Khong biet').
cau_14 :-
writeln('Liet ke danh sach khen thuong'),
findall(GV, khen_thuong(GV), List),
writeln(List).
cau_15 :-
writeln('Liet ke danh sach ky luat'),
findall(GV, ky_luat(GV), List),
writeln(List).
cau_16 :-
writeln('Cho biet giao vien cung bo mon voi Cong Phuong'),
findall(GV, giao_vien_cung_bo_mon('Cong Phuong', GV), List),
writeln(List).
cau_17 :-
writeln('Vo Thien Kim va Ly Tieu Long la giao vien cung khoa dung hay sai ?'),
giao_vien_cung_khoa('Vo Thien Kim', 'Ly Tieu Long') -> writeln('Dung'); writeln('Sai').
cau_18 :-
writeln('Bo mon Giai tich va Di truyen thuoc cung khoa dung hay sai ?'),
bo_mon_cung_khoa('Giai tich', 'Di truyen') -> writeln('Dung'); writeln('Sai').
cau_19 :-
writeln('Phong dao tao va Ban du an cung thuoc mot truong dung hay sai ?'),
phong_ban_cung_truong('Phong dao tao', 'Ban du an') -> writeln('Dung'); writeln('Sai').
cau_20 :-
writeln('Cho biet tuoi cua giao vien Luong Dinh Hoa'),
tuoi_tac('Luong Dinh Hoa', Tuoi) -> writeln(Tuoi); writeln('Khong biet').
cau_21 :-
writeln('Cho biet cac giao vien lon tuoi hon giao vien Hien Ho'),
findall(GV, tuoi_lon_hon(GV, 'Hien Ho'), List),
writeln(List).
cau_22 :-
writeln('Cho biet cac giao vien nho tuoi hon giao vien Cong Phuong'),
findall(GV, tuoi_nho_hon(GV, 'Cong Phuong'), List),
writeln(List).
cau_23 :-
writeln('Cho biet giao vien cung phong ban voi Hien Ho'),
findall(GV, giao_vien_cung_doan_the('Hien Ho', GV), List),
writeln(List).
cau_24 :-
writeln('Giao vien Bich Phuong va giao vien Bui Tien Dung co cung phong ban hay khong ?'),
giao_vien_thuoc_phong_ban('Bich Phuong', 'Bui Tien Dung') -> writeln('Co'); writeln('Khong').
cau_25 :-
writeln('Bo mon nao cung khoa voi bo mon Khoa hoc may tinh ?'),
findall(BM, bo_mon_cung_khoa('Khoa hoc may tinh', BM), List),
writeln(List). | 35.781818 | 99 | 0.673526 |
ed3f8c74dcb3da28f5568509a2fa10d03e5971f1 | 4,395 | t | Perl | gnu/usr.bin/perl/cpan/IO-Compress/t/105oneshot-zip-bzip2-only.t | ArrogantWombatics/openbsd-src | 75721e1d44322953075b7c4b89337b163a395291 | [
"BSD-3-Clause"
]
| 2 | 2018-06-15T08:32:44.000Z | 2019-01-12T03:20:41.000Z | openresty-win32-build/thirdparty/perl5-5.29.6/cpan/IO-Compress/t/105oneshot-zip-bzip2-only.t | nneesshh/openresty-win32-build | bfbb9d7526020eda1788a0ed24f2be3c8be5c1c3 | [
"MIT"
]
| 1 | 2018-08-21T03:56:33.000Z | 2018-08-21T03:56:33.000Z | openresty-win32-build/thirdparty/perl5-5.29.6/cpan/IO-Compress/t/105oneshot-zip-bzip2-only.t | nneesshh/openresty-win32-build | bfbb9d7526020eda1788a0ed24f2be3c8be5c1c3 | [
"MIT"
]
| null | null | null | BEGIN {
if ($ENV{PERL_CORE}) {
chdir 't' if -d 't';
@INC = ("../lib", "lib/compress");
}
}
use lib qw(t t/compress);
use strict;
use warnings;
use bytes;
use Test::More ;
use CompTestUtils;
BEGIN {
plan(skip_all => "oneshot needs Perl 5.005 or better - you have Perl $]" )
if $] < 5.005 ;
plan(skip_all => "IO::Compress::Bzip2 not available" )
unless eval { require IO::Compress::Bzip2;
require IO::Uncompress::Bunzip2;
1
} ;
# use Test::NoWarnings, if available
my $extra = 0 ;
$extra = 1
if eval { require Test::NoWarnings ; import Test::NoWarnings; 1 };
plan tests => 248 + $extra ;
#use_ok('IO::Compress::Zip', qw(zip $ZipError :zip_method)) ;
use_ok('IO::Compress::Zip', qw(:all)) ;
use_ok('IO::Uncompress::Unzip', qw(unzip $UnzipError)) ;
}
sub zipGetHeader
{
my $in = shift;
my $content = shift ;
my %opts = @_ ;
my $out ;
my $got ;
ok zip($in, \$out, %opts), " zip ok" ;
ok unzip(\$out, \$got), " unzip ok"
or diag $UnzipError ;
is $got, $content, " got expected content" ;
my $gunz = new IO::Uncompress::Unzip \$out, Strict => 0
or diag "UnzipError is $IO::Uncompress::Unzip::UnzipError" ;
ok $gunz, " Created IO::Uncompress::Unzip object";
my $hdr = $gunz->getHeaderInfo();
ok $hdr, " got Header info";
my $uncomp ;
ok $gunz->read($uncomp), " read ok" ;
is $uncomp, $content, " got expected content";
ok $gunz->close, " closed ok" ;
return $hdr ;
}
for my $input (0, 1)
{
for my $stream (0, 1)
{
for my $zip64 (0, 1)
{
#next if $zip64 && ! $stream;
for my $method (ZIP_CM_STORE, ZIP_CM_DEFLATE, ZIP_CM_BZIP2)
{
title "Input $input, Stream $stream, Zip64 $zip64, Method $method";
my $lex1 = new LexFile my $file1;
my $lex2 = new LexFile my $file2;
my $content = "hello ";
my $in ;
if ($input)
{
writeFile($file2, $content);
$in = $file2;
}
else
{
$in = \$content;
}
ok zip($in => $file1 , Method => $method,
Zip64 => $zip64,
Stream => $stream), " zip ok"
or diag $ZipError ;
my $got ;
ok unzip($file1 => \$got), " unzip ok"
or diag $UnzipError ;
is $got, $content, " content ok";
my $u = new IO::Uncompress::Unzip $file1
or diag $ZipError ;
my $hdr = $u->getHeaderInfo();
ok $hdr, " got header";
is $hdr->{Stream}, $stream, " stream is $stream" ;
is $hdr->{MethodID}, $method, " MethodID is $method" ;
is $hdr->{Zip64}, $zip64, " Zip64 is $zip64" ;
}
}
}
}
for my $stream (0, 1)
{
for my $zip64 (0, 1)
{
next if $zip64 && ! $stream;
for my $method (ZIP_CM_STORE, ZIP_CM_DEFLATE, ZIP_CM_BZIP2)
{
title "Stream $stream, Zip64 $zip64, Method $method";
my $file1;
my $file2;
my $zipfile;
my $lex = new LexFile $file1, $file2, $zipfile;
my $content1 = "hello ";
writeFile($file1, $content1);
my $content2 = "goodbye ";
writeFile($file2, $content2);
my %content = ( $file1 => $content1,
$file2 => $content2,
);
ok zip([$file1, $file2] => $zipfile , Method => $method,
Zip64 => $zip64,
Stream => $stream), " zip ok"
or diag $ZipError ;
for my $file ($file1, $file2)
{
my $got ;
ok unzip($zipfile => \$got, Name => $file), " unzip $file ok"
or diag $UnzipError ;
is $got, $content{$file}, " content ok";
}
}
}
}
# TODO add more error cases
| 26.317365 | 83 | 0.440046 |
ed3cd678fb60edee856aa011dde02924155dbc33 | 745 | t | Perl | t/plugins.t | gitpan/HTML-Widget-Factory | 3172e5ab6c0b862e7533b595e51dd7fe8541f569 | [
"Artistic-1.0"
]
| null | null | null | t/plugins.t | gitpan/HTML-Widget-Factory | 3172e5ab6c0b862e7533b595e51dd7fe8541f569 | [
"Artistic-1.0"
]
| null | null | null | t/plugins.t | gitpan/HTML-Widget-Factory | 3172e5ab6c0b862e7533b595e51dd7fe8541f569 | [
"Artistic-1.0"
]
| null | null | null | #!perl
use strict;
use warnings;
use Test::More;
use HTML::Widget::Factory;
my @expected = qw(
HTML::Widget::Plugin::Attrs
HTML::Widget::Plugin::Button
HTML::Widget::Plugin::Checkbox
HTML::Widget::Plugin::Image
HTML::Widget::Plugin::Input
HTML::Widget::Plugin::Link
HTML::Widget::Plugin::Multiselect
HTML::Widget::Plugin::Password
HTML::Widget::Plugin::Radio
HTML::Widget::Plugin::Select
HTML::Widget::Plugin::Submit
HTML::Widget::Plugin::Textarea
);
plan tests => 1 + @expected;
my $factory = HTML::Widget::Factory->new;
isa_ok($factory, 'HTML::Widget::Factory');
my @plugins = $factory->plugins;
for my $plugin (@expected) {
ok(
(grep { $_->isa($plugin) } @plugins),
"core plugin $plugin found",
);
}
| 20.694444 | 42 | 0.669799 |
ed13485de5848971e5a23fc44b7ec0cd9d6a6965 | 10,598 | pl | Perl | webapp/perl/local/lib/perl5/auto/share/dist/DateTime-Locale/fa.pl | AK-10/AK-10-isucon8-preliminary-revenge | f390710721b2f2e3d9f60120394ec37c9c96b975 | [
"MIT"
]
| 2 | 2019-04-15T04:28:23.000Z | 2019-04-16T12:45:51.000Z | webapp/perl/local/lib/perl5/auto/share/dist/DateTime-Locale/fa.pl | AK-10/AK-10-isucon8-preliminary-revenge | f390710721b2f2e3d9f60120394ec37c9c96b975 | [
"MIT"
]
| 16 | 2019-08-28T23:45:01.000Z | 2019-12-20T02:12:13.000Z | webapp/perl/local/lib/perl5/auto/share/dist/DateTime-Locale/fa.pl | AK-10/AK-10-isucon8-preliminary-revenge | f390710721b2f2e3d9f60120394ec37c9c96b975 | [
"MIT"
]
| 1 | 2019-04-14T01:11:20.000Z | 2019-04-14T01:11:20.000Z | {
am_pm_abbreviated => [
"\N{U+0642}.\N{U+0638}.",
"\N{U+0628}.\N{U+0638}.",
],
available_formats => {
Bh => "h B",
Bhm => "h:mm B",
Bhms => "h:mm:ss B",
E => "ccc",
EBhm => "E h:mm B",
EBhms => "E h:mm:ss B",
EHm => "E H:mm",
EHms => "E H:mm:ss",
Ed => "E d",
Ehm => "E h:mm a",
Ehms => "E h:mm:ss a",
Gy => "y G",
GyMMM => "MMM y G",
GyMMMEd => "E d MMM y G",
GyMMMd => "d MMM y G",
H => "H",
HHmmZ => "HH:mm (Z)",
Hm => "H:mm",
Hms => "H:mm:ss",
Hmsv => "HH:mm:ss v",
Hmv => "HH:mm v",
M => "L",
MEd => "E M/d",
MMM => "LLL",
MMMEd => "E d LLL",
MMMMEd => "E d LLLL",
"MMMMW-count-one" => "\N{U+0647}\N{U+0641}\N{U+062a}\N{U+0647} W \N{U+0627}\N{U+0632} MMM",
"MMMMW-count-other" => "\N{U+0647}\N{U+0641}\N{U+062a}\N{U+0647} W \N{U+0627}\N{U+0632} MMM",
MMMMd => "d LLLL",
MMMd => "d LLL",
Md => "M/d",
d => "d",
h => "h a",
hm => "h:mm a",
hms => "h:mm:ss a",
hmsv => "h:mm:ss a v",
hmv => "h:mm a v",
mmss => "mm:ss",
ms => "mm:ss",
y => "y",
yM => "y/M",
yMEd => "E y/M/d",
yMMM => "MMM y",
yMMMEd => "E d MMM y",
yMMMM => "MMMM y",
yMMMMEEEEd => "EEEE d MMMM y",
yMMMd => "d MMM y",
yMd => "y/M/d",
yQQQ => "QQQQ y",
yQQQQ => "QQQQ y",
"yw-count-one" => "\N{U+0647}\N{U+0641}\N{U+062a}\N{U+0647} w \N{U+0627}\N{U+0632} Y",
"yw-count-other" => "\N{U+0647}\N{U+0641}\N{U+062a}\N{U+0647} w \N{U+0627}\N{U+0632} Y",
},
code => "fa",
date_format_full => "EEEE d MMMM y",
date_format_long => "d MMMM y",
date_format_medium => "d MMM y",
date_format_short => "y/M/d",
datetime_format_full => "{1}\N{U+060c} \N{U+0633}\N{U+0627}\N{U+0639}\N{U+062a} {0}",
datetime_format_long => "{1}\N{U+060c} \N{U+0633}\N{U+0627}\N{U+0639}\N{U+062a} {0}",
datetime_format_medium => "{1}\N{U+060c}\N{U+200f} {0}",
datetime_format_short => "{1}\N{U+060c}\N{U+200f} {0}",
day_format_abbreviated => [
"\N{U+062f}\N{U+0648}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+0686}\N{U+0647}\N{U+0627}\N{U+0631}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+067e}\N{U+0646}\N{U+062c}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+062c}\N{U+0645}\N{U+0639}\N{U+0647}",
"\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+06cc}\N{U+06a9}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
],
day_format_narrow => [
"\N{U+062f}",
"\N{U+0633}",
"\N{U+0686}",
"\N{U+067e}",
"\N{U+062c}",
"\N{U+0634}",
"\N{U+06cc}",
],
day_format_wide => [
"\N{U+062f}\N{U+0648}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+0686}\N{U+0647}\N{U+0627}\N{U+0631}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+067e}\N{U+0646}\N{U+062c}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+062c}\N{U+0645}\N{U+0639}\N{U+0647}",
"\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+06cc}\N{U+06a9}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
],
day_stand_alone_abbreviated => [
"\N{U+062f}\N{U+0648}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+0686}\N{U+0647}\N{U+0627}\N{U+0631}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+067e}\N{U+0646}\N{U+062c}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+062c}\N{U+0645}\N{U+0639}\N{U+0647}",
"\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+06cc}\N{U+06a9}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
],
day_stand_alone_narrow => [
"\N{U+062f}",
"\N{U+0633}",
"\N{U+0686}",
"\N{U+067e}",
"\N{U+062c}",
"\N{U+0634}",
"\N{U+06cc}",
],
day_stand_alone_wide => [
"\N{U+062f}\N{U+0648}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+0686}\N{U+0647}\N{U+0627}\N{U+0631}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+067e}\N{U+0646}\N{U+062c}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+062c}\N{U+0645}\N{U+0639}\N{U+0647}",
"\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
"\N{U+06cc}\N{U+06a9}\N{U+0634}\N{U+0646}\N{U+0628}\N{U+0647}",
],
era_abbreviated => [
"\N{U+0642}.\N{U+0645}.",
"\N{U+0645}.",
],
era_narrow => [
"\N{U+0642}",
"\N{U+0645}",
],
era_wide => [
"\N{U+0642}\N{U+0628}\N{U+0644} \N{U+0627}\N{U+0632} \N{U+0645}\N{U+06cc}\N{U+0644}\N{U+0627}\N{U+062f}",
"\N{U+0645}\N{U+06cc}\N{U+0644}\N{U+0627}\N{U+062f}\N{U+06cc}",
],
first_day_of_week => 1,
glibc_date_1_format => "%a %b %e %H:%M:%S %Z %Y",
glibc_date_format => "%m/%d/%y",
glibc_datetime_format => "%a %b %e %H:%M:%S %Y",
glibc_time_12_format => "%I:%M:%S %p",
glibc_time_format => "%H:%M:%S",
language => "Persian",
month_format_abbreviated => [
"\N{U+0698}\N{U+0627}\N{U+0646}\N{U+0648}\N{U+06cc}\N{U+0647}\N{U+0654}",
"\N{U+0641}\N{U+0648}\N{U+0631}\N{U+06cc}\N{U+0647}\N{U+0654}",
"\N{U+0645}\N{U+0627}\N{U+0631}\N{U+0633}",
"\N{U+0622}\N{U+0648}\N{U+0631}\N{U+06cc}\N{U+0644}",
"\N{U+0645}\N{U+0647}\N{U+0654}",
"\N{U+0698}\N{U+0648}\N{U+0626}\N{U+0646}",
"\N{U+0698}\N{U+0648}\N{U+0626}\N{U+06cc}\N{U+0647}\N{U+0654}",
"\N{U+0627}\N{U+0648}\N{U+062a}",
"\N{U+0633}\N{U+067e}\N{U+062a}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
"\N{U+0627}\N{U+06a9}\N{U+062a}\N{U+0628}\N{U+0631}",
"\N{U+0646}\N{U+0648}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
"\N{U+062f}\N{U+0633}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
],
month_format_narrow => [
"\N{U+0698}",
"\N{U+0641}",
"\N{U+0645}",
"\N{U+0622}",
"\N{U+0645}",
"\N{U+0698}",
"\N{U+0698}",
"\N{U+0627}",
"\N{U+0633}",
"\N{U+0627}",
"\N{U+0646}",
"\N{U+062f}",
],
month_format_wide => [
"\N{U+0698}\N{U+0627}\N{U+0646}\N{U+0648}\N{U+06cc}\N{U+0647}\N{U+0654}",
"\N{U+0641}\N{U+0648}\N{U+0631}\N{U+06cc}\N{U+0647}\N{U+0654}",
"\N{U+0645}\N{U+0627}\N{U+0631}\N{U+0633}",
"\N{U+0622}\N{U+0648}\N{U+0631}\N{U+06cc}\N{U+0644}",
"\N{U+0645}\N{U+0647}\N{U+0654}",
"\N{U+0698}\N{U+0648}\N{U+0626}\N{U+0646}",
"\N{U+0698}\N{U+0648}\N{U+0626}\N{U+06cc}\N{U+0647}\N{U+0654}",
"\N{U+0627}\N{U+0648}\N{U+062a}",
"\N{U+0633}\N{U+067e}\N{U+062a}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
"\N{U+0627}\N{U+06a9}\N{U+062a}\N{U+0628}\N{U+0631}",
"\N{U+0646}\N{U+0648}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
"\N{U+062f}\N{U+0633}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
],
month_stand_alone_abbreviated => [
"\N{U+0698}\N{U+0627}\N{U+0646}\N{U+0648}\N{U+06cc}\N{U+0647}",
"\N{U+0641}\N{U+0648}\N{U+0631}\N{U+06cc}\N{U+0647}",
"\N{U+0645}\N{U+0627}\N{U+0631}\N{U+0633}",
"\N{U+0622}\N{U+0648}\N{U+0631}\N{U+06cc}\N{U+0644}",
"\N{U+0645}\N{U+0647}",
"\N{U+0698}\N{U+0648}\N{U+0626}\N{U+0646}",
"\N{U+0698}\N{U+0648}\N{U+0626}\N{U+06cc}\N{U+0647}",
"\N{U+0627}\N{U+0648}\N{U+062a}",
"\N{U+0633}\N{U+067e}\N{U+062a}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
"\N{U+0627}\N{U+06a9}\N{U+062a}\N{U+0628}\N{U+0631}",
"\N{U+0646}\N{U+0648}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
"\N{U+062f}\N{U+0633}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
],
month_stand_alone_narrow => [
"\N{U+0698}",
"\N{U+0641}",
"\N{U+0645}",
"\N{U+0622}",
"\N{U+0645}",
"\N{U+0698}",
"\N{U+0698}",
"\N{U+0627}",
"\N{U+0633}",
"\N{U+0627}",
"\N{U+0646}",
"\N{U+062f}",
],
month_stand_alone_wide => [
"\N{U+0698}\N{U+0627}\N{U+0646}\N{U+0648}\N{U+06cc}\N{U+0647}",
"\N{U+0641}\N{U+0648}\N{U+0631}\N{U+06cc}\N{U+0647}",
"\N{U+0645}\N{U+0627}\N{U+0631}\N{U+0633}",
"\N{U+0622}\N{U+0648}\N{U+0631}\N{U+06cc}\N{U+0644}",
"\N{U+0645}\N{U+0647}",
"\N{U+0698}\N{U+0648}\N{U+0626}\N{U+0646}",
"\N{U+0698}\N{U+0648}\N{U+0626}\N{U+06cc}\N{U+0647}",
"\N{U+0627}\N{U+0648}\N{U+062a}",
"\N{U+0633}\N{U+067e}\N{U+062a}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
"\N{U+0627}\N{U+06a9}\N{U+062a}\N{U+0628}\N{U+0631}",
"\N{U+0646}\N{U+0648}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
"\N{U+062f}\N{U+0633}\N{U+0627}\N{U+0645}\N{U+0628}\N{U+0631}",
],
name => "Persian",
native_language => "\N{U+0641}\N{U+0627}\N{U+0631}\N{U+0633}\N{U+06cc}",
native_name => "\N{U+0641}\N{U+0627}\N{U+0631}\N{U+0633}\N{U+06cc}",
native_script => undef,
native_territory => undef,
native_variant => undef,
quarter_format_abbreviated => [
"\N{U+0633}\N{U+200c}\N{U+0645}\N{U+06f1}",
"\N{U+0633}\N{U+200c}\N{U+0645}\N{U+06f2}",
"\N{U+0633}\N{U+200c}\N{U+0645}\N{U+06f3}",
"\N{U+0633}\N{U+200c}\N{U+0645}\N{U+06f4}",
],
quarter_format_narrow => [
"\N{U+06f1}",
"\N{U+06f2}",
"\N{U+06f3}",
"\N{U+06f4}",
],
quarter_format_wide => [
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0645}\N{U+0627}\N{U+0647}\N{U+0647}\N{U+0654} \N{U+0627}\N{U+0648}\N{U+0644}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0645}\N{U+0627}\N{U+0647}\N{U+0647}\N{U+0654} \N{U+062f}\N{U+0648}\N{U+0645}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0645}\N{U+0627}\N{U+0647}\N{U+0647}\N{U+0654} \N{U+0633}\N{U+0648}\N{U+0645}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0645}\N{U+0627}\N{U+0647}\N{U+0647}\N{U+0654} \N{U+0686}\N{U+0647}\N{U+0627}\N{U+0631}\N{U+0645}",
],
quarter_stand_alone_abbreviated => [
"\N{U+0633}\N{U+200c}\N{U+0645}\N{U+06f1}",
"\N{U+0633}\N{U+200c}\N{U+0645}\N{U+06f2}",
"\N{U+0633}\N{U+200c}\N{U+0645}\N{U+06f3}",
"\N{U+0633}\N{U+200c}\N{U+0645}\N{U+06f4}",
],
quarter_stand_alone_narrow => [
"\N{U+06f1}",
"\N{U+06f2}",
"\N{U+06f3}",
"\N{U+06f4}",
],
quarter_stand_alone_wide => [
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0645}\N{U+0627}\N{U+0647}\N{U+0647}\N{U+0654} \N{U+0627}\N{U+0648}\N{U+0644}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0645}\N{U+0627}\N{U+0647}\N{U+0647}\N{U+0654} \N{U+062f}\N{U+0648}\N{U+0645}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0645}\N{U+0627}\N{U+0647}\N{U+0647}\N{U+0654} \N{U+0633}\N{U+0648}\N{U+0645}",
"\N{U+0633}\N{U+0647}\N{U+200c}\N{U+0645}\N{U+0627}\N{U+0647}\N{U+0647}\N{U+0654} \N{U+0686}\N{U+0647}\N{U+0627}\N{U+0631}\N{U+0645}",
],
script => undef,
territory => undef,
time_format_full => "H:mm:ss (zzzz)",
time_format_long => "H:mm:ss (z)",
time_format_medium => "H:mm:ss",
time_format_short => "H:mm",
variant => undef,
version => 33,
}
| 38.259928 | 138 | 0.508681 |
73d0746eb94acfdb1f80a133872e78ae0be1134e | 52,379 | pl | Perl | crypto/ec/asm/ecp_nistz256-ppc64.pl | vohongnhuy/openssl | 59de7c93ae682330f9bfb328a6e4ac476a8d02db | [
"OpenSSL"
]
| 15 | 2019-01-21T14:31:40.000Z | 2021-04-13T12:28:26.000Z | crypto/ec/asm/ecp_nistz256-ppc64.pl | vohongnhuy/openssl | 59de7c93ae682330f9bfb328a6e4ac476a8d02db | [
"OpenSSL"
]
| 12 | 2021-07-05T11:51:19.000Z | 2022-02-25T01:06:41.000Z | crypto/ec/asm/ecp_nistz256-ppc64.pl | vohongnhuy/openssl | 59de7c93ae682330f9bfb328a6e4ac476a8d02db | [
"OpenSSL"
]
| 6 | 2019-07-16T13:36:07.000Z | 2021-03-19T15:27:35.000Z | #! /usr/bin/env perl
#
# ====================================================================
# Written by Andy Polyakov <appro@openssl.org> for the OpenSSL
# project. The module is, however, dual licensed under OpenSSL and
# CRYPTOGAMS licenses depending on where you obtain it. For further
# details see http://www.openssl.org/~appro/cryptogams/.
# ====================================================================
#
# ECP_NISTZ256 module for PPC64.
#
# August 2016.
#
# Original ECP_NISTZ256 submission targeting x86_64 is detailed in
# http://eprint.iacr.org/2013/816.
#
# with/without -DECP_NISTZ256_ASM
# POWER7 +260-530%
# POWER8 +220-340%
$flavour = shift;
while (($output=shift) && ($output!~/\w[\w\-]*\.\w+$/)) {}
$0 =~ m/(.*[\/\\])[^\/\\]+$/; $dir=$1;
( $xlate="${dir}ppc-xlate.pl" and -f $xlate ) or
( $xlate="${dir}../../perlasm/ppc-xlate.pl" and -f $xlate) or
die "can't locate ppc-xlate.pl";
open OUT,"| \"$^X\" $xlate $flavour $output";
*STDOUT=*OUT;
my $sp="r1";
{
my ($rp,$ap,$bp,$bi,$acc0,$acc1,$acc2,$acc3,$poly1,$poly3,
$acc4,$acc5,$a0,$a1,$a2,$a3,$t0,$t1,$t2,$t3) =
map("r$_",(3..12,22..31));
my ($acc6,$acc7)=($bp,$bi); # used in __ecp_nistz256_sqr_mont
$code.=<<___;
.machine "any"
.text
___
########################################################################
# Convert ecp_nistz256_table.c to layout expected by ecp_nistz_gather_w7
#
$0 =~ m/(.*[\/\\])[^\/\\]+$/; $dir=$1;
open TABLE,"<ecp_nistz256_table.c" or
open TABLE,"<${dir}../ecp_nistz256_table.c" or
die "failed to open ecp_nistz256_table.c:",$!;
use integer;
foreach(<TABLE>) {
s/TOBN\(\s*(0x[0-9a-f]+),\s*(0x[0-9a-f]+)\s*\)/push @arr,hex($2),hex($1)/geo;
}
close TABLE;
# See ecp_nistz256_table.c for explanation for why it's 64*16*37.
# 64*16*37-1 is because $#arr returns last valid index or @arr, not
# amount of elements.
die "insane number of elements" if ($#arr != 64*16*37-1);
$code.=<<___;
.type ecp_nistz256_precomputed,\@object
.globl ecp_nistz256_precomputed
.align 12
ecp_nistz256_precomputed:
___
########################################################################
# this conversion smashes P256_POINT_AFFINE by individual bytes with
# 64 byte interval, similar to
# 1111222233334444
# 1234123412341234
for(1..37) {
@tbl = splice(@arr,0,64*16);
for($i=0;$i<64;$i++) {
undef @line;
for($j=0;$j<64;$j++) {
push @line,(@tbl[$j*16+$i/4]>>(($i%4)*8))&0xff;
}
$code.=".byte\t";
$code.=join(',',map { sprintf "0x%02x",$_} @line);
$code.="\n";
}
}
$code.=<<___;
.size ecp_nistz256_precomputed,.-ecp_nistz256_precomputed
.asciz "ECP_NISTZ256 for PPC64, CRYPTOGAMS by <appro\@openssl.org>"
# void ecp_nistz256_mul_mont(BN_ULONG x0[4],const BN_ULONG x1[4],
# const BN_ULONG x2[4]);
.globl ecp_nistz256_mul_mont
.align 5
ecp_nistz256_mul_mont:
stdu $sp,-128($sp)
mflr r0
std r22,48($sp)
std r23,56($sp)
std r24,64($sp)
std r25,72($sp)
std r26,80($sp)
std r27,88($sp)
std r28,96($sp)
std r29,104($sp)
std r30,112($sp)
std r31,120($sp)
ld $a0,0($ap)
ld $bi,0($bp)
ld $a1,8($ap)
ld $a2,16($ap)
ld $a3,24($ap)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
bl __ecp_nistz256_mul_mont
mtlr r0
ld r22,48($sp)
ld r23,56($sp)
ld r24,64($sp)
ld r25,72($sp)
ld r26,80($sp)
ld r27,88($sp)
ld r28,96($sp)
ld r29,104($sp)
ld r30,112($sp)
ld r31,120($sp)
addi $sp,$sp,128
blr
.long 0
.byte 0,12,4,0,0x80,10,3,0
.long 0
.size ecp_nistz256_mul_mont,.-ecp_nistz256_mul_mont
# void ecp_nistz256_sqr_mont(BN_ULONG x0[4],const BN_ULONG x1[4]);
.globl ecp_nistz256_sqr_mont
.align 4
ecp_nistz256_sqr_mont:
stdu $sp,-128($sp)
mflr r0
std r22,48($sp)
std r23,56($sp)
std r24,64($sp)
std r25,72($sp)
std r26,80($sp)
std r27,88($sp)
std r28,96($sp)
std r29,104($sp)
std r30,112($sp)
std r31,120($sp)
ld $a0,0($ap)
ld $a1,8($ap)
ld $a2,16($ap)
ld $a3,24($ap)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
bl __ecp_nistz256_sqr_mont
mtlr r0
ld r22,48($sp)
ld r23,56($sp)
ld r24,64($sp)
ld r25,72($sp)
ld r26,80($sp)
ld r27,88($sp)
ld r28,96($sp)
ld r29,104($sp)
ld r30,112($sp)
ld r31,120($sp)
addi $sp,$sp,128
blr
.long 0
.byte 0,12,4,0,0x80,10,2,0
.long 0
.size ecp_nistz256_sqr_mont,.-ecp_nistz256_sqr_mont
# void ecp_nistz256_add(BN_ULONG x0[4],const BN_ULONG x1[4],
# const BN_ULONG x2[4]);
.globl ecp_nistz256_add
.align 4
ecp_nistz256_add:
stdu $sp,-128($sp)
mflr r0
std r28,96($sp)
std r29,104($sp)
std r30,112($sp)
std r31,120($sp)
ld $acc0,0($ap)
ld $t0, 0($bp)
ld $acc1,8($ap)
ld $t1, 8($bp)
ld $acc2,16($ap)
ld $t2, 16($bp)
ld $acc3,24($ap)
ld $t3, 24($bp)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
bl __ecp_nistz256_add
mtlr r0
ld r28,96($sp)
ld r29,104($sp)
ld r30,112($sp)
ld r31,120($sp)
addi $sp,$sp,128
blr
.long 0
.byte 0,12,4,0,0x80,4,3,0
.long 0
.size ecp_nistz256_add,.-ecp_nistz256_add
# void ecp_nistz256_div_by_2(BN_ULONG x0[4],const BN_ULONG x1[4]);
.globl ecp_nistz256_div_by_2
.align 4
ecp_nistz256_div_by_2:
stdu $sp,-128($sp)
mflr r0
std r28,96($sp)
std r29,104($sp)
std r30,112($sp)
std r31,120($sp)
ld $acc0,0($ap)
ld $acc1,8($ap)
ld $acc2,16($ap)
ld $acc3,24($ap)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
bl __ecp_nistz256_div_by_2
mtlr r0
ld r28,96($sp)
ld r29,104($sp)
ld r30,112($sp)
ld r31,120($sp)
addi $sp,$sp,128
blr
.long 0
.byte 0,12,4,0,0x80,4,2,0
.long 0
.size ecp_nistz256_div_by_2,.-ecp_nistz256_div_by_2
# void ecp_nistz256_mul_by_2(BN_ULONG x0[4],const BN_ULONG x1[4]);
.globl ecp_nistz256_mul_by_2
.align 4
ecp_nistz256_mul_by_2:
stdu $sp,-128($sp)
mflr r0
std r28,96($sp)
std r29,104($sp)
std r30,112($sp)
std r31,120($sp)
ld $acc0,0($ap)
ld $acc1,8($ap)
ld $acc2,16($ap)
ld $acc3,24($ap)
mr $t0,$acc0
mr $t1,$acc1
mr $t2,$acc2
mr $t3,$acc3
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
bl __ecp_nistz256_add # ret = a+a // 2*a
mtlr r0
ld r28,96($sp)
ld r29,104($sp)
ld r30,112($sp)
ld r31,120($sp)
addi $sp,$sp,128
blr
.long 0
.byte 0,12,4,0,0x80,4,3,0
.long 0
.size ecp_nistz256_mul_by_2,.-ecp_nistz256_mul_by_2
# void ecp_nistz256_mul_by_3(BN_ULONG x0[4],const BN_ULONG x1[4]);
.globl ecp_nistz256_mul_by_3
.align 4
ecp_nistz256_mul_by_3:
stdu $sp,-128($sp)
mflr r0
std r28,96($sp)
std r29,104($sp)
std r30,112($sp)
std r31,120($sp)
ld $acc0,0($ap)
ld $acc1,8($ap)
ld $acc2,16($ap)
ld $acc3,24($ap)
mr $t0,$acc0
std $acc0,64($sp)
mr $t1,$acc1
std $acc1,72($sp)
mr $t2,$acc2
std $acc2,80($sp)
mr $t3,$acc3
std $acc3,88($sp)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
bl __ecp_nistz256_add # ret = a+a // 2*a
ld $t0,64($sp)
ld $t1,72($sp)
ld $t2,80($sp)
ld $t3,88($sp)
bl __ecp_nistz256_add # ret += a // 2*a+a=3*a
mtlr r0
ld r28,96($sp)
ld r29,104($sp)
ld r30,112($sp)
ld r31,120($sp)
addi $sp,$sp,128
blr
.long 0
.byte 0,12,4,0,0x80,4,2,0
.long 0
.size ecp_nistz256_mul_by_3,.-ecp_nistz256_mul_by_3
# void ecp_nistz256_sub(BN_ULONG x0[4],const BN_ULONG x1[4],
# const BN_ULONG x2[4]);
.globl ecp_nistz256_sub
.align 4
ecp_nistz256_sub:
stdu $sp,-128($sp)
mflr r0
std r28,96($sp)
std r29,104($sp)
std r30,112($sp)
std r31,120($sp)
ld $acc0,0($ap)
ld $acc1,8($ap)
ld $acc2,16($ap)
ld $acc3,24($ap)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
bl __ecp_nistz256_sub_from
mtlr r0
ld r28,96($sp)
ld r29,104($sp)
ld r30,112($sp)
ld r31,120($sp)
addi $sp,$sp,128
blr
.long 0
.byte 0,12,4,0,0x80,4,3,0
.long 0
.size ecp_nistz256_sub,.-ecp_nistz256_sub
# void ecp_nistz256_neg(BN_ULONG x0[4],const BN_ULONG x1[4]);
.globl ecp_nistz256_neg
.align 4
ecp_nistz256_neg:
stdu $sp,-128($sp)
mflr r0
std r28,96($sp)
std r29,104($sp)
std r30,112($sp)
std r31,120($sp)
mr $bp,$ap
li $acc0,0
li $acc1,0
li $acc2,0
li $acc3,0
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
bl __ecp_nistz256_sub_from
mtlr r0
ld r28,96($sp)
ld r29,104($sp)
ld r30,112($sp)
ld r31,120($sp)
addi $sp,$sp,128
blr
.long 0
.byte 0,12,4,0,0x80,4,2,0
.long 0
.size ecp_nistz256_neg,.-ecp_nistz256_neg
# note that __ecp_nistz256_mul_mont expects a[0-3] input pre-loaded
# to $a0-$a3 and b[0] - to $bi
.type __ecp_nistz256_mul_mont,\@function
.align 4
__ecp_nistz256_mul_mont:
mulld $acc0,$a0,$bi # a[0]*b[0]
mulhdu $t0,$a0,$bi
mulld $acc1,$a1,$bi # a[1]*b[0]
mulhdu $t1,$a1,$bi
mulld $acc2,$a2,$bi # a[2]*b[0]
mulhdu $t2,$a2,$bi
mulld $acc3,$a3,$bi # a[3]*b[0]
mulhdu $t3,$a3,$bi
ld $bi,8($bp) # b[1]
addc $acc1,$acc1,$t0 # accumulate high parts of multiplication
sldi $t0,$acc0,32
adde $acc2,$acc2,$t1
srdi $t1,$acc0,32
adde $acc3,$acc3,$t2
addze $acc4,$t3
li $acc5,0
___
for($i=1;$i<4;$i++) {
################################################################
# Reduction iteration is normally performed by accumulating
# result of multiplication of modulus by "magic" digit [and
# omitting least significant word, which is guaranteed to
# be 0], but thanks to special form of modulus and "magic"
# digit being equal to least significant word, it can be
# performed with additions and subtractions alone. Indeed:
#
# ffff0001.00000000.0000ffff.ffffffff
# * abcdefgh
# + xxxxxxxx.xxxxxxxx.xxxxxxxx.xxxxxxxx.abcdefgh
#
# Now observing that ff..ff*x = (2^n-1)*x = 2^n*x-x, we
# rewrite above as:
#
# xxxxxxxx.xxxxxxxx.xxxxxxxx.xxxxxxxx.abcdefgh
# + abcdefgh.abcdefgh.0000abcd.efgh0000.00000000
# - 0000abcd.efgh0000.00000000.00000000.abcdefgh
#
# or marking redundant operations:
#
# xxxxxxxx.xxxxxxxx.xxxxxxxx.xxxxxxxx.--------
# + abcdefgh.abcdefgh.0000abcd.efgh0000.--------
# - 0000abcd.efgh0000.--------.--------.--------
$code.=<<___;
subfc $t2,$t0,$acc0 # "*0xffff0001"
subfe $t3,$t1,$acc0
addc $acc0,$acc1,$t0 # +=acc[0]<<96 and omit acc[0]
adde $acc1,$acc2,$t1
adde $acc2,$acc3,$t2 # +=acc[0]*0xffff0001
adde $acc3,$acc4,$t3
addze $acc4,$acc5
mulld $t0,$a0,$bi # lo(a[0]*b[i])
mulld $t1,$a1,$bi # lo(a[1]*b[i])
mulld $t2,$a2,$bi # lo(a[2]*b[i])
mulld $t3,$a3,$bi # lo(a[3]*b[i])
addc $acc0,$acc0,$t0 # accumulate low parts of multiplication
mulhdu $t0,$a0,$bi # hi(a[0]*b[i])
adde $acc1,$acc1,$t1
mulhdu $t1,$a1,$bi # hi(a[1]*b[i])
adde $acc2,$acc2,$t2
mulhdu $t2,$a2,$bi # hi(a[2]*b[i])
adde $acc3,$acc3,$t3
mulhdu $t3,$a3,$bi # hi(a[3]*b[i])
addze $acc4,$acc4
___
$code.=<<___ if ($i<3);
ld $bi,8*($i+1)($bp) # b[$i+1]
___
$code.=<<___;
addc $acc1,$acc1,$t0 # accumulate high parts of multiplication
sldi $t0,$acc0,32
adde $acc2,$acc2,$t1
srdi $t1,$acc0,32
adde $acc3,$acc3,$t2
adde $acc4,$acc4,$t3
li $acc5,0
addze $acc5,$acc5
___
}
$code.=<<___;
# last reduction
subfc $t2,$t0,$acc0 # "*0xffff0001"
subfe $t3,$t1,$acc0
addc $acc0,$acc1,$t0 # +=acc[0]<<96 and omit acc[0]
adde $acc1,$acc2,$t1
adde $acc2,$acc3,$t2 # +=acc[0]*0xffff0001
adde $acc3,$acc4,$t3
addze $acc4,$acc5
li $t2,0
addic $acc0,$acc0,1 # ret -= modulus
subfe $acc1,$poly1,$acc1
subfe $acc2,$t2,$acc2
subfe $acc3,$poly3,$acc3
subfe $acc4,$t2,$acc4
addc $acc0,$acc0,$acc4 # ret += modulus if borrow
and $t1,$poly1,$acc4
and $t3,$poly3,$acc4
adde $acc1,$acc1,$t1
addze $acc2,$acc2
adde $acc3,$acc3,$t3
std $acc0,0($rp)
std $acc1,8($rp)
std $acc2,16($rp)
std $acc3,24($rp)
blr
.long 0
.byte 0,12,0x14,0,0,0,1,0
.long 0
.size __ecp_nistz256_mul_mont,.-__ecp_nistz256_mul_mont
# note that __ecp_nistz256_sqr_mont expects a[0-3] input pre-loaded
# to $a0-$a3
.type __ecp_nistz256_sqr_mont,\@function
.align 4
__ecp_nistz256_sqr_mont:
################################################################
# | | | | | |a1*a0| |
# | | | | |a2*a0| | |
# | |a3*a2|a3*a0| | | |
# | | | |a2*a1| | | |
# | | |a3*a1| | | | |
# *| | | | | | | | 2|
# +|a3*a3|a2*a2|a1*a1|a0*a0|
# |--+--+--+--+--+--+--+--|
# |A7|A6|A5|A4|A3|A2|A1|A0|, where Ax is $accx, i.e. follow $accx
#
# "can't overflow" below mark carrying into high part of
# multiplication result, which can't overflow, because it
# can never be all ones.
mulld $acc1,$a1,$a0 # a[1]*a[0]
mulhdu $t1,$a1,$a0
mulld $acc2,$a2,$a0 # a[2]*a[0]
mulhdu $t2,$a2,$a0
mulld $acc3,$a3,$a0 # a[3]*a[0]
mulhdu $acc4,$a3,$a0
addc $acc2,$acc2,$t1 # accumulate high parts of multiplication
mulld $t0,$a2,$a1 # a[2]*a[1]
mulhdu $t1,$a2,$a1
adde $acc3,$acc3,$t2
mulld $t2,$a3,$a1 # a[3]*a[1]
mulhdu $t3,$a3,$a1
addze $acc4,$acc4 # can't overflow
mulld $acc5,$a3,$a2 # a[3]*a[2]
mulhdu $acc6,$a3,$a2
addc $t1,$t1,$t2 # accumulate high parts of multiplication
addze $t2,$t3 # can't overflow
addc $acc3,$acc3,$t0 # accumulate low parts of multiplication
adde $acc4,$acc4,$t1
adde $acc5,$acc5,$t2
addze $acc6,$acc6 # can't overflow
addc $acc1,$acc1,$acc1 # acc[1-6]*=2
adde $acc2,$acc2,$acc2
adde $acc3,$acc3,$acc3
adde $acc4,$acc4,$acc4
adde $acc5,$acc5,$acc5
adde $acc6,$acc6,$acc6
li $acc7,0
addze $acc7,$acc7
mulld $acc0,$a0,$a0 # a[0]*a[0]
mulhdu $a0,$a0,$a0
mulld $t1,$a1,$a1 # a[1]*a[1]
mulhdu $a1,$a1,$a1
mulld $t2,$a2,$a2 # a[2]*a[2]
mulhdu $a2,$a2,$a2
mulld $t3,$a3,$a3 # a[3]*a[3]
mulhdu $a3,$a3,$a3
addc $acc1,$acc1,$a0 # +a[i]*a[i]
sldi $t0,$acc0,32
adde $acc2,$acc2,$t1
srdi $t1,$acc0,32
adde $acc3,$acc3,$a1
adde $acc4,$acc4,$t2
adde $acc5,$acc5,$a2
adde $acc6,$acc6,$t3
adde $acc7,$acc7,$a3
___
for($i=0;$i<3;$i++) { # reductions, see commentary in
# multiplication for details
$code.=<<___;
subfc $t2,$t0,$acc0 # "*0xffff0001"
subfe $t3,$t1,$acc0
addc $acc0,$acc1,$t0 # +=acc[0]<<96 and omit acc[0]
sldi $t0,$acc0,32
adde $acc1,$acc2,$t1
srdi $t1,$acc0,32
adde $acc2,$acc3,$t2 # +=acc[0]*0xffff0001
addze $acc3,$t3 # can't overflow
___
}
$code.=<<___;
subfc $t2,$t0,$acc0 # "*0xffff0001"
subfe $t3,$t1,$acc0
addc $acc0,$acc1,$t0 # +=acc[0]<<96 and omit acc[0]
adde $acc1,$acc2,$t1
adde $acc2,$acc3,$t2 # +=acc[0]*0xffff0001
addze $acc3,$t3 # can't overflow
addc $acc0,$acc0,$acc4 # accumulate upper half
adde $acc1,$acc1,$acc5
adde $acc2,$acc2,$acc6
adde $acc3,$acc3,$acc7
li $t2,0
addze $acc4,$t2
addic $acc0,$acc0,1 # ret -= modulus
subfe $acc1,$poly1,$acc1
subfe $acc2,$t2,$acc2
subfe $acc3,$poly3,$acc3
subfe $acc4,$t2,$acc4
addc $acc0,$acc0,$acc4 # ret += modulus if borrow
and $t1,$poly1,$acc4
and $t3,$poly3,$acc4
adde $acc1,$acc1,$t1
addze $acc2,$acc2
adde $acc3,$acc3,$t3
std $acc0,0($rp)
std $acc1,8($rp)
std $acc2,16($rp)
std $acc3,24($rp)
blr
.long 0
.byte 0,12,0x14,0,0,0,1,0
.long 0
.size __ecp_nistz256_sqr_mont,.-__ecp_nistz256_sqr_mont
# Note that __ecp_nistz256_add expects both input vectors pre-loaded to
# $a0-$a3 and $t0-$t3. This is done because it's used in multiple
# contexts, e.g. in multiplication by 2 and 3...
.type __ecp_nistz256_add,\@function
.align 4
__ecp_nistz256_add:
addc $acc0,$acc0,$t0 # ret = a+b
adde $acc1,$acc1,$t1
adde $acc2,$acc2,$t2
li $t2,0
adde $acc3,$acc3,$t3
addze $t0,$t2
# if a+b >= modulus, subtract modulus
#
# But since comparison implies subtraction, we subtract
# modulus and then add it back if subraction borrowed.
subic $acc0,$acc0,-1
subfe $acc1,$poly1,$acc1
subfe $acc2,$t2,$acc2
subfe $acc3,$poly3,$acc3
subfe $t0,$t2,$t0
addc $acc0,$acc0,$t0
and $t1,$poly1,$t0
and $t3,$poly3,$t0
adde $acc1,$acc1,$t1
addze $acc2,$acc2
adde $acc3,$acc3,$t3
std $acc0,0($rp)
std $acc1,8($rp)
std $acc2,16($rp)
std $acc3,24($rp)
blr
.long 0
.byte 0,12,0x14,0,0,0,3,0
.long 0
.size __ecp_nistz256_add,.-__ecp_nistz256_add
.type __ecp_nistz256_sub_from,\@function
.align 4
__ecp_nistz256_sub_from:
ld $t0,0($bp)
ld $t1,8($bp)
ld $t2,16($bp)
ld $t3,24($bp)
subfc $acc0,$t0,$acc0 # ret = a-b
subfe $acc1,$t1,$acc1
subfe $acc2,$t2,$acc2
subfe $acc3,$t3,$acc3
subfe $t0,$t0,$t0 # t0 = borrow ? -1 : 0
# if a-b borrowed, add modulus
addc $acc0,$acc0,$t0 # ret -= modulus & t0
and $t1,$poly1,$t0
and $t3,$poly3,$t0
adde $acc1,$acc1,$t1
addze $acc2,$acc2
adde $acc3,$acc3,$t3
std $acc0,0($rp)
std $acc1,8($rp)
std $acc2,16($rp)
std $acc3,24($rp)
blr
.long 0
.byte 0,12,0x14,0,0,0,3,0
.long 0
.size __ecp_nistz256_sub_from,.-__ecp_nistz256_sub_from
.type __ecp_nistz256_sub_morf,\@function
.align 4
__ecp_nistz256_sub_morf:
ld $t0,0($bp)
ld $t1,8($bp)
ld $t2,16($bp)
ld $t3,24($bp)
subfc $acc0,$acc0,$t0 # ret = b-a
subfe $acc1,$acc1,$t1
subfe $acc2,$acc2,$t2
subfe $acc3,$acc3,$t3
subfe $t0,$t0,$t0 # t0 = borrow ? -1 : 0
# if b-a borrowed, add modulus
addc $acc0,$acc0,$t0 # ret -= modulus & t0
and $t1,$poly1,$t0
and $t3,$poly3,$t0
adde $acc1,$acc1,$t1
addze $acc2,$acc2
adde $acc3,$acc3,$t3
std $acc0,0($rp)
std $acc1,8($rp)
std $acc2,16($rp)
std $acc3,24($rp)
blr
.long 0
.byte 0,12,0x14,0,0,0,3,0
.long 0
.size __ecp_nistz256_sub_morf,.-__ecp_nistz256_sub_morf
.type __ecp_nistz256_div_by_2,\@function
.align 4
__ecp_nistz256_div_by_2:
andi. $t0,$acc0,1
addic $acc0,$acc0,-1 # a += modulus
neg $t0,$t0
adde $acc1,$acc1,$poly1
not $t0,$t0
addze $acc2,$acc2
li $t2,0
adde $acc3,$acc3,$poly3
and $t1,$poly1,$t0
addze $ap,$t2 # ap = carry
and $t3,$poly3,$t0
subfc $acc0,$t0,$acc0 # a -= modulus if a was even
subfe $acc1,$t1,$acc1
subfe $acc2,$t2,$acc2
subfe $acc3,$t3,$acc3
subfe $ap, $t2,$ap
srdi $acc0,$acc0,1
sldi $t0,$acc1,63
srdi $acc1,$acc1,1
sldi $t1,$acc2,63
srdi $acc2,$acc2,1
sldi $t2,$acc3,63
srdi $acc3,$acc3,1
sldi $t3,$ap,63
or $acc0,$acc0,$t0
or $acc1,$acc1,$t1
or $acc2,$acc2,$t2
or $acc3,$acc3,$t3
std $acc0,0($rp)
std $acc1,8($rp)
std $acc2,16($rp)
std $acc3,24($rp)
blr
.long 0
.byte 0,12,0x14,0,0,0,1,0
.long 0
.size __ecp_nistz256_div_by_2,.-__ecp_nistz256_div_by_2
___
########################################################################
# following subroutines are "literal" implementation of those found in
# ecp_nistz256.c
#
########################################################################
# void ecp_nistz256_point_double(P256_POINT *out,const P256_POINT *inp);
#
if (1) {
my $FRAME=64+32*4+12*8;
my ($S,$M,$Zsqr,$tmp0)=map(64+32*$_,(0..3));
# above map() describes stack layout with 4 temporary
# 256-bit vectors on top.
my ($rp_real,$ap_real) = map("r$_",(20,21));
$code.=<<___;
.globl ecp_nistz256_point_double
.align 5
ecp_nistz256_point_double:
stdu $sp,-$FRAME($sp)
mflr r0
std r20,$FRAME-8*12($sp)
std r21,$FRAME-8*11($sp)
std r22,$FRAME-8*10($sp)
std r23,$FRAME-8*9($sp)
std r24,$FRAME-8*8($sp)
std r25,$FRAME-8*7($sp)
std r26,$FRAME-8*6($sp)
std r27,$FRAME-8*5($sp)
std r28,$FRAME-8*4($sp)
std r29,$FRAME-8*3($sp)
std r30,$FRAME-8*2($sp)
std r31,$FRAME-8*1($sp)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
.Ldouble_shortcut:
ld $acc0,32($ap)
ld $acc1,40($ap)
ld $acc2,48($ap)
ld $acc3,56($ap)
mr $t0,$acc0
mr $t1,$acc1
mr $t2,$acc2
mr $t3,$acc3
ld $a0,64($ap) # forward load for p256_sqr_mont
ld $a1,72($ap)
ld $a2,80($ap)
ld $a3,88($ap)
mr $rp_real,$rp
mr $ap_real,$ap
addi $rp,$sp,$S
bl __ecp_nistz256_add # p256_mul_by_2(S, in_y);
addi $rp,$sp,$Zsqr
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(Zsqr, in_z);
ld $t0,0($ap_real)
ld $t1,8($ap_real)
ld $t2,16($ap_real)
ld $t3,24($ap_real)
mr $a0,$acc0 # put Zsqr aside for p256_sub
mr $a1,$acc1
mr $a2,$acc2
mr $a3,$acc3
addi $rp,$sp,$M
bl __ecp_nistz256_add # p256_add(M, Zsqr, in_x);
addi $bp,$ap_real,0
mr $acc0,$a0 # restore Zsqr
mr $acc1,$a1
mr $acc2,$a2
mr $acc3,$a3
ld $a0,$S+0($sp) # forward load for p256_sqr_mont
ld $a1,$S+8($sp)
ld $a2,$S+16($sp)
ld $a3,$S+24($sp)
addi $rp,$sp,$Zsqr
bl __ecp_nistz256_sub_morf # p256_sub(Zsqr, in_x, Zsqr);
addi $rp,$sp,$S
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(S, S);
ld $bi,32($ap_real)
ld $a0,64($ap_real)
ld $a1,72($ap_real)
ld $a2,80($ap_real)
ld $a3,88($ap_real)
addi $bp,$ap_real,32
addi $rp,$sp,$tmp0
bl __ecp_nistz256_mul_mont # p256_mul_mont(tmp0, in_z, in_y);
mr $t0,$acc0
mr $t1,$acc1
mr $t2,$acc2
mr $t3,$acc3
ld $a0,$S+0($sp) # forward load for p256_sqr_mont
ld $a1,$S+8($sp)
ld $a2,$S+16($sp)
ld $a3,$S+24($sp)
addi $rp,$rp_real,64
bl __ecp_nistz256_add # p256_mul_by_2(res_z, tmp0);
addi $rp,$sp,$tmp0
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(tmp0, S);
ld $bi,$Zsqr($sp) # forward load for p256_mul_mont
ld $a0,$M+0($sp)
ld $a1,$M+8($sp)
ld $a2,$M+16($sp)
ld $a3,$M+24($sp)
addi $rp,$rp_real,32
bl __ecp_nistz256_div_by_2 # p256_div_by_2(res_y, tmp0);
addi $bp,$sp,$Zsqr
addi $rp,$sp,$M
bl __ecp_nistz256_mul_mont # p256_mul_mont(M, M, Zsqr);
mr $t0,$acc0 # duplicate M
mr $t1,$acc1
mr $t2,$acc2
mr $t3,$acc3
mr $a0,$acc0 # put M aside
mr $a1,$acc1
mr $a2,$acc2
mr $a3,$acc3
addi $rp,$sp,$M
bl __ecp_nistz256_add
mr $t0,$a0 # restore M
mr $t1,$a1
mr $t2,$a2
mr $t3,$a3
ld $bi,0($ap_real) # forward load for p256_mul_mont
ld $a0,$S+0($sp)
ld $a1,$S+8($sp)
ld $a2,$S+16($sp)
ld $a3,$S+24($sp)
bl __ecp_nistz256_add # p256_mul_by_3(M, M);
addi $bp,$ap_real,0
addi $rp,$sp,$S
bl __ecp_nistz256_mul_mont # p256_mul_mont(S, S, in_x);
mr $t0,$acc0
mr $t1,$acc1
mr $t2,$acc2
mr $t3,$acc3
ld $a0,$M+0($sp) # forward load for p256_sqr_mont
ld $a1,$M+8($sp)
ld $a2,$M+16($sp)
ld $a3,$M+24($sp)
addi $rp,$sp,$tmp0
bl __ecp_nistz256_add # p256_mul_by_2(tmp0, S);
addi $rp,$rp_real,0
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(res_x, M);
addi $bp,$sp,$tmp0
bl __ecp_nistz256_sub_from # p256_sub(res_x, res_x, tmp0);
addi $bp,$sp,$S
addi $rp,$sp,$S
bl __ecp_nistz256_sub_morf # p256_sub(S, S, res_x);
ld $bi,$M($sp)
mr $a0,$acc0 # copy S
mr $a1,$acc1
mr $a2,$acc2
mr $a3,$acc3
addi $bp,$sp,$M
bl __ecp_nistz256_mul_mont # p256_mul_mont(S, S, M);
addi $bp,$rp_real,32
addi $rp,$rp_real,32
bl __ecp_nistz256_sub_from # p256_sub(res_y, S, res_y);
mtlr r0
ld r20,$FRAME-8*12($sp)
ld r21,$FRAME-8*11($sp)
ld r22,$FRAME-8*10($sp)
ld r23,$FRAME-8*9($sp)
ld r24,$FRAME-8*8($sp)
ld r25,$FRAME-8*7($sp)
ld r26,$FRAME-8*6($sp)
ld r27,$FRAME-8*5($sp)
ld r28,$FRAME-8*4($sp)
ld r29,$FRAME-8*3($sp)
ld r30,$FRAME-8*2($sp)
ld r31,$FRAME-8*1($sp)
addi $sp,$sp,$FRAME
blr
.long 0
.byte 0,12,4,0,0x80,12,2,0
.long 0
.size ecp_nistz256_point_double,.-ecp_nistz256_point_double
___
}
########################################################################
# void ecp_nistz256_point_add(P256_POINT *out,const P256_POINT *in1,
# const P256_POINT *in2);
if (1) {
my $FRAME = 64 + 32*12 + 16*8;
my ($res_x,$res_y,$res_z,
$H,$Hsqr,$R,$Rsqr,$Hcub,
$U1,$U2,$S1,$S2)=map(64+32*$_,(0..11));
my ($Z1sqr, $Z2sqr) = ($Hsqr, $Rsqr);
# above map() describes stack layout with 12 temporary
# 256-bit vectors on top.
my ($rp_real,$ap_real,$bp_real,$in1infty,$in2infty,$temp)=map("r$_",(16..21));
$code.=<<___;
.globl ecp_nistz256_point_add
.align 5
ecp_nistz256_point_add:
stdu $sp,-$FRAME($sp)
mflr r0
std r16,$FRAME-8*16($sp)
std r17,$FRAME-8*15($sp)
std r18,$FRAME-8*14($sp)
std r19,$FRAME-8*13($sp)
std r20,$FRAME-8*12($sp)
std r21,$FRAME-8*11($sp)
std r22,$FRAME-8*10($sp)
std r23,$FRAME-8*9($sp)
std r24,$FRAME-8*8($sp)
std r25,$FRAME-8*7($sp)
std r26,$FRAME-8*6($sp)
std r27,$FRAME-8*5($sp)
std r28,$FRAME-8*4($sp)
std r29,$FRAME-8*3($sp)
std r30,$FRAME-8*2($sp)
std r31,$FRAME-8*1($sp)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
ld $a0,64($bp) # in2_z
ld $a1,72($bp)
ld $a2,80($bp)
ld $a3,88($bp)
mr $rp_real,$rp
mr $ap_real,$ap
mr $bp_real,$bp
or $t0,$a0,$a1
or $t2,$a2,$a3
or $in2infty,$t0,$t2
neg $t0,$in2infty
or $in2infty,$in2infty,$t0
sradi $in2infty,$in2infty,63 # !in2infty
addi $rp,$sp,$Z2sqr
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(Z2sqr, in2_z);
ld $a0,64($ap_real) # in1_z
ld $a1,72($ap_real)
ld $a2,80($ap_real)
ld $a3,88($ap_real)
or $t0,$a0,$a1
or $t2,$a2,$a3
or $in1infty,$t0,$t2
neg $t0,$in1infty
or $in1infty,$in1infty,$t0
sradi $in1infty,$in1infty,63 # !in1infty
addi $rp,$sp,$Z1sqr
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(Z1sqr, in1_z);
ld $bi,64($bp_real)
ld $a0,$Z2sqr+0($sp)
ld $a1,$Z2sqr+8($sp)
ld $a2,$Z2sqr+16($sp)
ld $a3,$Z2sqr+24($sp)
addi $bp,$bp_real,64
addi $rp,$sp,$S1
bl __ecp_nistz256_mul_mont # p256_mul_mont(S1, Z2sqr, in2_z);
ld $bi,64($ap_real)
ld $a0,$Z1sqr+0($sp)
ld $a1,$Z1sqr+8($sp)
ld $a2,$Z1sqr+16($sp)
ld $a3,$Z1sqr+24($sp)
addi $bp,$ap_real,64
addi $rp,$sp,$S2
bl __ecp_nistz256_mul_mont # p256_mul_mont(S2, Z1sqr, in1_z);
ld $bi,32($ap_real)
ld $a0,$S1+0($sp)
ld $a1,$S1+8($sp)
ld $a2,$S1+16($sp)
ld $a3,$S1+24($sp)
addi $bp,$ap_real,32
addi $rp,$sp,$S1
bl __ecp_nistz256_mul_mont # p256_mul_mont(S1, S1, in1_y);
ld $bi,32($bp_real)
ld $a0,$S2+0($sp)
ld $a1,$S2+8($sp)
ld $a2,$S2+16($sp)
ld $a3,$S2+24($sp)
addi $bp,$bp_real,32
addi $rp,$sp,$S2
bl __ecp_nistz256_mul_mont # p256_mul_mont(S2, S2, in2_y);
addi $bp,$sp,$S1
ld $bi,$Z2sqr($sp) # forward load for p256_mul_mont
ld $a0,0($ap_real)
ld $a1,8($ap_real)
ld $a2,16($ap_real)
ld $a3,24($ap_real)
addi $rp,$sp,$R
bl __ecp_nistz256_sub_from # p256_sub(R, S2, S1);
or $acc0,$acc0,$acc1 # see if result is zero
or $acc2,$acc2,$acc3
or $temp,$acc0,$acc2
addi $bp,$sp,$Z2sqr
addi $rp,$sp,$U1
bl __ecp_nistz256_mul_mont # p256_mul_mont(U1, in1_x, Z2sqr);
ld $bi,$Z1sqr($sp)
ld $a0,0($bp_real)
ld $a1,8($bp_real)
ld $a2,16($bp_real)
ld $a3,24($bp_real)
addi $bp,$sp,$Z1sqr
addi $rp,$sp,$U2
bl __ecp_nistz256_mul_mont # p256_mul_mont(U2, in2_x, Z1sqr);
addi $bp,$sp,$U1
ld $a0,$R+0($sp) # forward load for p256_sqr_mont
ld $a1,$R+8($sp)
ld $a2,$R+16($sp)
ld $a3,$R+24($sp)
addi $rp,$sp,$H
bl __ecp_nistz256_sub_from # p256_sub(H, U2, U1);
or $acc0,$acc0,$acc1 # see if result is zero
or $acc2,$acc2,$acc3
or. $acc0,$acc0,$acc2
bne .Ladd_proceed # is_equal(U1,U2)?
and. $t0,$in1infty,$in2infty
beq .Ladd_proceed # (in1infty || in2infty)?
cmpldi $temp,0
beq .Ladd_double # is_equal(S1,S2)?
xor $a0,$a0,$a0
std $a0,0($rp_real)
std $a0,8($rp_real)
std $a0,16($rp_real)
std $a0,24($rp_real)
std $a0,32($rp_real)
std $a0,40($rp_real)
std $a0,48($rp_real)
std $a0,56($rp_real)
std $a0,64($rp_real)
std $a0,72($rp_real)
std $a0,80($rp_real)
std $a0,88($rp_real)
b .Ladd_done
.align 4
.Ladd_double:
ld $bp,0($sp) # back-link
mr $ap,$ap_real
mr $rp,$rp_real
ld r16,$FRAME-8*16($sp)
ld r17,$FRAME-8*15($sp)
ld r18,$FRAME-8*14($sp)
ld r19,$FRAME-8*13($sp)
stdu $bp,$FRAME-288($sp) # difference in stack frame sizes
b .Ldouble_shortcut
.align 4
.Ladd_proceed:
addi $rp,$sp,$Rsqr
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(Rsqr, R);
ld $bi,64($ap_real)
ld $a0,$H+0($sp)
ld $a1,$H+8($sp)
ld $a2,$H+16($sp)
ld $a3,$H+24($sp)
addi $bp,$ap_real,64
addi $rp,$sp,$res_z
bl __ecp_nistz256_mul_mont # p256_mul_mont(res_z, H, in1_z);
ld $a0,$H+0($sp)
ld $a1,$H+8($sp)
ld $a2,$H+16($sp)
ld $a3,$H+24($sp)
addi $rp,$sp,$Hsqr
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(Hsqr, H);
ld $bi,64($bp_real)
ld $a0,$res_z+0($sp)
ld $a1,$res_z+8($sp)
ld $a2,$res_z+16($sp)
ld $a3,$res_z+24($sp)
addi $bp,$bp_real,64
addi $rp,$sp,$res_z
bl __ecp_nistz256_mul_mont # p256_mul_mont(res_z, res_z, in2_z);
ld $bi,$H($sp)
ld $a0,$Hsqr+0($sp)
ld $a1,$Hsqr+8($sp)
ld $a2,$Hsqr+16($sp)
ld $a3,$Hsqr+24($sp)
addi $bp,$sp,$H
addi $rp,$sp,$Hcub
bl __ecp_nistz256_mul_mont # p256_mul_mont(Hcub, Hsqr, H);
ld $bi,$Hsqr($sp)
ld $a0,$U1+0($sp)
ld $a1,$U1+8($sp)
ld $a2,$U1+16($sp)
ld $a3,$U1+24($sp)
addi $bp,$sp,$Hsqr
addi $rp,$sp,$U2
bl __ecp_nistz256_mul_mont # p256_mul_mont(U2, U1, Hsqr);
mr $t0,$acc0
mr $t1,$acc1
mr $t2,$acc2
mr $t3,$acc3
addi $rp,$sp,$Hsqr
bl __ecp_nistz256_add # p256_mul_by_2(Hsqr, U2);
addi $bp,$sp,$Rsqr
addi $rp,$sp,$res_x
bl __ecp_nistz256_sub_morf # p256_sub(res_x, Rsqr, Hsqr);
addi $bp,$sp,$Hcub
bl __ecp_nistz256_sub_from # p256_sub(res_x, res_x, Hcub);
addi $bp,$sp,$U2
ld $bi,$Hcub($sp) # forward load for p256_mul_mont
ld $a0,$S1+0($sp)
ld $a1,$S1+8($sp)
ld $a2,$S1+16($sp)
ld $a3,$S1+24($sp)
addi $rp,$sp,$res_y
bl __ecp_nistz256_sub_morf # p256_sub(res_y, U2, res_x);
addi $bp,$sp,$Hcub
addi $rp,$sp,$S2
bl __ecp_nistz256_mul_mont # p256_mul_mont(S2, S1, Hcub);
ld $bi,$R($sp)
ld $a0,$res_y+0($sp)
ld $a1,$res_y+8($sp)
ld $a2,$res_y+16($sp)
ld $a3,$res_y+24($sp)
addi $bp,$sp,$R
addi $rp,$sp,$res_y
bl __ecp_nistz256_mul_mont # p256_mul_mont(res_y, res_y, R);
addi $bp,$sp,$S2
bl __ecp_nistz256_sub_from # p256_sub(res_y, res_y, S2);
ld $t0,0($bp_real) # in2
ld $t1,8($bp_real)
ld $t2,16($bp_real)
ld $t3,24($bp_real)
ld $a0,$res_x+0($sp) # res
ld $a1,$res_x+8($sp)
ld $a2,$res_x+16($sp)
ld $a3,$res_x+24($sp)
___
for($i=0;$i<64;$i+=32) { # conditional moves
$code.=<<___;
ld $acc0,$i+0($ap_real) # in1
ld $acc1,$i+8($ap_real)
ld $acc2,$i+16($ap_real)
ld $acc3,$i+24($ap_real)
andc $t0,$t0,$in1infty
andc $t1,$t1,$in1infty
andc $t2,$t2,$in1infty
andc $t3,$t3,$in1infty
and $a0,$a0,$in1infty
and $a1,$a1,$in1infty
and $a2,$a2,$in1infty
and $a3,$a3,$in1infty
or $t0,$t0,$a0
or $t1,$t1,$a1
or $t2,$t2,$a2
or $t3,$t3,$a3
andc $acc0,$acc0,$in2infty
andc $acc1,$acc1,$in2infty
andc $acc2,$acc2,$in2infty
andc $acc3,$acc3,$in2infty
and $t0,$t0,$in2infty
and $t1,$t1,$in2infty
and $t2,$t2,$in2infty
and $t3,$t3,$in2infty
or $acc0,$acc0,$t0
or $acc1,$acc1,$t1
or $acc2,$acc2,$t2
or $acc3,$acc3,$t3
ld $t0,$i+32($bp_real) # in2
ld $t1,$i+40($bp_real)
ld $t2,$i+48($bp_real)
ld $t3,$i+56($bp_real)
ld $a0,$res_x+$i+32($sp)
ld $a1,$res_x+$i+40($sp)
ld $a2,$res_x+$i+48($sp)
ld $a3,$res_x+$i+56($sp)
std $acc0,$i+0($rp_real)
std $acc1,$i+8($rp_real)
std $acc2,$i+16($rp_real)
std $acc3,$i+24($rp_real)
___
}
$code.=<<___;
ld $acc0,$i+0($ap_real) # in1
ld $acc1,$i+8($ap_real)
ld $acc2,$i+16($ap_real)
ld $acc3,$i+24($ap_real)
andc $t0,$t0,$in1infty
andc $t1,$t1,$in1infty
andc $t2,$t2,$in1infty
andc $t3,$t3,$in1infty
and $a0,$a0,$in1infty
and $a1,$a1,$in1infty
and $a2,$a2,$in1infty
and $a3,$a3,$in1infty
or $t0,$t0,$a0
or $t1,$t1,$a1
or $t2,$t2,$a2
or $t3,$t3,$a3
andc $acc0,$acc0,$in2infty
andc $acc1,$acc1,$in2infty
andc $acc2,$acc2,$in2infty
andc $acc3,$acc3,$in2infty
and $t0,$t0,$in2infty
and $t1,$t1,$in2infty
and $t2,$t2,$in2infty
and $t3,$t3,$in2infty
or $acc0,$acc0,$t0
or $acc1,$acc1,$t1
or $acc2,$acc2,$t2
or $acc3,$acc3,$t3
std $acc0,$i+0($rp_real)
std $acc1,$i+8($rp_real)
std $acc2,$i+16($rp_real)
std $acc3,$i+24($rp_real)
.Ladd_done:
mtlr r0
ld r16,$FRAME-8*16($sp)
ld r17,$FRAME-8*15($sp)
ld r18,$FRAME-8*14($sp)
ld r19,$FRAME-8*13($sp)
ld r20,$FRAME-8*12($sp)
ld r21,$FRAME-8*11($sp)
ld r22,$FRAME-8*10($sp)
ld r23,$FRAME-8*9($sp)
ld r24,$FRAME-8*8($sp)
ld r25,$FRAME-8*7($sp)
ld r26,$FRAME-8*6($sp)
ld r27,$FRAME-8*5($sp)
ld r28,$FRAME-8*4($sp)
ld r29,$FRAME-8*3($sp)
ld r30,$FRAME-8*2($sp)
ld r31,$FRAME-8*1($sp)
addi $sp,$sp,$FRAME
blr
.long 0
.byte 0,12,4,0,0x80,16,3,0
.long 0
.size ecp_nistz256_point_add,.-ecp_nistz256_point_add
___
}
########################################################################
# void ecp_nistz256_point_add_affine(P256_POINT *out,const P256_POINT *in1,
# const P256_POINT_AFFINE *in2);
if (1) {
my $FRAME = 64 + 32*10 + 16*8;
my ($res_x,$res_y,$res_z,
$U2,$S2,$H,$R,$Hsqr,$Hcub,$Rsqr)=map(64+32*$_,(0..9));
my $Z1sqr = $S2;
# above map() describes stack layout with 10 temporary
# 256-bit vectors on top.
my ($rp_real,$ap_real,$bp_real,$in1infty,$in2infty,$temp)=map("r$_",(16..21));
$code.=<<___;
.globl ecp_nistz256_point_add_affine
.align 5
ecp_nistz256_point_add_affine:
stdu $sp,-$FRAME($sp)
mflr r0
std r16,$FRAME-8*16($sp)
std r17,$FRAME-8*15($sp)
std r18,$FRAME-8*14($sp)
std r19,$FRAME-8*13($sp)
std r20,$FRAME-8*12($sp)
std r21,$FRAME-8*11($sp)
std r22,$FRAME-8*10($sp)
std r23,$FRAME-8*9($sp)
std r24,$FRAME-8*8($sp)
std r25,$FRAME-8*7($sp)
std r26,$FRAME-8*6($sp)
std r27,$FRAME-8*5($sp)
std r28,$FRAME-8*4($sp)
std r29,$FRAME-8*3($sp)
std r30,$FRAME-8*2($sp)
std r31,$FRAME-8*1($sp)
li $poly1,-1
srdi $poly1,$poly1,32 # 0x00000000ffffffff
li $poly3,1
orc $poly3,$poly3,$poly1 # 0xffffffff00000001
mr $rp_real,$rp
mr $ap_real,$ap
mr $bp_real,$bp
ld $a0,64($ap) # in1_z
ld $a1,72($ap)
ld $a2,80($ap)
ld $a3,88($ap)
or $t0,$a0,$a1
or $t2,$a2,$a3
or $in1infty,$t0,$t2
neg $t0,$in1infty
or $in1infty,$in1infty,$t0
sradi $in1infty,$in1infty,63 # !in1infty
ld $acc0,0($bp) # in2_x
ld $acc1,8($bp)
ld $acc2,16($bp)
ld $acc3,24($bp)
ld $t0,32($bp) # in2_y
ld $t1,40($bp)
ld $t2,48($bp)
ld $t3,56($bp)
or $acc0,$acc0,$acc1
or $acc2,$acc2,$acc3
or $acc0,$acc0,$acc2
or $t0,$t0,$t1
or $t2,$t2,$t3
or $t0,$t0,$t2
or $in2infty,$acc0,$t0
neg $t0,$in2infty
or $in2infty,$in2infty,$t0
sradi $in2infty,$in2infty,63 # !in2infty
addi $rp,$sp,$Z1sqr
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(Z1sqr, in1_z);
mr $a0,$acc0
mr $a1,$acc1
mr $a2,$acc2
mr $a3,$acc3
ld $bi,0($bp_real)
addi $bp,$bp_real,0
addi $rp,$sp,$U2
bl __ecp_nistz256_mul_mont # p256_mul_mont(U2, Z1sqr, in2_x);
addi $bp,$ap_real,0
ld $bi,64($ap_real) # forward load for p256_mul_mont
ld $a0,$Z1sqr+0($sp)
ld $a1,$Z1sqr+8($sp)
ld $a2,$Z1sqr+16($sp)
ld $a3,$Z1sqr+24($sp)
addi $rp,$sp,$H
bl __ecp_nistz256_sub_from # p256_sub(H, U2, in1_x);
addi $bp,$ap_real,64
addi $rp,$sp,$S2
bl __ecp_nistz256_mul_mont # p256_mul_mont(S2, Z1sqr, in1_z);
ld $bi,64($ap_real)
ld $a0,$H+0($sp)
ld $a1,$H+8($sp)
ld $a2,$H+16($sp)
ld $a3,$H+24($sp)
addi $bp,$ap_real,64
addi $rp,$sp,$res_z
bl __ecp_nistz256_mul_mont # p256_mul_mont(res_z, H, in1_z);
ld $bi,32($bp_real)
ld $a0,$S2+0($sp)
ld $a1,$S2+8($sp)
ld $a2,$S2+16($sp)
ld $a3,$S2+24($sp)
addi $bp,$bp_real,32
addi $rp,$sp,$S2
bl __ecp_nistz256_mul_mont # p256_mul_mont(S2, S2, in2_y);
addi $bp,$ap_real,32
ld $a0,$H+0($sp) # forward load for p256_sqr_mont
ld $a1,$H+8($sp)
ld $a2,$H+16($sp)
ld $a3,$H+24($sp)
addi $rp,$sp,$R
bl __ecp_nistz256_sub_from # p256_sub(R, S2, in1_y);
addi $rp,$sp,$Hsqr
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(Hsqr, H);
ld $a0,$R+0($sp)
ld $a1,$R+8($sp)
ld $a2,$R+16($sp)
ld $a3,$R+24($sp)
addi $rp,$sp,$Rsqr
bl __ecp_nistz256_sqr_mont # p256_sqr_mont(Rsqr, R);
ld $bi,$H($sp)
ld $a0,$Hsqr+0($sp)
ld $a1,$Hsqr+8($sp)
ld $a2,$Hsqr+16($sp)
ld $a3,$Hsqr+24($sp)
addi $bp,$sp,$H
addi $rp,$sp,$Hcub
bl __ecp_nistz256_mul_mont # p256_mul_mont(Hcub, Hsqr, H);
ld $bi,0($ap_real)
ld $a0,$Hsqr+0($sp)
ld $a1,$Hsqr+8($sp)
ld $a2,$Hsqr+16($sp)
ld $a3,$Hsqr+24($sp)
addi $bp,$ap_real,0
addi $rp,$sp,$U2
bl __ecp_nistz256_mul_mont # p256_mul_mont(U2, in1_x, Hsqr);
mr $t0,$acc0
mr $t1,$acc1
mr $t2,$acc2
mr $t3,$acc3
addi $rp,$sp,$Hsqr
bl __ecp_nistz256_add # p256_mul_by_2(Hsqr, U2);
addi $bp,$sp,$Rsqr
addi $rp,$sp,$res_x
bl __ecp_nistz256_sub_morf # p256_sub(res_x, Rsqr, Hsqr);
addi $bp,$sp,$Hcub
bl __ecp_nistz256_sub_from # p256_sub(res_x, res_x, Hcub);
addi $bp,$sp,$U2
ld $bi,32($ap_real) # forward load for p256_mul_mont
ld $a0,$Hcub+0($sp)
ld $a1,$Hcub+8($sp)
ld $a2,$Hcub+16($sp)
ld $a3,$Hcub+24($sp)
addi $rp,$sp,$res_y
bl __ecp_nistz256_sub_morf # p256_sub(res_y, U2, res_x);
addi $bp,$ap_real,32
addi $rp,$sp,$S2
bl __ecp_nistz256_mul_mont # p256_mul_mont(S2, in1_y, Hcub);
ld $bi,$R($sp)
ld $a0,$res_y+0($sp)
ld $a1,$res_y+8($sp)
ld $a2,$res_y+16($sp)
ld $a3,$res_y+24($sp)
addi $bp,$sp,$R
addi $rp,$sp,$res_y
bl __ecp_nistz256_mul_mont # p256_mul_mont(res_y, res_y, R);
addi $bp,$sp,$S2
bl __ecp_nistz256_sub_from # p256_sub(res_y, res_y, S2);
ld $t0,0($bp_real) # in2
ld $t1,8($bp_real)
ld $t2,16($bp_real)
ld $t3,24($bp_real)
ld $a0,$res_x+0($sp) # res
ld $a1,$res_x+8($sp)
ld $a2,$res_x+16($sp)
ld $a3,$res_x+24($sp)
___
for($i=0;$i<64;$i+=32) { # conditional moves
$code.=<<___;
ld $acc0,$i+0($ap_real) # in1
ld $acc1,$i+8($ap_real)
ld $acc2,$i+16($ap_real)
ld $acc3,$i+24($ap_real)
andc $t0,$t0,$in1infty
andc $t1,$t1,$in1infty
andc $t2,$t2,$in1infty
andc $t3,$t3,$in1infty
and $a0,$a0,$in1infty
and $a1,$a1,$in1infty
and $a2,$a2,$in1infty
and $a3,$a3,$in1infty
or $t0,$t0,$a0
or $t1,$t1,$a1
or $t2,$t2,$a2
or $t3,$t3,$a3
andc $acc0,$acc0,$in2infty
andc $acc1,$acc1,$in2infty
andc $acc2,$acc2,$in2infty
andc $acc3,$acc3,$in2infty
and $t0,$t0,$in2infty
and $t1,$t1,$in2infty
and $t2,$t2,$in2infty
and $t3,$t3,$in2infty
or $acc0,$acc0,$t0
or $acc1,$acc1,$t1
or $acc2,$acc2,$t2
or $acc3,$acc3,$t3
___
$code.=<<___ if ($i==0);
ld $t0,32($bp_real) # in2
ld $t1,40($bp_real)
ld $t2,48($bp_real)
ld $t3,56($bp_real)
___
$code.=<<___ if ($i==32);
li $t0,1 # Lone_mont
not $t1,$poly1
li $t2,-1
not $t3,$poly3
___
$code.=<<___;
ld $a0,$res_x+$i+32($sp)
ld $a1,$res_x+$i+40($sp)
ld $a2,$res_x+$i+48($sp)
ld $a3,$res_x+$i+56($sp)
std $acc0,$i+0($rp_real)
std $acc1,$i+8($rp_real)
std $acc2,$i+16($rp_real)
std $acc3,$i+24($rp_real)
___
}
$code.=<<___;
ld $acc0,$i+0($ap_real) # in1
ld $acc1,$i+8($ap_real)
ld $acc2,$i+16($ap_real)
ld $acc3,$i+24($ap_real)
andc $t0,$t0,$in1infty
andc $t1,$t1,$in1infty
andc $t2,$t2,$in1infty
andc $t3,$t3,$in1infty
and $a0,$a0,$in1infty
and $a1,$a1,$in1infty
and $a2,$a2,$in1infty
and $a3,$a3,$in1infty
or $t0,$t0,$a0
or $t1,$t1,$a1
or $t2,$t2,$a2
or $t3,$t3,$a3
andc $acc0,$acc0,$in2infty
andc $acc1,$acc1,$in2infty
andc $acc2,$acc2,$in2infty
andc $acc3,$acc3,$in2infty
and $t0,$t0,$in2infty
and $t1,$t1,$in2infty
and $t2,$t2,$in2infty
and $t3,$t3,$in2infty
or $acc0,$acc0,$t0
or $acc1,$acc1,$t1
or $acc2,$acc2,$t2
or $acc3,$acc3,$t3
std $acc0,$i+0($rp_real)
std $acc1,$i+8($rp_real)
std $acc2,$i+16($rp_real)
std $acc3,$i+24($rp_real)
mtlr r0
ld r16,$FRAME-8*16($sp)
ld r17,$FRAME-8*15($sp)
ld r18,$FRAME-8*14($sp)
ld r19,$FRAME-8*13($sp)
ld r20,$FRAME-8*12($sp)
ld r21,$FRAME-8*11($sp)
ld r22,$FRAME-8*10($sp)
ld r23,$FRAME-8*9($sp)
ld r24,$FRAME-8*8($sp)
ld r25,$FRAME-8*7($sp)
ld r26,$FRAME-8*6($sp)
ld r27,$FRAME-8*5($sp)
ld r28,$FRAME-8*4($sp)
ld r29,$FRAME-8*3($sp)
ld r30,$FRAME-8*2($sp)
ld r31,$FRAME-8*1($sp)
addi $sp,$sp,$FRAME
blr
.long 0
.byte 0,12,4,0,0x80,16,3,0
.long 0
.size ecp_nistz256_point_add_affine,.-ecp_nistz256_point_add_affine
___
}
if (1) {
my ($ordk,$ord0,$ord1,$t4) = map("r$_",(18..21));
my ($ord2,$ord3,$zr) = ($poly1,$poly3,"r0");
$code.=<<___;
########################################################################
# void ecp_nistz256_ord_mul_mont(uint64_t res[4], uint64_t a[4],
# uint64_t b[4]);
.globl ecp_nistz256_ord_mul_mont
.align 5
ecp_nistz256_ord_mul_mont:
stdu $sp,-160($sp)
std r18,48($sp)
std r19,56($sp)
std r20,64($sp)
std r21,72($sp)
std r22,80($sp)
std r23,88($sp)
std r24,96($sp)
std r25,104($sp)
std r26,112($sp)
std r27,120($sp)
std r28,128($sp)
std r29,136($sp)
std r30,144($sp)
std r31,152($sp)
ld $a0,0($ap)
ld $bi,0($bp)
ld $a1,8($ap)
ld $a2,16($ap)
ld $a3,24($ap)
lis $ordk,0xccd1
lis $ord0,0xf3b9
lis $ord1,0xbce6
ori $ordk,$ordk,0xc8aa
ori $ord0,$ord0,0xcac2
ori $ord1,$ord1,0xfaad
sldi $ordk,$ordk,32
sldi $ord0,$ord0,32
sldi $ord1,$ord1,32
oris $ordk,$ordk,0xee00
oris $ord0,$ord0,0xfc63
oris $ord1,$ord1,0xa717
ori $ordk,$ordk,0xbc4f # 0xccd1c8aaee00bc4f
ori $ord0,$ord0,0x2551 # 0xf3b9cac2fc632551
ori $ord1,$ord1,0x9e84 # 0xbce6faada7179e84
li $ord2,-1 # 0xffffffffffffffff
sldi $ord3,$ord2,32 # 0xffffffff00000000
li $zr,0
mulld $acc0,$a0,$bi # a[0]*b[0]
mulhdu $t0,$a0,$bi
mulld $acc1,$a1,$bi # a[1]*b[0]
mulhdu $t1,$a1,$bi
mulld $acc2,$a2,$bi # a[2]*b[0]
mulhdu $t2,$a2,$bi
mulld $acc3,$a3,$bi # a[3]*b[0]
mulhdu $acc4,$a3,$bi
mulld $t4,$acc0,$ordk
addc $acc1,$acc1,$t0 # accumulate high parts of multiplication
adde $acc2,$acc2,$t1
adde $acc3,$acc3,$t2
addze $acc4,$acc4
li $acc5,0
___
for ($i=1;$i<4;$i++) {
################################################################
# ffff0000.ffffffff.yyyyyyyy.zzzzzzzz
# * abcdefgh
# + xxxxxxxx.xxxxxxxx.xxxxxxxx.xxxxxxxx.xxxxxxxx
#
# Now observing that ff..ff*x = (2^n-1)*x = 2^n*x-x, we
# rewrite above as:
#
# xxxxxxxx.xxxxxxxx.xxxxxxxx.xxxxxxxx.xxxxxxxx
# - 0000abcd.efgh0000.abcdefgh.00000000.00000000
# + abcdefgh.abcdefgh.yzayzbyz.cyzdyzey.zfyzgyzh
$code.=<<___;
ld $bi,8*$i($bp) # b[i]
sldi $t0,$t4,32
subfc $acc2,$t4,$acc2
srdi $t1,$t4,32
subfe $acc3,$t0,$acc3
subfe $acc4,$t1,$acc4
subfe $acc5,$zr,$acc5
addic $t0,$acc0,-1 # discarded
mulhdu $t1,$ord0,$t4
mulld $t2,$ord1,$t4
mulhdu $t3,$ord1,$t4
adde $t2,$t2,$t1
mulld $t0,$a0,$bi
addze $t3,$t3
mulld $t1,$a1,$bi
addc $acc0,$acc1,$t2
mulld $t2,$a2,$bi
adde $acc1,$acc2,$t3
mulld $t3,$a3,$bi
adde $acc2,$acc3,$t4
adde $acc3,$acc4,$t4
addze $acc4,$acc5
addc $acc0,$acc0,$t0 # accumulate low parts
mulhdu $t0,$a0,$bi
adde $acc1,$acc1,$t1
mulhdu $t1,$a1,$bi
adde $acc2,$acc2,$t2
mulhdu $t2,$a2,$bi
adde $acc3,$acc3,$t3
mulhdu $t3,$a3,$bi
addze $acc4,$acc4
mulld $t4,$acc0,$ordk
addc $acc1,$acc1,$t0 # accumulate high parts
adde $acc2,$acc2,$t1
adde $acc3,$acc3,$t2
adde $acc4,$acc4,$t3
addze $acc5,$zr
___
}
$code.=<<___;
sldi $t0,$t4,32 # last reduction
subfc $acc2,$t4,$acc2
srdi $t1,$t4,32
subfe $acc3,$t0,$acc3
subfe $acc4,$t1,$acc4
subfe $acc5,$zr,$acc5
addic $t0,$acc0,-1 # discarded
mulhdu $t1,$ord0,$t4
mulld $t2,$ord1,$t4
mulhdu $t3,$ord1,$t4
adde $t2,$t2,$t1
addze $t3,$t3
addc $acc0,$acc1,$t2
adde $acc1,$acc2,$t3
adde $acc2,$acc3,$t4
adde $acc3,$acc4,$t4
addze $acc4,$acc5
subfc $acc0,$ord0,$acc0 # ret -= modulus
subfe $acc1,$ord1,$acc1
subfe $acc2,$ord2,$acc2
subfe $acc3,$ord3,$acc3
subfe $acc4,$zr,$acc4
and $t0,$ord0,$acc4
and $t1,$ord1,$acc4
addc $acc0,$acc0,$t0 # ret += modulus if borrow
and $t3,$ord3,$acc4
adde $acc1,$acc1,$t1
adde $acc2,$acc2,$acc4
adde $acc3,$acc3,$t3
std $acc0,0($rp)
std $acc1,8($rp)
std $acc2,16($rp)
std $acc3,24($rp)
ld r18,48($sp)
ld r19,56($sp)
ld r20,64($sp)
ld r21,72($sp)
ld r22,80($sp)
ld r23,88($sp)
ld r24,96($sp)
ld r25,104($sp)
ld r26,112($sp)
ld r27,120($sp)
ld r28,128($sp)
ld r29,136($sp)
ld r30,144($sp)
ld r31,152($sp)
addi $sp,$sp,160
blr
.long 0
.byte 0,12,4,0,0x80,14,3,0
.long 0
.size ecp_nistz256_ord_mul_mont,.-ecp_nistz256_ord_mul_mont
################################################################################
# void ecp_nistz256_ord_sqr_mont(uint64_t res[4], uint64_t a[4],
# int rep);
.globl ecp_nistz256_ord_sqr_mont
.align 5
ecp_nistz256_ord_sqr_mont:
stdu $sp,-160($sp)
std r18,48($sp)
std r19,56($sp)
std r20,64($sp)
std r21,72($sp)
std r22,80($sp)
std r23,88($sp)
std r24,96($sp)
std r25,104($sp)
std r26,112($sp)
std r27,120($sp)
std r28,128($sp)
std r29,136($sp)
std r30,144($sp)
std r31,152($sp)
mtctr $bp
ld $a0,0($ap)
ld $a1,8($ap)
ld $a2,16($ap)
ld $a3,24($ap)
lis $ordk,0xccd1
lis $ord0,0xf3b9
lis $ord1,0xbce6
ori $ordk,$ordk,0xc8aa
ori $ord0,$ord0,0xcac2
ori $ord1,$ord1,0xfaad
sldi $ordk,$ordk,32
sldi $ord0,$ord0,32
sldi $ord1,$ord1,32
oris $ordk,$ordk,0xee00
oris $ord0,$ord0,0xfc63
oris $ord1,$ord1,0xa717
ori $ordk,$ordk,0xbc4f # 0xccd1c8aaee00bc4f
ori $ord0,$ord0,0x2551 # 0xf3b9cac2fc632551
ori $ord1,$ord1,0x9e84 # 0xbce6faada7179e84
li $ord2,-1 # 0xffffffffffffffff
sldi $ord3,$ord2,32 # 0xffffffff00000000
li $zr,0
b .Loop_ord_sqr
.align 5
.Loop_ord_sqr:
################################################################
# | | | | | |a1*a0| |
# | | | | |a2*a0| | |
# | |a3*a2|a3*a0| | | |
# | | | |a2*a1| | | |
# | | |a3*a1| | | | |
# *| | | | | | | | 2|
# +|a3*a3|a2*a2|a1*a1|a0*a0|
# |--+--+--+--+--+--+--+--|
# |A7|A6|A5|A4|A3|A2|A1|A0|, where Ax is $accx, i.e. follow $accx
#
# "can't overflow" below mark carrying into high part of
# multiplication result, which can't overflow, because it
# can never be all ones.
mulld $acc1,$a1,$a0 # a[1]*a[0]
mulhdu $t1,$a1,$a0
mulld $acc2,$a2,$a0 # a[2]*a[0]
mulhdu $t2,$a2,$a0
mulld $acc3,$a3,$a0 # a[3]*a[0]
mulhdu $acc4,$a3,$a0
addc $acc2,$acc2,$t1 # accumulate high parts of multiplication
mulld $t0,$a2,$a1 # a[2]*a[1]
mulhdu $t1,$a2,$a1
adde $acc3,$acc3,$t2
mulld $t2,$a3,$a1 # a[3]*a[1]
mulhdu $t3,$a3,$a1
addze $acc4,$acc4 # can't overflow
mulld $acc5,$a3,$a2 # a[3]*a[2]
mulhdu $acc6,$a3,$a2
addc $t1,$t1,$t2 # accumulate high parts of multiplication
mulld $acc0,$a0,$a0 # a[0]*a[0]
addze $t2,$t3 # can't overflow
addc $acc3,$acc3,$t0 # accumulate low parts of multiplication
mulhdu $a0,$a0,$a0
adde $acc4,$acc4,$t1
mulld $t1,$a1,$a1 # a[1]*a[1]
adde $acc5,$acc5,$t2
mulhdu $a1,$a1,$a1
addze $acc6,$acc6 # can't overflow
addc $acc1,$acc1,$acc1 # acc[1-6]*=2
mulld $t2,$a2,$a2 # a[2]*a[2]
adde $acc2,$acc2,$acc2
mulhdu $a2,$a2,$a2
adde $acc3,$acc3,$acc3
mulld $t3,$a3,$a3 # a[3]*a[3]
adde $acc4,$acc4,$acc4
mulhdu $a3,$a3,$a3
adde $acc5,$acc5,$acc5
adde $acc6,$acc6,$acc6
addze $acc7,$zr
addc $acc1,$acc1,$a0 # +a[i]*a[i]
mulld $t4,$acc0,$ordk
adde $acc2,$acc2,$t1
adde $acc3,$acc3,$a1
adde $acc4,$acc4,$t2
adde $acc5,$acc5,$a2
adde $acc6,$acc6,$t3
adde $acc7,$acc7,$a3
___
for($i=0; $i<4; $i++) { # reductions
$code.=<<___;
addic $t0,$acc0,-1 # discarded
mulhdu $t1,$ord0,$t4
mulld $t2,$ord1,$t4
mulhdu $t3,$ord1,$t4
adde $t2,$t2,$t1
addze $t3,$t3
addc $acc0,$acc1,$t2
adde $acc1,$acc2,$t3
adde $acc2,$acc3,$t4
adde $acc3,$zr,$t4 # can't overflow
___
$code.=<<___ if ($i<3);
mulld $t3,$acc0,$ordk
___
$code.=<<___;
sldi $t0,$t4,32
subfc $acc1,$t4,$acc1
srdi $t1,$t4,32
subfe $acc2,$t0,$acc2
subfe $acc3,$t1,$acc3 # can't borrow
___
($t3,$t4) = ($t4,$t3);
}
$code.=<<___;
addc $acc0,$acc0,$acc4 # accumulate upper half
adde $acc1,$acc1,$acc5
adde $acc2,$acc2,$acc6
adde $acc3,$acc3,$acc7
addze $acc4,$zr
subfc $acc0,$ord0,$acc0 # ret -= modulus
subfe $acc1,$ord1,$acc1
subfe $acc2,$ord2,$acc2
subfe $acc3,$ord3,$acc3
subfe $acc4,$zr,$acc4
and $t0,$ord0,$acc4
and $t1,$ord1,$acc4
addc $a0,$acc0,$t0 # ret += modulus if borrow
and $t3,$ord3,$acc4
adde $a1,$acc1,$t1
adde $a2,$acc2,$acc4
adde $a3,$acc3,$t3
bdnz .Loop_ord_sqr
std $a0,0($rp)
std $a1,8($rp)
std $a2,16($rp)
std $a3,24($rp)
ld r18,48($sp)
ld r19,56($sp)
ld r20,64($sp)
ld r21,72($sp)
ld r22,80($sp)
ld r23,88($sp)
ld r24,96($sp)
ld r25,104($sp)
ld r26,112($sp)
ld r27,120($sp)
ld r28,128($sp)
ld r29,136($sp)
ld r30,144($sp)
ld r31,152($sp)
addi $sp,$sp,160
blr
.long 0
.byte 0,12,4,0,0x80,14,3,0
.long 0
.size ecp_nistz256_ord_sqr_mont,.-ecp_nistz256_ord_sqr_mont
___
} }
########################################################################
# scatter-gather subroutines
{
my ($out,$inp,$index,$mask)=map("r$_",(3..7));
$code.=<<___;
########################################################################
# void ecp_nistz256_scatter_w5(void *out, const P256_POINT *inp,
# int index);
.globl ecp_nistz256_scatter_w5
.align 4
ecp_nistz256_scatter_w5:
slwi $index,$index,2
add $out,$out,$index
ld r8, 0($inp) # X
ld r9, 8($inp)
ld r10,16($inp)
ld r11,24($inp)
stw r8, 64*0-4($out)
srdi r8, r8, 32
stw r9, 64*1-4($out)
srdi r9, r9, 32
stw r10,64*2-4($out)
srdi r10,r10,32
stw r11,64*3-4($out)
srdi r11,r11,32
stw r8, 64*4-4($out)
stw r9, 64*5-4($out)
stw r10,64*6-4($out)
stw r11,64*7-4($out)
addi $out,$out,64*8
ld r8, 32($inp) # Y
ld r9, 40($inp)
ld r10,48($inp)
ld r11,56($inp)
stw r8, 64*0-4($out)
srdi r8, r8, 32
stw r9, 64*1-4($out)
srdi r9, r9, 32
stw r10,64*2-4($out)
srdi r10,r10,32
stw r11,64*3-4($out)
srdi r11,r11,32
stw r8, 64*4-4($out)
stw r9, 64*5-4($out)
stw r10,64*6-4($out)
stw r11,64*7-4($out)
addi $out,$out,64*8
ld r8, 64($inp) # Z
ld r9, 72($inp)
ld r10,80($inp)
ld r11,88($inp)
stw r8, 64*0-4($out)
srdi r8, r8, 32
stw r9, 64*1-4($out)
srdi r9, r9, 32
stw r10,64*2-4($out)
srdi r10,r10,32
stw r11,64*3-4($out)
srdi r11,r11,32
stw r8, 64*4-4($out)
stw r9, 64*5-4($out)
stw r10,64*6-4($out)
stw r11,64*7-4($out)
blr
.long 0
.byte 0,12,0x14,0,0,0,3,0
.long 0
.size ecp_nistz256_scatter_w5,.-ecp_nistz256_scatter_w5
########################################################################
# void ecp_nistz256_gather_w5(P256_POINT *out, const void *inp,
# int index);
.globl ecp_nistz256_gather_w5
.align 4
ecp_nistz256_gather_w5:
neg r0,$index
sradi r0,r0,63
add $index,$index,r0
slwi $index,$index,2
add $inp,$inp,$index
lwz r5, 64*0($inp)
lwz r6, 64*1($inp)
lwz r7, 64*2($inp)
lwz r8, 64*3($inp)
lwz r9, 64*4($inp)
lwz r10,64*5($inp)
lwz r11,64*6($inp)
lwz r12,64*7($inp)
addi $inp,$inp,64*8
sldi r9, r9, 32
sldi r10,r10,32
sldi r11,r11,32
sldi r12,r12,32
or r5,r5,r9
or r6,r6,r10
or r7,r7,r11
or r8,r8,r12
and r5,r5,r0
and r6,r6,r0
and r7,r7,r0
and r8,r8,r0
std r5,0($out) # X
std r6,8($out)
std r7,16($out)
std r8,24($out)
lwz r5, 64*0($inp)
lwz r6, 64*1($inp)
lwz r7, 64*2($inp)
lwz r8, 64*3($inp)
lwz r9, 64*4($inp)
lwz r10,64*5($inp)
lwz r11,64*6($inp)
lwz r12,64*7($inp)
addi $inp,$inp,64*8
sldi r9, r9, 32
sldi r10,r10,32
sldi r11,r11,32
sldi r12,r12,32
or r5,r5,r9
or r6,r6,r10
or r7,r7,r11
or r8,r8,r12
and r5,r5,r0
and r6,r6,r0
and r7,r7,r0
and r8,r8,r0
std r5,32($out) # Y
std r6,40($out)
std r7,48($out)
std r8,56($out)
lwz r5, 64*0($inp)
lwz r6, 64*1($inp)
lwz r7, 64*2($inp)
lwz r8, 64*3($inp)
lwz r9, 64*4($inp)
lwz r10,64*5($inp)
lwz r11,64*6($inp)
lwz r12,64*7($inp)
sldi r9, r9, 32
sldi r10,r10,32
sldi r11,r11,32
sldi r12,r12,32
or r5,r5,r9
or r6,r6,r10
or r7,r7,r11
or r8,r8,r12
and r5,r5,r0
and r6,r6,r0
and r7,r7,r0
and r8,r8,r0
std r5,64($out) # Z
std r6,72($out)
std r7,80($out)
std r8,88($out)
blr
.long 0
.byte 0,12,0x14,0,0,0,3,0
.long 0
.size ecp_nistz256_gather_w5,.-ecp_nistz256_gather_w5
########################################################################
# void ecp_nistz256_scatter_w7(void *out, const P256_POINT_AFFINE *inp,
# int index);
.globl ecp_nistz256_scatter_w7
.align 4
ecp_nistz256_scatter_w7:
li r0,8
mtctr r0
add $out,$out,$index
subi $inp,$inp,8
.Loop_scatter_w7:
ldu r0,8($inp)
stb r0,64*0-1($out)
srdi r0,r0,8
stb r0,64*1-1($out)
srdi r0,r0,8
stb r0,64*2-1($out)
srdi r0,r0,8
stb r0,64*3-1($out)
srdi r0,r0,8
stb r0,64*4-1($out)
srdi r0,r0,8
stb r0,64*5-1($out)
srdi r0,r0,8
stb r0,64*6-1($out)
srdi r0,r0,8
stb r0,64*7-1($out)
addi $out,$out,64*8
bdnz .Loop_scatter_w7
blr
.long 0
.byte 0,12,0x14,0,0,0,3,0
.long 0
.size ecp_nistz256_scatter_w7,.-ecp_nistz256_scatter_w7
########################################################################
# void ecp_nistz256_gather_w7(P256_POINT_AFFINE *out, const void *inp,
# int index);
.globl ecp_nistz256_gather_w7
.align 4
ecp_nistz256_gather_w7:
li r0,8
mtctr r0
neg r0,$index
sradi r0,r0,63
add $index,$index,r0
add $inp,$inp,$index
subi $out,$out,8
.Loop_gather_w7:
lbz r5, 64*0($inp)
lbz r6, 64*1($inp)
lbz r7, 64*2($inp)
lbz r8, 64*3($inp)
lbz r9, 64*4($inp)
lbz r10,64*5($inp)
lbz r11,64*6($inp)
lbz r12,64*7($inp)
addi $inp,$inp,64*8
sldi r6, r6, 8
sldi r7, r7, 16
sldi r8, r8, 24
sldi r9, r9, 32
sldi r10,r10,40
sldi r11,r11,48
sldi r12,r12,56
or r5,r5,r6
or r7,r7,r8
or r9,r9,r10
or r11,r11,r12
or r5,r5,r7
or r9,r9,r11
or r5,r5,r9
and r5,r5,r0
stdu r5,8($out)
bdnz .Loop_gather_w7
blr
.long 0
.byte 0,12,0x14,0,0,0,3,0
.long 0
.size ecp_nistz256_gather_w7,.-ecp_nistz256_gather_w7
___
}
foreach (split("\n",$code)) {
s/\`([^\`]*)\`/eval $1/ge;
print $_,"\n";
}
close STDOUT; # enforce flush
| 22.045034 | 80 | 0.617996 |
Subsets and Splits