entry_point
stringlengths 1
65
| original_triton_code
stringlengths 4.5k
619k
| python_code
stringlengths 208
60.9k
| triton_code
stringlengths 1.15k
275k
| repo_name
stringlengths 7
115
| module_name
stringlengths 1
65
| synthetic
bool 1
class | uuid
int64 0
18.5k
| licenses
listlengths 1
6
| stars
int64 0
19.8k
| sha
stringlengths 40
40
| repo_link
stringlengths 72
180
|
---|---|---|---|---|---|---|---|---|---|---|---|
BCELoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/a6/ca625ch2ma4nxamrbh6aiqjarhys2ayutwxi7mqpfwzyf5cgoavx.py
# Topologically Sorted Source Nodes: [loss, mul], Original ATen: [aten.binary_cross_entropy, aten.mul]
# Source node to ATen node mapping:
# loss => full_default, full_default_1, log, log1p, maximum, maximum_1, mean, mul, mul_1, neg, sub, sub_1
# mul => mul_2
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, 1), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%arg1_1,), kwargs = {})
# %log1p : [num_users=1] = call_function[target=torch.ops.aten.log1p.default](args = (%neg,), kwargs = {})
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], -100), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %maximum : [num_users=1] = call_function[target=torch.ops.aten.maximum.default](args = (%log1p, %full_default), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, %maximum), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%arg1_1,), kwargs = {})
# %full_default_1 : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], -100), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %maximum_1 : [num_users=1] = call_function[target=torch.ops.aten.maximum.default](args = (%log, %full_default_1), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg0_1, %maximum_1), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%mul, %mul_1), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%sub_1,), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_binary_cross_entropy_mul_0 = async_compile.triton('triton_per_fused_binary_cross_entropy_mul_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_binary_cross_entropy_mul_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_binary_cross_entropy_mul_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp3 = tl.load(in_ptr1 + (r0), None)
tmp1 = 1.0
tmp2 = tmp0 - tmp1
tmp4 = -tmp3
tmp5 = libdevice.log1p(tmp4)
tmp6 = -100.0
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp2 * tmp7
tmp9 = tl_math.log(tmp3)
tmp10 = triton_helpers.maximum(tmp9, tmp6)
tmp11 = tmp0 * tmp10
tmp12 = tmp8 - tmp11
tmp13 = tl.broadcast_to(tmp12, [RBLOCK])
tmp15 = triton_helpers.promote_to_tensor(tl.sum(tmp13, 0))
tmp16 = 256.0
tmp17 = tmp15 / tmp16
tmp18 = tmp17 * tmp1
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp18, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [loss, mul], Original ATen: [aten.binary_cross_entropy, aten.mul]
stream0 = get_raw_stream(0)
triton_per_fused_binary_cross_entropy_mul_0.run(buf1, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class BCELoss(nn.Module):
"""Binary Cross Entropy loss."""
def __init__(self, use_target_weight=False, loss_weight=1.0):
super().__init__()
self.criterion = F.binary_cross_entropy
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
def forward(self, output, target, target_weight=None):
"""Forward function.
Note:
- batch_size: N
- num_labels: K
Args:
output (torch.Tensor[N, K]): Output classification.
target (torch.Tensor[N, K]): Target classification.
target_weight (torch.Tensor[N, K] or torch.Tensor[N]):
Weights across different labels.
"""
if self.use_target_weight:
assert target_weight is not None
loss = self.criterion(output, target, reduction='none')
if target_weight.dim() == 1:
target_weight = target_weight[:, None]
loss = (loss * target_weight).mean()
else:
loss = self.criterion(output, target)
return loss * self.loss_weight
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_binary_cross_entropy_mul_0(in_out_ptr0, in_ptr0,
in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp3 = tl.load(in_ptr1 + r0, None)
tmp1 = 1.0
tmp2 = tmp0 - tmp1
tmp4 = -tmp3
tmp5 = libdevice.log1p(tmp4)
tmp6 = -100.0
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp2 * tmp7
tmp9 = tl_math.log(tmp3)
tmp10 = triton_helpers.maximum(tmp9, tmp6)
tmp11 = tmp0 * tmp10
tmp12 = tmp8 - tmp11
tmp13 = tl.broadcast_to(tmp12, [RBLOCK])
tmp15 = triton_helpers.promote_to_tensor(tl.sum(tmp13, 0))
tmp16 = 256.0
tmp17 = tmp15 / tmp16
tmp18 = tmp17 * tmp1
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp18, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_binary_cross_entropy_mul_0[grid(1)](buf1, arg0_1,
arg1_1, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
class BCELossNew(nn.Module):
"""Binary Cross Entropy loss."""
def __init__(self, use_target_weight=False, loss_weight=1.0):
super().__init__()
self.criterion = F.binary_cross_entropy
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ALISCIFP/mmpose
|
BCELoss
| false | 2,053 |
[
"Apache-2.0"
] | 0 |
2433e3dbcc44baa2253e2a7c748ba0216937933e
|
https://github.com/ALISCIFP/mmpose/tree/2433e3dbcc44baa2253e2a7c748ba0216937933e
|
SoftWingLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/un/cunwpec7dtp6lckksegntrqkwzophx7kdx4optoqpzwrrovam74k.py
# Topologically Sorted Source Nodes: [sub, delta, lt, truediv, add, log, mul, add_1, losses, sum_1], Original ATen: [aten.sub, aten.abs, aten.lt, aten.div, aten.add, aten.log, aten.mul, aten.where, aten.sum]
# Source node to ATen node mapping:
# add => add
# add_1 => add_1
# delta => abs_1
# log => log
# losses => where
# lt => lt
# mul => mul
# sub => sub
# sum_1 => sum_1
# truediv => div
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %abs_1 : [num_users=3] = call_function[target=torch.ops.aten.abs.default](args = (%sub,), kwargs = {})
# %lt : [num_users=1] = call_function[target=torch.ops.aten.lt.Scalar](args = (%abs_1, 2.0), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%abs_1, 0.5), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%div, 1.0), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%add,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%log, 20.0), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, -30.188758248682007), kwargs = {})
# %where : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%lt, %abs_1, %add_1), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%where, [1, 2]), kwargs = {})
triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0 = async_compile.triton('triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 16],
reduction_hint=ReductionHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0(in_ptr0, in_ptr1, out_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r2 = rindex
x0 = xindex % 4
x1 = (xindex // 4)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (4*r2) + (64*x1)), xmask, other=0.0)
tmp1 = tl.load(in_ptr1 + (x0 + (4*r2) + (64*x1)), xmask, other=0.0)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = 2.0
tmp5 = tmp3 < tmp4
tmp6 = tmp3 * tmp4
tmp7 = 1.0
tmp8 = tmp6 + tmp7
tmp9 = tl_math.log(tmp8)
tmp10 = 20.0
tmp11 = tmp9 * tmp10
tmp12 = -30.188758248682007
tmp13 = tmp11 + tmp12
tmp14 = tl.where(tmp5, tmp3, tmp13)
tmp15 = tl.broadcast_to(tmp14, [XBLOCK, RBLOCK])
tmp17 = tl.where(xmask, tmp15, 0)
tmp18 = tl.sum(tmp17, 1)[:, None]
tl.store(out_ptr0 + (x3), tmp18, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/yi/cyivqxc32riwmi4nsqtijcqefjxyivwafk4qjnscryb6cwpfnqim.py
# Topologically Sorted Source Nodes: [loss, mul_1], Original ATen: [aten.mean, aten.mul]
# Source node to ATen node mapping:
# loss => mean
# mul_1 => mul_1
# Graph fragment:
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%sum_1, [0]), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_poi_fused_mean_mul_1 = async_compile.triton('triton_poi_fused_mean_mul_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mean_mul_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mean_mul_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = tl.load(in_ptr0 + (4 + x0), xmask)
tmp3 = tl.load(in_ptr0 + (8 + x0), xmask)
tmp5 = tl.load(in_ptr0 + (12 + x0), xmask)
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 4.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.store(out_ptr0 + (x0), tmp10, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [sub, delta, lt, truediv, add, log, mul, add_1, losses, sum_1], Original ATen: [aten.sub, aten.abs, aten.lt, aten.div, aten.add, aten.log, aten.mul, aten.where, aten.sum]
stream0 = get_raw_stream(0)
triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0.run(arg0_1, arg1_1, buf0, 16, 16, grid=grid(16), stream=stream0)
del arg0_1
del arg1_1
buf1 = empty_strided_cuda((4, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [loss, mul_1], Original ATen: [aten.mean, aten.mul]
triton_poi_fused_mean_mul_1.run(buf0, buf1, 4, grid=grid(4), stream=stream0)
del buf0
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import math
import torch
import torch.nn as nn
class SoftWingLoss(nn.Module):
"""Soft Wing Loss 'Structure-Coherent Deep Feature Learning for Robust Face
Alignment' Lin et al. TIP'2021.
loss =
1. |x| , if |x| < omega1
2. omega2*ln(1+|x|/epsilon) + B, if |x| >= omega1
Args:
omega1 (float): The first threshold.
omega2 (float): The second threshold.
epsilon (float): Also referred to as curvature.
use_target_weight (bool): Option to use weighted MSE loss.
Different joint types may have different target weights.
loss_weight (float): Weight of the loss. Default: 1.0.
"""
def __init__(self, omega1=2.0, omega2=20.0, epsilon=0.5,
use_target_weight=False, loss_weight=1.0):
super().__init__()
self.omega1 = omega1
self.omega2 = omega2
self.epsilon = epsilon
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
self.B = self.omega1 - self.omega2 * math.log(1.0 + self.omega1 /
self.epsilon)
def criterion(self, pred, target):
"""Criterion of wingloss.
Note:
batch_size: N
num_keypoints: K
dimension of keypoints: D (D=2 or D=3)
Args:
pred (torch.Tensor[N, K, D]): Output regression.
target (torch.Tensor[N, K, D]): Target regression.
"""
delta = (target - pred).abs()
losses = torch.where(delta < self.omega1, delta, self.omega2 *
torch.log(1.0 + delta / self.epsilon) + self.B)
return torch.mean(torch.sum(losses, dim=[1, 2]), dim=0)
def forward(self, output, target, target_weight=None):
"""Forward function.
Note:
batch_size: N
num_keypoints: K
dimension of keypoints: D (D=2 or D=3)
Args:
output (torch.Tensor[N, K, D]): Output regression.
target (torch.Tensor[N, K, D]): Target regression.
target_weight (torch.Tensor[N, K, D]):
Weights across different joint types.
"""
if self.use_target_weight:
assert target_weight is not None
loss = self.criterion(output * target_weight, target *
target_weight)
else:
loss = self.criterion(output, target)
return loss * self.loss_weight
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import math as tl_math
import math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0(in_ptr0,
in_ptr1, out_ptr0, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r2 = rindex
x0 = xindex % 4
x1 = xindex // 4
x3 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 4 * r2 + 64 * x1), xmask, other=0.0)
tmp1 = tl.load(in_ptr1 + (x0 + 4 * r2 + 64 * x1), xmask, other=0.0)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = 2.0
tmp5 = tmp3 < tmp4
tmp6 = tmp3 * tmp4
tmp7 = 1.0
tmp8 = tmp6 + tmp7
tmp9 = tl_math.log(tmp8)
tmp10 = 20.0
tmp11 = tmp9 * tmp10
tmp12 = -30.188758248682007
tmp13 = tmp11 + tmp12
tmp14 = tl.where(tmp5, tmp3, tmp13)
tmp15 = tl.broadcast_to(tmp14, [XBLOCK, RBLOCK])
tmp17 = tl.where(xmask, tmp15, 0)
tmp18 = tl.sum(tmp17, 1)[:, None]
tl.store(out_ptr0 + x3, tmp18, xmask)
@triton.jit
def triton_poi_fused_mean_mul_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = tl.load(in_ptr0 + (4 + x0), xmask)
tmp3 = tl.load(in_ptr0 + (8 + x0), xmask)
tmp5 = tl.load(in_ptr0 + (12 + x0), xmask)
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 4.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.store(out_ptr0 + x0, tmp10, xmask)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
get_raw_stream(0)
triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0[grid(16)](
arg0_1, arg1_1, buf0, 16, 16, XBLOCK=1, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
buf1 = empty_strided_cuda((4,), (1,), torch.float32)
triton_poi_fused_mean_mul_1[grid(4)](buf0, buf1, 4, XBLOCK=4,
num_warps=1, num_stages=1)
del buf0
return buf1,
class SoftWingLossNew(nn.Module):
"""Soft Wing Loss 'Structure-Coherent Deep Feature Learning for Robust Face
Alignment' Lin et al. TIP'2021.
loss =
1. |x| , if |x| < omega1
2. omega2*ln(1+|x|/epsilon) + B, if |x| >= omega1
Args:
omega1 (float): The first threshold.
omega2 (float): The second threshold.
epsilon (float): Also referred to as curvature.
use_target_weight (bool): Option to use weighted MSE loss.
Different joint types may have different target weights.
loss_weight (float): Weight of the loss. Default: 1.0.
"""
def __init__(self, omega1=2.0, omega2=20.0, epsilon=0.5,
use_target_weight=False, loss_weight=1.0):
super().__init__()
self.omega1 = omega1
self.omega2 = omega2
self.epsilon = epsilon
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
self.B = self.omega1 - self.omega2 * math.log(1.0 + self.omega1 /
self.epsilon)
def criterion(self, pred, target):
"""Criterion of wingloss.
Note:
batch_size: N
num_keypoints: K
dimension of keypoints: D (D=2 or D=3)
Args:
pred (torch.Tensor[N, K, D]): Output regression.
target (torch.Tensor[N, K, D]): Target regression.
"""
delta = (target - pred).abs()
losses = torch.where(delta < self.omega1, delta, self.omega2 *
torch.log(1.0 + delta / self.epsilon) + self.B)
return torch.mean(torch.sum(losses, dim=[1, 2]), dim=0)
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ALISCIFP/mmpose
|
SoftWingLoss
| false | 2,054 |
[
"Apache-2.0"
] | 0 |
2433e3dbcc44baa2253e2a7c748ba0216937933e
|
https://github.com/ALISCIFP/mmpose/tree/2433e3dbcc44baa2253e2a7c748ba0216937933e
|
Regression
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/jv/cjvfpvazszqsn7k2c7ac25njk43pn5fjlaxzgkwwsgomov2lqu5x.py
# Topologically Sorted Source Nodes: [x1], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# x1 => relu
# Graph fragment:
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_1,), kwargs = {})
# %le_1 : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_0 = async_compile.triton('triton_poi_fused_relu_threshold_backward_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1536
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 24
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
tl.store(out_ptr0 + (x2), tmp6, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7 = args
args.clear()
assert_size_stride(primals_1, (24, 4), (4, 1))
assert_size_stride(primals_2, (24, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (24, 24), (24, 1))
assert_size_stride(primals_5, (24, ), (1, ))
assert_size_stride(primals_6, (4, 24), (24, 1))
assert_size_stride(primals_7, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 24), (24, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 24), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 24), (384, 96, 24, 1), 0); del buf0 # reuse
buf6 = empty_strided_cuda((4, 4, 4, 24), (384, 96, 24, 1), torch.bool)
# Topologically Sorted Source Nodes: [x1], Original ATen: [aten.relu, aten.threshold_backward]
stream0 = get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0.run(buf1, primals_2, buf6, 1536, grid=grid(1536), stream=stream0)
del primals_2
buf2 = empty_strided_cuda((64, 24), (24, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf1, (64, 24), (24, 1), 0), reinterpret_tensor(primals_4, (24, 24), (1, 24), 0), out=buf2)
buf3 = reinterpret_tensor(buf2, (4, 4, 4, 24), (384, 96, 24, 1), 0); del buf2 # reuse
buf5 = empty_strided_cuda((4, 4, 4, 24), (384, 96, 24, 1), torch.bool)
# Topologically Sorted Source Nodes: [x2], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_0.run(buf3, primals_5, buf5, 1536, grid=grid(1536), stream=stream0)
del primals_5
buf4 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x3], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_7, reinterpret_tensor(buf3, (64, 24), (24, 1), 0), reinterpret_tensor(primals_6, (24, 4), (1, 24), 0), alpha=1, beta=1, out=buf4)
del primals_7
return (reinterpret_tensor(buf4, (4, 4, 4, 4), (64, 16, 4, 1), 0), reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(buf1, (64, 24), (24, 1), 0), reinterpret_tensor(buf3, (64, 24), (24, 1), 0), primals_6, buf5, primals_4, buf6, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((24, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((24, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((24, 24), (24, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((24, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 24), (24, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
import torch.onnx
class Regression(nn.Module):
def __init__(self, input_size, output_size):
super(Regression, self).__init__()
self.layer1 = nn.Linear(input_size, 24)
self.layer2 = nn.Linear(24, 24)
self.layer3 = nn.Linear(24, output_size)
def forward(self, x):
x1 = F.relu(self.layer1(x))
x2 = F.relu(self.layer2(x1))
x3 = self.layer3(x2)
return x3
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'input_size': 4, 'output_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
import torch.onnx
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 1536
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 24
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, xmask)
tl.store(out_ptr0 + x2, tmp6, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7) = args
args.clear()
assert_size_stride(primals_1, (24, 4), (4, 1))
assert_size_stride(primals_2, (24,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (24, 24), (24, 1))
assert_size_stride(primals_5, (24,), (1,))
assert_size_stride(primals_6, (4, 24), (24, 1))
assert_size_stride(primals_7, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 24), (24, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 24), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 24), (384, 96, 24, 1), 0)
del buf0
buf6 = empty_strided_cuda((4, 4, 4, 24), (384, 96, 24, 1), torch.bool)
get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0[grid(1536)](buf1,
primals_2, buf6, 1536, XBLOCK=256, num_warps=4, num_stages=1)
del primals_2
buf2 = empty_strided_cuda((64, 24), (24, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf1, (64, 24), (24, 1), 0),
reinterpret_tensor(primals_4, (24, 24), (1, 24), 0), out=buf2)
buf3 = reinterpret_tensor(buf2, (4, 4, 4, 24), (384, 96, 24, 1), 0)
del buf2
buf5 = empty_strided_cuda((4, 4, 4, 24), (384, 96, 24, 1), torch.bool)
triton_poi_fused_relu_threshold_backward_0[grid(1536)](buf3,
primals_5, buf5, 1536, XBLOCK=256, num_warps=4, num_stages=1)
del primals_5
buf4 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_7, reinterpret_tensor(buf3, (64, 24),
(24, 1), 0), reinterpret_tensor(primals_6, (24, 4), (1, 24), 0),
alpha=1, beta=1, out=buf4)
del primals_7
return reinterpret_tensor(buf4, (4, 4, 4, 4), (64, 16, 4, 1), 0
), reinterpret_tensor(primals_3, (64, 4), (4, 1), 0
), reinterpret_tensor(buf1, (64, 24), (24, 1), 0), reinterpret_tensor(
buf3, (64, 24), (24, 1), 0), primals_6, buf5, primals_4, buf6
class RegressionNew(nn.Module):
def __init__(self, input_size, output_size):
super(RegressionNew, self).__init__()
self.layer1 = nn.Linear(input_size, 24)
self.layer2 = nn.Linear(24, 24)
self.layer3 = nn.Linear(24, output_size)
def forward(self, input_0):
primals_1 = self.layer1.weight
primals_2 = self.layer1.bias
primals_4 = self.layer2.weight
primals_5 = self.layer2.bias
primals_6 = self.layer3.weight
primals_7 = self.layer3.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7])
return output[0]
|
BEOKS/Windows-Machine-Learning
|
Regression
| false | 2,055 |
[
"MIT"
] | 0 |
e227909baa5ef604d45afa976dc04598f09d76bd
|
https://github.com/BEOKS/Windows-Machine-Learning/tree/e227909baa5ef604d45afa976dc04598f09d76bd
|
L2Norm
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/gj/cgj7f4rogjebeuosz3asgun5w2hregxq3ziitg4vtnz4jtcqfmau.py
# Topologically Sorted Source Nodes: [pow_1, sum_1, sqrt, norm, mul, truediv], Original ATen: [aten.pow, aten.sum, aten.sqrt, aten.add, aten.mul, aten.div]
# Source node to ATen node mapping:
# mul => mul
# norm => add
# pow_1 => pow_1
# sqrt => sqrt
# sum_1 => sum_1
# truediv => div
# Graph fragment:
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%primals_1, 2), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%pow_1, [1], True), kwargs = {})
# %sqrt : [num_users=1] = call_function[target=torch.ops.aten.sqrt.default](args = (%sum_1,), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sqrt, 1e-10), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%expand, %primals_1), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%mul, %add), kwargs = {})
triton_poi_fused_add_div_mul_pow_sqrt_sum_0 = async_compile.triton('triton_poi_fused_add_div_mul_pow_sqrt_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_div_mul_pow_sqrt_sum_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 6, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_div_mul_pow_sqrt_sum_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 16) % 4
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x3), xmask)
tmp3 = tl.load(in_ptr1 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr1 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr1 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr1 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tmp0 * tmp1
tmp4 = tmp3 * tmp3
tmp6 = tmp5 * tmp5
tmp7 = tmp4 + tmp6
tmp9 = tmp8 * tmp8
tmp10 = tmp7 + tmp9
tmp12 = tmp11 * tmp11
tmp13 = tmp10 + tmp12
tmp14 = libdevice.sqrt(tmp13)
tmp15 = 1e-10
tmp16 = tmp14 + tmp15
tmp17 = tmp2 / tmp16
tl.store(out_ptr0 + (x3), tmp17, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [pow_1, sum_1, sqrt, norm, mul, truediv], Original ATen: [aten.pow, aten.sum, aten.sqrt, aten.add, aten.mul, aten.div]
stream0 = get_raw_stream(0)
triton_poi_fused_add_div_mul_pow_sqrt_sum_0.run(primals_2, primals_1, buf0, 256, grid=grid(256), stream=stream0)
del primals_2
return (buf0, primals_1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class L2Norm(nn.Module):
def __init__(self, n_dims, scale=20.0, eps=1e-10):
super(L2Norm, self).__init__()
self.n_dims = n_dims
self.weight = nn.Parameter(torch.Tensor(self.n_dims))
self.eps = eps
self.scale = scale
def forward(self, x):
x_float = x.float()
norm = x_float.pow(2).sum(1, keepdim=True).sqrt() + self.eps
return (self.weight[None, :, None, None].float().expand_as(x_float) *
x_float / norm).type_as(x)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'n_dims': 4}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_add_div_mul_pow_sqrt_sum_0(in_ptr0, in_ptr1, out_ptr0,
xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 16 % 4
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x3, xmask)
tmp3 = tl.load(in_ptr1 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp5 = tl.load(in_ptr1 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp8 = tl.load(in_ptr1 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp11 = tl.load(in_ptr1 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tmp0 * tmp1
tmp4 = tmp3 * tmp3
tmp6 = tmp5 * tmp5
tmp7 = tmp4 + tmp6
tmp9 = tmp8 * tmp8
tmp10 = tmp7 + tmp9
tmp12 = tmp11 * tmp11
tmp13 = tmp10 + tmp12
tmp14 = libdevice.sqrt(tmp13)
tmp15 = 1e-10
tmp16 = tmp14 + tmp15
tmp17 = tmp2 / tmp16
tl.store(out_ptr0 + x3, tmp17, xmask)
def call(args):
primals_1, primals_2 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_add_div_mul_pow_sqrt_sum_0[grid(256)](primals_2,
primals_1, buf0, 256, XBLOCK=256, num_warps=4, num_stages=1)
del primals_2
return buf0, primals_1
class L2NormNew(nn.Module):
def __init__(self, n_dims, scale=20.0, eps=1e-10):
super(L2NormNew, self).__init__()
self.n_dims = n_dims
self.weight = nn.Parameter(torch.Tensor(self.n_dims))
self.eps = eps
self.scale = scale
def forward(self, input_0):
primals_2 = self.weight
primals_1 = input_0
output = call([primals_1, primals_2])
return output[0]
|
CK-er/mmdet
|
L2Norm
| false | 2,056 |
[
"Apache-2.0"
] | 0 |
9bea4068efbcf7bf739dbe41917a68d525c29868
|
https://github.com/CK-er/mmdet/tree/9bea4068efbcf7bf739dbe41917a68d525c29868
|
MPJPELoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/zu/czujx3x7ghsdpfovcj7w56ztapmlm4ti2434djcb5yn2khft5ydg.py
# Topologically Sorted Source Nodes: [sub, norm, loss, mul], Original ATen: [aten.sub, aten.linalg_vector_norm, aten.mean, aten.mul]
# Source node to ATen node mapping:
# loss => mean
# mul => mul
# norm => pow_1, pow_2, sum_1
# sub => sub
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub, 2), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%pow_1, [-1]), kwargs = {})
# %pow_2 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sum_1, 0.5), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%pow_2,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_linalg_vector_norm_mean_mul_sub_0 = async_compile.triton('triton_per_fused_linalg_vector_norm_mean_mul_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_linalg_vector_norm_mean_mul_sub_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_linalg_vector_norm_mean_mul_sub_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 1
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (4*r0), None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (4*r0), None, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (1 + (4*r0)), None, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr1 + (1 + (4*r0)), None, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (2 + (4*r0)), None, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr1 + (2 + (4*r0)), None, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr0 + (3 + (4*r0)), None, eviction_policy='evict_last')
tmp15 = tl.load(in_ptr1 + (3 + (4*r0)), None, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp3 = tmp2 * tmp2
tmp6 = tmp4 - tmp5
tmp7 = tmp6 * tmp6
tmp8 = tmp3 + tmp7
tmp11 = tmp9 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tmp8 + tmp12
tmp16 = tmp14 - tmp15
tmp17 = tmp16 * tmp16
tmp18 = tmp13 + tmp17
tmp19 = libdevice.sqrt(tmp18)
tmp20 = tl.broadcast_to(tmp19, [XBLOCK, RBLOCK])
tmp22 = tl.sum(tmp20, 1)[:, None]
tmp23 = 64.0
tmp24 = tmp22 / tmp23
tmp25 = 1.0
tmp26 = tmp24 * tmp25
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([XBLOCK, 1], 0, tl.int32)), tmp26, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [sub, norm, loss, mul], Original ATen: [aten.sub, aten.linalg_vector_norm, aten.mean, aten.mul]
stream0 = get_raw_stream(0)
triton_per_fused_linalg_vector_norm_mean_mul_sub_0.run(buf1, arg0_1, arg1_1, 1, 64, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class MPJPELoss(nn.Module):
"""MPJPE (Mean Per Joint Position Error) loss.
Args:
use_target_weight (bool): Option to use weighted MSE loss.
Different joint types may have different target weights.
loss_weight (float): Weight of the loss. Default: 1.0.
"""
def __init__(self, use_target_weight=False, loss_weight=1.0):
super().__init__()
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
def forward(self, output, target, target_weight=None):
"""Forward function.
Note:
- batch_size: N
- num_keypoints: K
- dimension of keypoints: D (D=2 or D=3)
Args:
output (torch.Tensor[N, K, D]): Output regression.
target (torch.Tensor[N, K, D]): Target regression.
target_weight (torch.Tensor[N,K,D]):
Weights across different joint types.
"""
if self.use_target_weight:
assert target_weight is not None
loss = torch.mean(torch.norm((output - target) * target_weight,
dim=-1))
else:
loss = torch.mean(torch.norm(output - target, dim=-1))
return loss * self.loss_weight
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_linalg_vector_norm_mean_mul_sub_0(in_out_ptr0, in_ptr0,
in_ptr1, xnumel, rnumel, XBLOCK: tl.constexpr):
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xoffset + tl.arange(0, XBLOCK)[:, None]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + 4 * r0, None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + 4 * r0, None, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (1 + 4 * r0), None, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr1 + (1 + 4 * r0), None, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (2 + 4 * r0), None, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr1 + (2 + 4 * r0), None, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr0 + (3 + 4 * r0), None, eviction_policy='evict_last')
tmp15 = tl.load(in_ptr1 + (3 + 4 * r0), None, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp3 = tmp2 * tmp2
tmp6 = tmp4 - tmp5
tmp7 = tmp6 * tmp6
tmp8 = tmp3 + tmp7
tmp11 = tmp9 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tmp8 + tmp12
tmp16 = tmp14 - tmp15
tmp17 = tmp16 * tmp16
tmp18 = tmp13 + tmp17
tmp19 = libdevice.sqrt(tmp18)
tmp20 = tl.broadcast_to(tmp19, [XBLOCK, RBLOCK])
tmp22 = tl.sum(tmp20, 1)[:, None]
tmp23 = 64.0
tmp24 = tmp22 / tmp23
tmp25 = 1.0
tmp26 = tmp24 * tmp25
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([XBLOCK, 1], 0, tl.int32), tmp26, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_linalg_vector_norm_mean_mul_sub_0[grid(1)](buf1,
arg0_1, arg1_1, 1, 64, XBLOCK=1, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
class MPJPELossNew(nn.Module):
"""MPJPE (Mean Per Joint Position Error) loss.
Args:
use_target_weight (bool): Option to use weighted MSE loss.
Different joint types may have different target weights.
loss_weight (float): Weight of the loss. Default: 1.0.
"""
def __init__(self, use_target_weight=False, loss_weight=1.0):
super().__init__()
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ALISCIFP/mmpose
|
MPJPELoss
| false | 2,057 |
[
"Apache-2.0"
] | 0 |
2433e3dbcc44baa2253e2a7c748ba0216937933e
|
https://github.com/ALISCIFP/mmpose/tree/2433e3dbcc44baa2253e2a7c748ba0216937933e
|
TransformerNet
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/xi/cxi3ssslzv45liamqvbt6decmfms5gkzbjn7dtainfaa436qkyw3.py
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.reflection_pad2d]
# Source node to ATen node mapping:
# out => _unsafe_index, _unsafe_index_1
# Graph fragment:
# %_unsafe_index : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%primals_1, [None, None, %sub_1, None]), kwargs = {})
# %_unsafe_index_1 : [num_users=2] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index, [None, None, None, %sub_1]), kwargs = {})
triton_poi_fused_reflection_pad2d_0 = async_compile.triton('triton_poi_fused_reflection_pad2d_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[65536],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_reflection_pad2d_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_reflection_pad2d_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 62208
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 72
x1 = (xindex // 72) % 72
x2 = (xindex // 5184)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (4095 + ((-1)*(tl_math.abs((-63) + (tl_math.abs((-4) + x0))))) + ((-64)*(tl_math.abs((-63) + (tl_math.abs((-4) + x1))))) + (4096*x2)), xmask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x3), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/zp/czpuakvx3zciuzfmemejrltenkqbzqirfyy2fnfbmrorwkdndz6e.py
# Topologically Sorted Source Nodes: [out_1, instance_norm], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
# Source node to ATen node mapping:
# instance_norm => add, rsqrt, var_mean
# out_1 => convolution
# Graph fragment:
# %convolution : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%_unsafe_index_1, %primals_2, %primals_3, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %var_mean : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem, 1e-05), kwargs = {})
# %rsqrt : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add,), kwargs = {})
triton_red_fused__native_batch_norm_legit_convolution_1 = async_compile.triton('triton_red_fused__native_batch_norm_legit_convolution_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.reduction(
size_hints=[128, 4096],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_red_fused__native_batch_norm_legit_convolution_1', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 2, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_red_fused__native_batch_norm_legit_convolution_1(in_out_ptr0, in_out_ptr1, in_ptr0, out_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr, RBLOCK : tl.constexpr):
xnumel = 128
rnumel = 4096
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rbase = tl.arange(0, RBLOCK)[None, :]
x3 = xindex
x0 = xindex % 32
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp4_mean = tl.zeros([XBLOCK, RBLOCK], tl.float32)
tmp4_m2 = tl.zeros([XBLOCK, RBLOCK], tl.float32)
tmp4_weight = tl.zeros([XBLOCK, RBLOCK], tl.float32)
for roffset in range(0, rnumel, RBLOCK):
rindex = roffset + rbase
rmask = rindex < rnumel
r2 = rindex
tmp0 = tl.load(in_out_ptr0 + (r2 + (4096*x3)), rmask & xmask, eviction_policy='evict_first', other=0.0)
tmp2 = tmp0 + tmp1
tmp3 = tl.broadcast_to(tmp2, [XBLOCK, RBLOCK])
tmp4_mean_next, tmp4_m2_next, tmp4_weight_next = triton_helpers.welford_reduce(
tmp3, tmp4_mean, tmp4_m2, tmp4_weight, roffset == 0
)
tmp4_mean = tl.where(rmask & xmask, tmp4_mean_next, tmp4_mean)
tmp4_m2 = tl.where(rmask & xmask, tmp4_m2_next, tmp4_m2)
tmp4_weight = tl.where(rmask & xmask, tmp4_weight_next, tmp4_weight)
tl.store(in_out_ptr0 + (r2 + (4096*x3)), tmp2, rmask & xmask)
tmp4_tmp, tmp5_tmp, tmp6_tmp = triton_helpers.welford(
tmp4_mean, tmp4_m2, tmp4_weight, 1
)
tmp4 = tmp4_tmp[:, None]
tmp5 = tmp5_tmp[:, None]
tmp6 = tmp6_tmp[:, None]
tl.store(out_ptr0 + (x3), tmp4, xmask)
tmp7 = 4096.0
tmp8 = tmp5 / tmp7
tmp9 = 1e-05
tmp10 = tmp8 + tmp9
tmp11 = libdevice.rsqrt(tmp10)
tl.debug_barrier()
tl.store(in_out_ptr1 + (x3), tmp11, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/in/ciny2bql3sygecchlvr6rxw73jnhl7dgi3s5w2g2fefaoug53zzz.py
# Topologically Sorted Source Nodes: [instance_norm], Original ATen: [aten.repeat]
# Source node to ATen node mapping:
# instance_norm => repeat
# Graph fragment:
# %repeat : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_4, [4]), kwargs = {})
triton_poi_fused_repeat_2 = async_compile.triton('triton_poi_fused_repeat_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[128],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_repeat_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_repeat_2(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0 % 32), xmask)
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/ii/ciidusl6utkne6h3zmwx3jccsnttcsdc42mtp3vanldcnxv4y7ov.py
# Topologically Sorted Source Nodes: [y, out_2], Original ATen: [aten.relu, aten.reflection_pad2d]
# Source node to ATen node mapping:
# out_2 => _unsafe_index_2, _unsafe_index_3
# y => relu
# Graph fragment:
# %relu : [num_users=1] = call_function[target=torch.ops.aten.relu.default](args = (%view_1,), kwargs = {})
# %_unsafe_index_2 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%relu, [None, None, %sub_6, None]), kwargs = {})
# %_unsafe_index_3 : [num_users=2] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_2, [None, None, None, %sub_6]), kwargs = {})
triton_poi_fused_reflection_pad2d_relu_3 = async_compile.triton('triton_poi_fused_reflection_pad2d_relu_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1048576],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_reflection_pad2d_relu_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_reflection_pad2d_relu_3(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 557568
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 66
x1 = (xindex // 66) % 66
x2 = (xindex // 4356)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (4095 + ((-1)*(tl_math.abs((-63) + (tl_math.abs((-1) + x0))))) + ((-64)*(tl_math.abs((-63) + (tl_math.abs((-1) + x1))))) + (4096*x2)), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (x2), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + (x2), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + (x2), xmask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + (x3), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/si/csiohvngy3nd4p3av6rdkonvlcuns665sjcyq5ggukrhfwpso4ay.py
# Topologically Sorted Source Nodes: [out_3, instance_norm_1], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
# Source node to ATen node mapping:
# instance_norm_1 => add_2, rsqrt_1, var_mean_1
# out_3 => convolution_1
# Graph fragment:
# %convolution_1 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%_unsafe_index_3, %primals_6, %primals_7, [2, 2], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %var_mean_1 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_2, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_2, 1e-05), kwargs = {})
# %rsqrt_1 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_2,), kwargs = {})
triton_per_fused__native_batch_norm_legit_convolution_4 = async_compile.triton('triton_per_fused__native_batch_norm_legit_convolution_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[256, 1024],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__native_batch_norm_legit_convolution_4', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__native_batch_norm_legit_convolution_4(in_out_ptr0, in_out_ptr1, in_ptr0, out_ptr0, xnumel, rnumel):
xnumel = 256
XBLOCK: tl.constexpr = 1
rnumel = 1024
RBLOCK: tl.constexpr = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r2 = rindex
x3 = xindex
x0 = xindex % 64
tmp0 = tl.load(in_out_ptr0 + (r2 + (1024*x3)), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.broadcast_to(tmp2, [RBLOCK])
tmp5 = tl.broadcast_to(tmp3, [RBLOCK])
tmp7 = triton_helpers.promote_to_tensor(tl.sum(tmp5, 0))
tmp8 = tl.full([1], 1024, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp3 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [RBLOCK])
tmp15 = triton_helpers.promote_to_tensor(tl.sum(tmp13, 0))
tmp16 = 1024.0
tmp17 = tmp15 / tmp16
tmp18 = 1e-05
tmp19 = tmp17 + tmp18
tmp20 = libdevice.rsqrt(tmp19)
tl.store(in_out_ptr0 + (r2 + (1024*x3)), tmp2, None)
tl.debug_barrier()
tl.store(in_out_ptr1 + (x3), tmp20, None)
tl.store(out_ptr0 + (x3), tmp10, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/bo/cbop6byfkkzzjktajzua3ovnpvhy32nxb7dbv364jfeaxunlv7bo.py
# Topologically Sorted Source Nodes: [instance_norm_1], Original ATen: [aten.repeat]
# Source node to ATen node mapping:
# instance_norm_1 => repeat_2
# Graph fragment:
# %repeat_2 : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_8, [4]), kwargs = {})
triton_poi_fused_repeat_5 = async_compile.triton('triton_poi_fused_repeat_5', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_repeat_5', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_repeat_5(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0 % 64), xmask)
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/k6/ck6ljtglelyaqir7indwg3cp4wwudzqtlaof4xfdlyasdzhka7z5.py
# Topologically Sorted Source Nodes: [y_1, out_4], Original ATen: [aten.relu, aten.reflection_pad2d]
# Source node to ATen node mapping:
# out_4 => _unsafe_index_4, _unsafe_index_5
# y_1 => relu_1
# Graph fragment:
# %relu_1 : [num_users=1] = call_function[target=torch.ops.aten.relu.default](args = (%view_3,), kwargs = {})
# %_unsafe_index_4 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%relu_1, [None, None, %sub_11, None]), kwargs = {})
# %_unsafe_index_5 : [num_users=2] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_4, [None, None, None, %sub_11]), kwargs = {})
triton_poi_fused_reflection_pad2d_relu_6 = async_compile.triton('triton_poi_fused_reflection_pad2d_relu_6', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[524288],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_reflection_pad2d_relu_6', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_reflection_pad2d_relu_6(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 295936
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 34
x1 = (xindex // 34) % 34
x2 = (xindex // 1156)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (1023 + ((-1)*(tl_math.abs((-31) + (tl_math.abs((-1) + x0))))) + ((-32)*(tl_math.abs((-31) + (tl_math.abs((-1) + x1))))) + (1024*x2)), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (x2), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + (x2), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + (x2), xmask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + (x3), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/b3/cb3i36nfih3ah5aifo46hyitngbbqmrioka4h7sa3nz2vzd5toin.py
# Topologically Sorted Source Nodes: [out_5, instance_norm_2, y_2], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.relu]
# Source node to ATen node mapping:
# instance_norm_2 => add_4, repeat_4, repeat_5, rsqrt_2, var_mean_2
# out_5 => convolution_2
# y_2 => relu_2
# Graph fragment:
# %convolution_2 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%_unsafe_index_5, %primals_10, %primals_11, [2, 2], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %repeat_4 : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_12, [4]), kwargs = {})
# %repeat_5 : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_13, [4]), kwargs = {})
# %var_mean_2 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_4, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_4 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_4, 1e-05), kwargs = {})
# %rsqrt_2 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_4,), kwargs = {})
# %relu_2 : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_5,), kwargs = {})
triton_per_fused__native_batch_norm_legit_convolution_relu_repeat_7 = async_compile.triton('triton_per_fused__native_batch_norm_legit_convolution_relu_repeat_7', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[512, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: '*fp32', 9: 'i32', 10: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__native_batch_norm_legit_convolution_relu_repeat_7', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1'], 'no_x_dim': True, 'num_load': 4, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__native_batch_norm_legit_convolution_relu_repeat_7(in_out_ptr0, in_out_ptr1, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr2, out_ptr3, xnumel, rnumel):
xnumel = 512
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 128
tmp0 = tl.load(in_ptr0 + (x0 % 128), None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x0 % 128), None, eviction_policy='evict_last')
tmp2 = tl.load(in_out_ptr0 + (r3 + (256*x0)), None)
tmp3 = tl.load(in_ptr2 + (x1), None, eviction_policy='evict_last')
tmp4 = tmp2 + tmp3
tmp5 = tl.broadcast_to(tmp4, [RBLOCK])
tmp7 = tl.broadcast_to(tmp5, [RBLOCK])
tmp9 = triton_helpers.promote_to_tensor(tl.sum(tmp7, 0))
tmp10 = tl.full([1], 256, tl.int32)
tmp11 = tmp10.to(tl.float32)
tmp12 = tmp9 / tmp11
tmp13 = tmp5 - tmp12
tmp14 = tmp13 * tmp13
tmp15 = tl.broadcast_to(tmp14, [RBLOCK])
tmp17 = triton_helpers.promote_to_tensor(tl.sum(tmp15, 0))
tmp18 = 256.0
tmp19 = tmp17 / tmp18
tmp20 = 1e-05
tmp21 = tmp19 + tmp20
tmp22 = libdevice.rsqrt(tmp21)
tmp23 = tmp4 - tmp12
tmp24 = tmp23 * tmp22
tmp25 = tmp24 * tmp0
tmp26 = tmp25 + tmp1
tmp27 = tl.full([1], 0, tl.int32)
tmp28 = triton_helpers.maximum(tmp27, tmp26)
tl.store(out_ptr0 + (x0), tmp0, None)
tl.store(out_ptr1 + (x0), tmp1, None)
tl.store(in_out_ptr0 + (r3 + (256*x0)), tmp4, None)
tl.debug_barrier()
tl.store(in_out_ptr1 + (x0), tmp22, None)
tl.store(out_ptr3 + (r3 + (256*x0)), tmp28, None)
tl.store(out_ptr2 + (x0), tmp12, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/st/cstfzn4z33vdn3t4r76kkdoe3fox63ob7zbuq5lr4e2aj2wo3cfw.py
# Topologically Sorted Source Nodes: [out_6], Original ATen: [aten.reflection_pad2d]
# Source node to ATen node mapping:
# out_6 => _unsafe_index_6, _unsafe_index_7
# Graph fragment:
# %_unsafe_index_6 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%relu_2, [None, None, %sub_16, None]), kwargs = {})
# %_unsafe_index_7 : [num_users=2] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_6, [None, None, None, %sub_16]), kwargs = {})
triton_poi_fused_reflection_pad2d_8 = async_compile.triton('triton_poi_fused_reflection_pad2d_8', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[262144],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_reflection_pad2d_8', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_reflection_pad2d_8(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 165888
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x0 = xindex % 18
x1 = (xindex // 18) % 18
x2 = (xindex // 324)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (255 + ((-1)*(tl_math.abs((-15) + (tl_math.abs((-1) + x0))))) + ((-16)*(tl_math.abs((-15) + (tl_math.abs((-1) + x1))))) + (256*x2)), None, eviction_policy='evict_last')
tl.store(out_ptr0 + (x3), tmp0, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/e2/ce2xxpjelyctnuhefg5fuzcvwpa544akythto7ai5tgzpkjchqwu.py
# Topologically Sorted Source Nodes: [out_7, instance_norm_3], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
# Source node to ATen node mapping:
# instance_norm_3 => add_6, rsqrt_3, var_mean_3
# out_7 => convolution_3
# Graph fragment:
# %convolution_3 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%_unsafe_index_7, %primals_14, %primals_15, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %var_mean_3 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_6, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_6 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_6, 1e-05), kwargs = {})
# %rsqrt_3 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_6,), kwargs = {})
triton_per_fused__native_batch_norm_legit_convolution_9 = async_compile.triton('triton_per_fused__native_batch_norm_legit_convolution_9', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[512, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__native_batch_norm_legit_convolution_9', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__native_batch_norm_legit_convolution_9(in_out_ptr0, in_out_ptr1, in_ptr0, out_ptr0, xnumel, rnumel):
xnumel = 512
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r2 = rindex
x3 = xindex
x0 = xindex % 128
tmp0 = tl.load(in_out_ptr0 + (r2 + (256*x3)), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.broadcast_to(tmp2, [RBLOCK])
tmp5 = tl.broadcast_to(tmp3, [RBLOCK])
tmp7 = triton_helpers.promote_to_tensor(tl.sum(tmp5, 0))
tmp8 = tl.full([1], 256, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp3 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [RBLOCK])
tmp15 = triton_helpers.promote_to_tensor(tl.sum(tmp13, 0))
tmp16 = 256.0
tmp17 = tmp15 / tmp16
tmp18 = 1e-05
tmp19 = tmp17 + tmp18
tmp20 = libdevice.rsqrt(tmp19)
tl.store(in_out_ptr0 + (r2 + (256*x3)), tmp2, None)
tl.debug_barrier()
tl.store(in_out_ptr1 + (x3), tmp20, None)
tl.store(out_ptr0 + (x3), tmp10, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/df/cdfz5yaux6hd3x6u7ywjjuon3rgwzpj6jchxqf6fmzsftmjj7luu.py
# Topologically Sorted Source Nodes: [instance_norm_3], Original ATen: [aten.repeat]
# Source node to ATen node mapping:
# instance_norm_3 => repeat_6
# Graph fragment:
# %repeat_6 : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_16, [4]), kwargs = {})
triton_poi_fused_repeat_10 = async_compile.triton('triton_poi_fused_repeat_10', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[512],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_repeat_10', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_repeat_10(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 512
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0 % 128), xmask)
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/72/c72anaicoavbg3ypt27amkloa7kkqjupcqqr7kifcj4pxrdujccb.py
# Topologically Sorted Source Nodes: [out_8, out_9], Original ATen: [aten.relu, aten.reflection_pad2d]
# Source node to ATen node mapping:
# out_8 => relu_3
# out_9 => _unsafe_index_8, _unsafe_index_9
# Graph fragment:
# %relu_3 : [num_users=1] = call_function[target=torch.ops.aten.relu.default](args = (%view_7,), kwargs = {})
# %_unsafe_index_8 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%relu_3, [None, None, %sub_16, None]), kwargs = {})
# %_unsafe_index_9 : [num_users=2] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_8, [None, None, None, %sub_16]), kwargs = {})
triton_poi_fused_reflection_pad2d_relu_11 = async_compile.triton('triton_poi_fused_reflection_pad2d_relu_11', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[262144],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_reflection_pad2d_relu_11', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_reflection_pad2d_relu_11(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 165888
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x0 = xindex % 18
x1 = (xindex // 18) % 18
x2 = (xindex // 324)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (255 + ((-1)*(tl_math.abs((-15) + (tl_math.abs((-1) + x0))))) + ((-16)*(tl_math.abs((-15) + (tl_math.abs((-1) + x1))))) + (256*x2)), None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), None, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (x2), None, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + (x2), None, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + (x2), None, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + (x3), tmp10, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/ht/chtgxfnwsuka4dupubnxavhxnvwl72mb4ekz5zpamrm6tamf5fvv.py
# Topologically Sorted Source Nodes: [out_10, out_11, out_12], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.add]
# Source node to ATen node mapping:
# out_10 => convolution_4
# out_11 => add_8, repeat_8, rsqrt_4, var_mean_4
# out_12 => add_10
# Graph fragment:
# %convolution_4 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%_unsafe_index_9, %primals_18, %primals_19, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %repeat_8 : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_20, [4]), kwargs = {})
# %var_mean_4 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_8, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_8 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_8, 1e-05), kwargs = {})
# %rsqrt_4 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_8,), kwargs = {})
# %add_10 : [num_users=2] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_9, %relu_2), kwargs = {})
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12 = async_compile.triton('triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[512, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: 'i32', 9: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8, 9), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1'], 'no_x_dim': True, 'num_load': 5, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12(in_out_ptr0, in_out_ptr1, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr3, xnumel, rnumel):
xnumel = 512
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 128
tmp0 = tl.load(in_ptr0 + (x0 % 128), None, eviction_policy='evict_last')
tmp1 = tl.load(in_out_ptr0 + (r3 + (256*x0)), None)
tmp2 = tl.load(in_ptr1 + (x1), None, eviction_policy='evict_last')
tmp25 = tl.load(in_ptr2 + (x1), None, eviction_policy='evict_last')
tmp27 = tl.load(in_out_ptr1 + (r3 + (256*x0)), None)
tmp3 = tmp1 + tmp2
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = tl.broadcast_to(tmp4, [RBLOCK])
tmp8 = triton_helpers.promote_to_tensor(tl.sum(tmp6, 0))
tmp9 = tl.full([1], 256, tl.int32)
tmp10 = tmp9.to(tl.float32)
tmp11 = tmp8 / tmp10
tmp12 = tmp4 - tmp11
tmp13 = tmp12 * tmp12
tmp14 = tl.broadcast_to(tmp13, [RBLOCK])
tmp16 = triton_helpers.promote_to_tensor(tl.sum(tmp14, 0))
tmp17 = tmp3 - tmp11
tmp18 = 256.0
tmp19 = tmp16 / tmp18
tmp20 = 1e-05
tmp21 = tmp19 + tmp20
tmp22 = libdevice.rsqrt(tmp21)
tmp23 = tmp17 * tmp22
tmp24 = tmp23 * tmp0
tmp26 = tmp24 + tmp25
tmp28 = tmp26 + tmp27
tl.store(out_ptr0 + (x0), tmp0, None)
tl.store(in_out_ptr0 + (r3 + (256*x0)), tmp3, None)
tl.store(in_out_ptr1 + (r3 + (256*x0)), tmp28, None)
tl.store(out_ptr3 + (x0), tmp22, None)
tl.store(out_ptr1 + (x0), tmp11, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/b3/cb3qjb4uid2oua44nvmn56hgg22nygnazgnt5dgu6oqhrcyphjio.py
# Topologically Sorted Source Nodes: [out_38, out_39], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
# Source node to ATen node mapping:
# out_38 => convolution_12
# out_39 => add_28, rsqrt_12, var_mean_12
# Graph fragment:
# %convolution_12 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%_unsafe_index_25, %primals_50, %primals_51, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %var_mean_12 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_24, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_28 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_24, 1e-05), kwargs = {})
# %rsqrt_12 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_28,), kwargs = {})
triton_per_fused__native_batch_norm_legit_convolution_13 = async_compile.triton('triton_per_fused__native_batch_norm_legit_convolution_13', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[512, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32', 6: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__native_batch_norm_legit_convolution_13', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__native_batch_norm_legit_convolution_13(in_out_ptr0, in_ptr0, out_ptr0, out_ptr1, out_ptr2, xnumel, rnumel):
xnumel = 512
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r2 = rindex
x3 = xindex
x0 = xindex % 128
tmp0 = tl.load(in_out_ptr0 + (r2 + (256*x3)), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.broadcast_to(tmp2, [RBLOCK])
tmp5 = tl.broadcast_to(tmp3, [RBLOCK])
tmp7 = triton_helpers.promote_to_tensor(tl.sum(tmp5, 0))
tmp8 = tl.full([1], 256, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp3 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [RBLOCK])
tmp15 = triton_helpers.promote_to_tensor(tl.sum(tmp13, 0))
tmp16 = 256.0
tmp17 = tmp15 / tmp16
tmp18 = 1e-05
tmp19 = tmp17 + tmp18
tmp20 = libdevice.rsqrt(tmp19)
tl.store(in_out_ptr0 + (r2 + (256*x3)), tmp2, None)
tl.store(out_ptr2 + (x3), tmp20, None)
tl.store(out_ptr0 + (x3), tmp10, None)
tl.store(out_ptr1 + (x3), tmp15, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/qq/cqqyalirw6ktpkb7ck6op5kn5slga5gde6ffhveztg3zuk5kgxda.py
# Topologically Sorted Source Nodes: [x_in], Original ATen: [aten.arange]
# Source node to ATen node mapping:
# x_in => iota_26
# Graph fragment:
# %iota_26 : [num_users=2] = call_function[target=torch.ops.prims.iota.default](args = (32,), kwargs = {start: 0, step: 1, dtype: torch.int64, device: cuda:0, requires_grad: False})
triton_poi_fused_arange_14 = async_compile.triton('triton_poi_fused_arange_14', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[32],
filename=__file__,
triton_meta={'signature': {0: '*i64', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_arange_14', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 0, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_arange_14(out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 32
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = x0
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/r3/cr3jbyf5ylpcnip7fl3i4e3dqhcl5pfkrdyzumgnsa2b4past5le.py
# Topologically Sorted Source Nodes: [x_in], Original ATen: [aten.arange, aten.add, aten.mul, aten._to_copy]
# Source node to ATen node mapping:
# x_in => add_31, add_32, convert_element_type, convert_element_type_1, mul_26, mul_27
# Graph fragment:
# %mul_26 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%iota_26, 1), kwargs = {})
# %add_31 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_26, 0), kwargs = {})
# %convert_element_type : [num_users=1] = call_function[target=torch.ops.prims.convert_element_type.default](args = (%add_31, torch.float32), kwargs = {})
# %add_32 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%convert_element_type, 0.0), kwargs = {})
# %mul_27 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%add_32, 0.5), kwargs = {})
# %convert_element_type_1 : [num_users=3] = call_function[target=torch.ops.prims.convert_element_type.default](args = (%mul_27, torch.int64), kwargs = {})
triton_poi_fused__to_copy_add_arange_mul_15 = async_compile.triton('triton_poi_fused__to_copy_add_arange_mul_15', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[32],
filename=__file__,
triton_meta={'signature': {0: '*i64', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__to_copy_add_arange_mul_15', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 0, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__to_copy_add_arange_mul_15(out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 32
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = x0
tmp1 = tmp0.to(tl.float32)
tmp2 = 0.5
tmp3 = tmp1 * tmp2
tmp4 = tmp3.to(tl.int32)
tl.store(out_ptr0 + (x0), tmp4, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/4u/c4ulzdc64ey5bpk3wpc3vnmalkhaekirwmcugkiy5azetn32lzqc.py
# Topologically Sorted Source Nodes: [out_40, x_in, out_41], Original ATen: [aten.add, aten._unsafe_index, aten.reflection_pad2d]
# Source node to ATen node mapping:
# out_40 => add_30
# out_41 => _unsafe_index_27, _unsafe_index_28
# x_in => _unsafe_index_26
# Graph fragment:
# %add_30 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_25, %add_25), kwargs = {})
# %_unsafe_index_26 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%add_30, [None, None, %unsqueeze_52, %convert_element_type_1]), kwargs = {})
# %_unsafe_index_27 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_26, [None, None, %sub_11, None]), kwargs = {})
# %_unsafe_index_28 : [num_users=2] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_27, [None, None, None, %sub_11]), kwargs = {})
triton_poi_fused__unsafe_index_add_reflection_pad2d_16 = async_compile.triton('triton_poi_fused__unsafe_index_add_reflection_pad2d_16', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1048576],
filename=__file__,
triton_meta={'signature': {0: '*i64', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__unsafe_index_add_reflection_pad2d_16', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 6, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__unsafe_index_add_reflection_pad2d_16(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, in_ptr5, in_ptr6, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 591872
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x1 = (xindex // 34) % 34
x0 = xindex % 34
x4 = (xindex // 1156)
x2 = (xindex // 1156) % 128
x7 = xindex
tmp0 = tl.load(in_ptr0 + (31 + ((-1)*(tl_math.abs((-31) + (tl_math.abs((-1) + x1)))))), None, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (31 + ((-1)*(tl_math.abs((-31) + (tl_math.abs((-1) + x0)))))), None, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr2 + (x4), None, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr3 + (x4), None, eviction_policy='evict_last')
tmp19 = tl.load(in_ptr4 + (x4), None, eviction_policy='evict_last')
tmp21 = tl.load(in_ptr5 + (x2), None, eviction_policy='evict_last')
tmp1 = tl.full([XBLOCK], 16, tl.int32)
tmp2 = tmp0 + tmp1
tmp3 = tmp0 < 0
tmp4 = tl.where(tmp3, tmp2, tmp0)
tmp6 = tmp5 + tmp1
tmp7 = tmp5 < 0
tmp8 = tl.where(tmp7, tmp6, tmp5)
tmp9 = tl.load(in_ptr1 + (tmp8 + (16*tmp4) + (256*x4)), None, eviction_policy='evict_last')
tmp11 = tmp9 - tmp10
tmp13 = 256.0
tmp14 = tmp12 / tmp13
tmp15 = 1e-05
tmp16 = tmp14 + tmp15
tmp17 = libdevice.rsqrt(tmp16)
tmp18 = tmp11 * tmp17
tmp20 = tmp18 * tmp19
tmp22 = tmp20 + tmp21
tmp23 = tl.load(in_ptr6 + (tmp8 + (16*tmp4) + (256*x4)), None, eviction_policy='evict_last')
tmp24 = tmp22 + tmp23
tl.store(out_ptr0 + (x7), tmp24, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/dq/cdq7haid5a5j3lkr5pvfwpau3a4evwh5wu6wzw4wsmw3e4ska5zp.py
# Topologically Sorted Source Nodes: [x_in_1], Original ATen: [aten.arange]
# Source node to ATen node mapping:
# x_in_1 => iota_30
# Graph fragment:
# %iota_30 : [num_users=2] = call_function[target=torch.ops.prims.iota.default](args = (64,), kwargs = {start: 0, step: 1, dtype: torch.int64, device: cuda:0, requires_grad: False})
triton_poi_fused_arange_17 = async_compile.triton('triton_poi_fused_arange_17', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*i64', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_arange_17', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 0, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_arange_17(out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = x0
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/lc/clcrsu5s34immb6guobkppggbuvqp4z4ceacadyjt2r2vb5cnfrr.py
# Topologically Sorted Source Nodes: [x_in_1], Original ATen: [aten.arange, aten.add, aten.mul, aten._to_copy]
# Source node to ATen node mapping:
# x_in_1 => add_37, add_38, convert_element_type_4, convert_element_type_5, mul_32, mul_33
# Graph fragment:
# %mul_32 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%iota_30, 1), kwargs = {})
# %add_37 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_32, 0), kwargs = {})
# %convert_element_type_4 : [num_users=1] = call_function[target=torch.ops.prims.convert_element_type.default](args = (%add_37, torch.float32), kwargs = {})
# %add_38 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%convert_element_type_4, 0.0), kwargs = {})
# %mul_33 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%add_38, 0.5), kwargs = {})
# %convert_element_type_5 : [num_users=3] = call_function[target=torch.ops.prims.convert_element_type.default](args = (%mul_33, torch.int64), kwargs = {})
triton_poi_fused__to_copy_add_arange_mul_18 = async_compile.triton('triton_poi_fused__to_copy_add_arange_mul_18', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*i64', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__to_copy_add_arange_mul_18', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 0, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__to_copy_add_arange_mul_18(out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = x0
tmp1 = tmp0.to(tl.float32)
tmp2 = 0.5
tmp3 = tmp1 * tmp2
tmp4 = tmp3.to(tl.int32)
tl.store(out_ptr0 + (x0), tmp4, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/wm/cwmojiabjtl2ol57sxtgs6t2ik45zfe3nj5ahimvzp7to4pegq4y.py
# Topologically Sorted Source Nodes: [y_3, x_in_1, out_43], Original ATen: [aten.relu, aten._unsafe_index, aten.reflection_pad2d]
# Source node to ATen node mapping:
# out_43 => _unsafe_index_30, _unsafe_index_31
# x_in_1 => _unsafe_index_29
# y_3 => relu_8
# Graph fragment:
# %relu_8 : [num_users=1] = call_function[target=torch.ops.aten.relu.default](args = (%view_27,), kwargs = {})
# %_unsafe_index_29 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%relu_8, [None, None, %unsqueeze_57, %convert_element_type_5]), kwargs = {})
# %_unsafe_index_30 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_29, [None, None, %sub_6, None]), kwargs = {})
# %_unsafe_index_31 : [num_users=2] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_30, [None, None, None, %sub_6]), kwargs = {})
triton_poi_fused__unsafe_index_reflection_pad2d_relu_19 = async_compile.triton('triton_poi_fused__unsafe_index_reflection_pad2d_relu_19', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2097152],
filename=__file__,
triton_meta={'signature': {0: '*i64', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__unsafe_index_reflection_pad2d_relu_19', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 6, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__unsafe_index_reflection_pad2d_relu_19(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, in_ptr5, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1115136
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 66) % 66
x0 = xindex % 66
x2 = (xindex // 4356)
x5 = xindex
tmp0 = tl.load(in_ptr0 + (63 + ((-1)*(tl_math.abs((-63) + (tl_math.abs((-1) + x1)))))), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (63 + ((-1)*(tl_math.abs((-63) + (tl_math.abs((-1) + x0)))))), xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr2 + (x2), xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr3 + (x2), xmask, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr4 + (x2), xmask, eviction_policy='evict_last')
tmp16 = tl.load(in_ptr5 + (x2), xmask, eviction_policy='evict_last')
tmp1 = tl.full([XBLOCK], 32, tl.int32)
tmp2 = tmp0 + tmp1
tmp3 = tmp0 < 0
tmp4 = tl.where(tmp3, tmp2, tmp0)
tmp6 = tmp5 + tmp1
tmp7 = tmp5 < 0
tmp8 = tl.where(tmp7, tmp6, tmp5)
tmp9 = tl.load(in_ptr1 + (tmp8 + (32*tmp4) + (1024*x2)), xmask, eviction_policy='evict_last')
tmp11 = tmp9 - tmp10
tmp13 = tmp11 * tmp12
tmp15 = tmp13 * tmp14
tmp17 = tmp15 + tmp16
tmp18 = tl.full([1], 0, tl.int32)
tmp19 = triton_helpers.maximum(tmp18, tmp17)
tl.store(out_ptr0 + (x5), tmp19, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/th/cthl4msq2bdgpn742l3webz5mqwgninyvmg573gu2uxszfsmpn4m.py
# Topologically Sorted Source Nodes: [y_4, out_45], Original ATen: [aten.relu, aten.reflection_pad2d]
# Source node to ATen node mapping:
# out_45 => _unsafe_index_32, _unsafe_index_33
# y_4 => relu_9
# Graph fragment:
# %relu_9 : [num_users=1] = call_function[target=torch.ops.aten.relu.default](args = (%view_29,), kwargs = {})
# %_unsafe_index_32 : [num_users=1] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%relu_9, [None, None, %sub_1, None]), kwargs = {})
# %_unsafe_index_33 : [num_users=2] = call_function[target=torch.ops.aten._unsafe_index.Tensor](args = (%_unsafe_index_32, [None, None, None, %sub_1]), kwargs = {})
triton_poi_fused_reflection_pad2d_relu_20 = async_compile.triton('triton_poi_fused_reflection_pad2d_relu_20', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1048576],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_reflection_pad2d_relu_20', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_reflection_pad2d_relu_20(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 663552
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x0 = xindex % 72
x1 = (xindex // 72) % 72
x2 = (xindex // 5184)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (4095 + ((-1)*(tl_math.abs((-63) + (tl_math.abs((-4) + x0))))) + ((-64)*(tl_math.abs((-63) + (tl_math.abs((-4) + x1))))) + (4096*x2)), None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), None, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (x2), None, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + (x2), None, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + (x2), None, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + (x3), tmp10, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/e7/ce74uqtoket5nfthmxg424ua6qpeecce5sbwlb43qck4fh7zcxd5.py
# Topologically Sorted Source Nodes: [out_46], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# out_46 => convolution_15
# Graph fragment:
# %convolution_15 : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%_unsafe_index_33, %primals_62, %primals_63, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_21 = async_compile.triton('triton_poi_fused_convolution_21', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[65536],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_21', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_21(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 49152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x3 = xindex
x1 = (xindex // 4096) % 3
tmp0 = tl.load(in_out_ptr0 + (x3), None)
tmp1 = tl.load(in_ptr0 + (x1), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15, primals_16, primals_17, primals_18, primals_19, primals_20, primals_21, primals_22, primals_23, primals_24, primals_25, primals_26, primals_27, primals_28, primals_29, primals_30, primals_31, primals_32, primals_33, primals_34, primals_35, primals_36, primals_37, primals_38, primals_39, primals_40, primals_41, primals_42, primals_43, primals_44, primals_45, primals_46, primals_47, primals_48, primals_49, primals_50, primals_51, primals_52, primals_53, primals_54, primals_55, primals_56, primals_57, primals_58, primals_59, primals_60, primals_61, primals_62, primals_63 = args
args.clear()
assert_size_stride(primals_1, (4, 3, 64, 64), (12288, 4096, 64, 1))
assert_size_stride(primals_2, (32, 3, 9, 9), (243, 81, 9, 1))
assert_size_stride(primals_3, (32, ), (1, ))
assert_size_stride(primals_4, (32, ), (1, ))
assert_size_stride(primals_5, (32, ), (1, ))
assert_size_stride(primals_6, (64, 32, 3, 3), (288, 9, 3, 1))
assert_size_stride(primals_7, (64, ), (1, ))
assert_size_stride(primals_8, (64, ), (1, ))
assert_size_stride(primals_9, (64, ), (1, ))
assert_size_stride(primals_10, (128, 64, 3, 3), (576, 9, 3, 1))
assert_size_stride(primals_11, (128, ), (1, ))
assert_size_stride(primals_12, (128, ), (1, ))
assert_size_stride(primals_13, (128, ), (1, ))
assert_size_stride(primals_14, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_15, (128, ), (1, ))
assert_size_stride(primals_16, (128, ), (1, ))
assert_size_stride(primals_17, (128, ), (1, ))
assert_size_stride(primals_18, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_19, (128, ), (1, ))
assert_size_stride(primals_20, (128, ), (1, ))
assert_size_stride(primals_21, (128, ), (1, ))
assert_size_stride(primals_22, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_23, (128, ), (1, ))
assert_size_stride(primals_24, (128, ), (1, ))
assert_size_stride(primals_25, (128, ), (1, ))
assert_size_stride(primals_26, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_27, (128, ), (1, ))
assert_size_stride(primals_28, (128, ), (1, ))
assert_size_stride(primals_29, (128, ), (1, ))
assert_size_stride(primals_30, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_31, (128, ), (1, ))
assert_size_stride(primals_32, (128, ), (1, ))
assert_size_stride(primals_33, (128, ), (1, ))
assert_size_stride(primals_34, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_35, (128, ), (1, ))
assert_size_stride(primals_36, (128, ), (1, ))
assert_size_stride(primals_37, (128, ), (1, ))
assert_size_stride(primals_38, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_39, (128, ), (1, ))
assert_size_stride(primals_40, (128, ), (1, ))
assert_size_stride(primals_41, (128, ), (1, ))
assert_size_stride(primals_42, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_43, (128, ), (1, ))
assert_size_stride(primals_44, (128, ), (1, ))
assert_size_stride(primals_45, (128, ), (1, ))
assert_size_stride(primals_46, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_47, (128, ), (1, ))
assert_size_stride(primals_48, (128, ), (1, ))
assert_size_stride(primals_49, (128, ), (1, ))
assert_size_stride(primals_50, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_51, (128, ), (1, ))
assert_size_stride(primals_52, (128, ), (1, ))
assert_size_stride(primals_53, (128, ), (1, ))
assert_size_stride(primals_54, (64, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_55, (64, ), (1, ))
assert_size_stride(primals_56, (64, ), (1, ))
assert_size_stride(primals_57, (64, ), (1, ))
assert_size_stride(primals_58, (32, 64, 3, 3), (576, 9, 3, 1))
assert_size_stride(primals_59, (32, ), (1, ))
assert_size_stride(primals_60, (32, ), (1, ))
assert_size_stride(primals_61, (32, ), (1, ))
assert_size_stride(primals_62, (3, 32, 9, 9), (2592, 81, 9, 1))
assert_size_stride(primals_63, (3, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 3, 72, 72), (15552, 5184, 72, 1), torch.float32)
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.reflection_pad2d]
stream0 = get_raw_stream(0)
triton_poi_fused_reflection_pad2d_0.run(primals_1, buf0, 62208, grid=grid(62208), stream=stream0)
del primals_1
# Topologically Sorted Source Nodes: [out_1], Original ATen: [aten.convolution]
buf1 = extern_kernels.convolution(buf0, primals_2, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf1, (4, 32, 64, 64), (131072, 4096, 64, 1))
buf2 = buf1; del buf1 # reuse
buf5 = empty_strided_cuda((1, 128, 1, 1), (128, 1, 1, 1), torch.float32)
buf6 = empty_strided_cuda((1, 128, 1, 1), (128, 1, 128, 128), torch.float32)
buf8 = reinterpret_tensor(buf6, (1, 128, 1, 1), (128, 1, 1, 1), 0); del buf6 # reuse
# Topologically Sorted Source Nodes: [out_1, instance_norm], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_red_fused__native_batch_norm_legit_convolution_1.run(buf2, buf8, primals_3, buf5, 128, 4096, grid=grid(128), stream=stream0)
del primals_3
buf3 = empty_strided_cuda((128, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm], Original ATen: [aten.repeat]
triton_poi_fused_repeat_2.run(primals_4, buf3, 128, grid=grid(128), stream=stream0)
del primals_4
buf4 = empty_strided_cuda((128, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm], Original ATen: [aten.repeat]
triton_poi_fused_repeat_2.run(primals_5, buf4, 128, grid=grid(128), stream=stream0)
del primals_5
buf9 = empty_strided_cuda((4, 32, 66, 66), (139392, 4356, 66, 1), torch.float32)
# Topologically Sorted Source Nodes: [y, out_2], Original ATen: [aten.relu, aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_relu_3.run(buf2, buf5, buf8, buf3, buf4, buf9, 557568, grid=grid(557568), stream=stream0)
# Topologically Sorted Source Nodes: [out_3], Original ATen: [aten.convolution]
buf10 = extern_kernels.convolution(buf9, primals_6, stride=(2, 2), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf10, (4, 64, 32, 32), (65536, 1024, 32, 1))
buf11 = buf10; del buf10 # reuse
buf14 = empty_strided_cuda((1, 256, 1, 1), (256, 1, 1, 1), torch.float32)
buf15 = empty_strided_cuda((1, 256, 1, 1), (256, 1, 256, 256), torch.float32)
buf17 = reinterpret_tensor(buf15, (1, 256, 1, 1), (256, 1, 1, 1), 0); del buf15 # reuse
# Topologically Sorted Source Nodes: [out_3, instance_norm_1], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_per_fused__native_batch_norm_legit_convolution_4.run(buf11, buf17, primals_7, buf14, 256, 1024, grid=grid(256), stream=stream0)
del primals_7
buf12 = empty_strided_cuda((256, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_1], Original ATen: [aten.repeat]
triton_poi_fused_repeat_5.run(primals_8, buf12, 256, grid=grid(256), stream=stream0)
del primals_8
buf13 = empty_strided_cuda((256, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_1], Original ATen: [aten.repeat]
triton_poi_fused_repeat_5.run(primals_9, buf13, 256, grid=grid(256), stream=stream0)
del primals_9
buf18 = empty_strided_cuda((4, 64, 34, 34), (73984, 1156, 34, 1), torch.float32)
# Topologically Sorted Source Nodes: [y_1, out_4], Original ATen: [aten.relu, aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_relu_6.run(buf11, buf14, buf17, buf12, buf13, buf18, 295936, grid=grid(295936), stream=stream0)
# Topologically Sorted Source Nodes: [out_5], Original ATen: [aten.convolution]
buf19 = extern_kernels.convolution(buf18, primals_10, stride=(2, 2), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf19, (4, 128, 16, 16), (32768, 256, 16, 1))
buf21 = empty_strided_cuda((512, ), (1, ), torch.float32)
buf22 = empty_strided_cuda((512, ), (1, ), torch.float32)
buf20 = buf19; del buf19 # reuse
buf23 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.float32)
buf24 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf26 = reinterpret_tensor(buf24, (1, 512, 1, 1), (512, 1, 1, 1), 0); del buf24 # reuse
buf27 = empty_strided_cuda((4, 128, 16, 16), (32768, 256, 16, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_5, instance_norm_2, y_2], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.relu]
triton_per_fused__native_batch_norm_legit_convolution_relu_repeat_7.run(buf20, buf26, primals_12, primals_13, primals_11, buf21, buf22, buf23, buf27, 512, 256, grid=grid(512), stream=stream0)
del primals_11
del primals_12
del primals_13
buf28 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_6], Original ATen: [aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_8.run(buf27, buf28, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_7], Original ATen: [aten.convolution]
buf29 = extern_kernels.convolution(buf28, primals_14, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf29, (4, 128, 16, 16), (32768, 256, 16, 1))
buf30 = buf29; del buf29 # reuse
buf33 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.float32)
buf34 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf36 = reinterpret_tensor(buf34, (1, 512, 1, 1), (512, 1, 1, 1), 0); del buf34 # reuse
# Topologically Sorted Source Nodes: [out_7, instance_norm_3], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_per_fused__native_batch_norm_legit_convolution_9.run(buf30, buf36, primals_15, buf33, 512, 256, grid=grid(512), stream=stream0)
del primals_15
buf31 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_3], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_16, buf31, 512, grid=grid(512), stream=stream0)
del primals_16
buf32 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_3], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_17, buf32, 512, grid=grid(512), stream=stream0)
del primals_17
buf37 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_8, out_9], Original ATen: [aten.relu, aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_relu_11.run(buf30, buf33, buf36, buf31, buf32, buf37, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_10], Original ATen: [aten.convolution]
buf38 = extern_kernels.convolution(buf37, primals_18, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf38, (4, 128, 16, 16), (32768, 256, 16, 1))
buf40 = empty_strided_cuda((512, ), (1, ), torch.float32)
buf39 = buf38; del buf38 # reuse
buf41 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf45 = buf27; del buf27 # reuse
buf44 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
# Topologically Sorted Source Nodes: [out_10, out_11, out_12], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.add]
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12.run(buf39, buf45, primals_20, primals_19, primals_21, buf40, buf41, buf44, 512, 256, grid=grid(512), stream=stream0)
del primals_19
del primals_20
del primals_21
buf46 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_13], Original ATen: [aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_8.run(buf45, buf46, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_14], Original ATen: [aten.convolution]
buf47 = extern_kernels.convolution(buf46, primals_22, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf47, (4, 128, 16, 16), (32768, 256, 16, 1))
buf48 = buf47; del buf47 # reuse
buf51 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.float32)
buf52 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf54 = reinterpret_tensor(buf52, (1, 512, 1, 1), (512, 1, 1, 1), 0); del buf52 # reuse
# Topologically Sorted Source Nodes: [out_14, instance_norm_5], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_per_fused__native_batch_norm_legit_convolution_9.run(buf48, buf54, primals_23, buf51, 512, 256, grid=grid(512), stream=stream0)
del primals_23
buf49 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_5], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_24, buf49, 512, grid=grid(512), stream=stream0)
del primals_24
buf50 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_5], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_25, buf50, 512, grid=grid(512), stream=stream0)
del primals_25
buf55 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_15, out_16], Original ATen: [aten.relu, aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_relu_11.run(buf48, buf51, buf54, buf49, buf50, buf55, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_17], Original ATen: [aten.convolution]
buf56 = extern_kernels.convolution(buf55, primals_26, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf56, (4, 128, 16, 16), (32768, 256, 16, 1))
buf58 = empty_strided_cuda((512, ), (1, ), torch.float32)
buf57 = buf56; del buf56 # reuse
buf59 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf63 = buf45; del buf45 # reuse
buf62 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
# Topologically Sorted Source Nodes: [out_17, out_18, out_19], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.add]
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12.run(buf57, buf63, primals_28, primals_27, primals_29, buf58, buf59, buf62, 512, 256, grid=grid(512), stream=stream0)
del primals_27
del primals_28
del primals_29
buf64 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_20], Original ATen: [aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_8.run(buf63, buf64, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_21], Original ATen: [aten.convolution]
buf65 = extern_kernels.convolution(buf64, primals_30, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf65, (4, 128, 16, 16), (32768, 256, 16, 1))
buf66 = buf65; del buf65 # reuse
buf69 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.float32)
buf70 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf72 = reinterpret_tensor(buf70, (1, 512, 1, 1), (512, 1, 1, 1), 0); del buf70 # reuse
# Topologically Sorted Source Nodes: [out_21, instance_norm_7], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_per_fused__native_batch_norm_legit_convolution_9.run(buf66, buf72, primals_31, buf69, 512, 256, grid=grid(512), stream=stream0)
del primals_31
buf67 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_7], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_32, buf67, 512, grid=grid(512), stream=stream0)
del primals_32
buf68 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_7], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_33, buf68, 512, grid=grid(512), stream=stream0)
del primals_33
buf73 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_22, out_23], Original ATen: [aten.relu, aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_relu_11.run(buf66, buf69, buf72, buf67, buf68, buf73, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_24], Original ATen: [aten.convolution]
buf74 = extern_kernels.convolution(buf73, primals_34, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf74, (4, 128, 16, 16), (32768, 256, 16, 1))
buf76 = empty_strided_cuda((512, ), (1, ), torch.float32)
buf75 = buf74; del buf74 # reuse
buf77 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf81 = buf63; del buf63 # reuse
buf80 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
# Topologically Sorted Source Nodes: [out_24, out_25, out_26], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.add]
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12.run(buf75, buf81, primals_36, primals_35, primals_37, buf76, buf77, buf80, 512, 256, grid=grid(512), stream=stream0)
del primals_35
del primals_36
del primals_37
buf82 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_27], Original ATen: [aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_8.run(buf81, buf82, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_28], Original ATen: [aten.convolution]
buf83 = extern_kernels.convolution(buf82, primals_38, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf83, (4, 128, 16, 16), (32768, 256, 16, 1))
buf84 = buf83; del buf83 # reuse
buf87 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.float32)
buf88 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf90 = reinterpret_tensor(buf88, (1, 512, 1, 1), (512, 1, 1, 1), 0); del buf88 # reuse
# Topologically Sorted Source Nodes: [out_28, instance_norm_9], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_per_fused__native_batch_norm_legit_convolution_9.run(buf84, buf90, primals_39, buf87, 512, 256, grid=grid(512), stream=stream0)
del primals_39
buf85 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_9], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_40, buf85, 512, grid=grid(512), stream=stream0)
del primals_40
buf86 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_9], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_41, buf86, 512, grid=grid(512), stream=stream0)
del primals_41
buf91 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_29, out_30], Original ATen: [aten.relu, aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_relu_11.run(buf84, buf87, buf90, buf85, buf86, buf91, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_31], Original ATen: [aten.convolution]
buf92 = extern_kernels.convolution(buf91, primals_42, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf92, (4, 128, 16, 16), (32768, 256, 16, 1))
buf94 = empty_strided_cuda((512, ), (1, ), torch.float32)
buf93 = buf92; del buf92 # reuse
buf95 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf99 = buf81; del buf81 # reuse
buf98 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
# Topologically Sorted Source Nodes: [out_31, out_32, out_33], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.add]
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12.run(buf93, buf99, primals_44, primals_43, primals_45, buf94, buf95, buf98, 512, 256, grid=grid(512), stream=stream0)
del primals_43
del primals_44
del primals_45
buf100 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_34], Original ATen: [aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_8.run(buf99, buf100, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_35], Original ATen: [aten.convolution]
buf101 = extern_kernels.convolution(buf100, primals_46, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf101, (4, 128, 16, 16), (32768, 256, 16, 1))
buf102 = buf101; del buf101 # reuse
buf105 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.float32)
buf106 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf108 = reinterpret_tensor(buf106, (1, 512, 1, 1), (512, 1, 1, 1), 0); del buf106 # reuse
# Topologically Sorted Source Nodes: [out_35, instance_norm_11], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_per_fused__native_batch_norm_legit_convolution_9.run(buf102, buf108, primals_47, buf105, 512, 256, grid=grid(512), stream=stream0)
del primals_47
buf103 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_11], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_48, buf103, 512, grid=grid(512), stream=stream0)
del primals_48
buf104 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_11], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_49, buf104, 512, grid=grid(512), stream=stream0)
del primals_49
buf109 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_36, out_37], Original ATen: [aten.relu, aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_relu_11.run(buf102, buf105, buf108, buf103, buf104, buf109, 165888, grid=grid(165888), stream=stream0)
# Topologically Sorted Source Nodes: [out_38], Original ATen: [aten.convolution]
buf110 = extern_kernels.convolution(buf109, primals_50, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf110, (4, 128, 16, 16), (32768, 256, 16, 1))
buf111 = buf110; del buf110 # reuse
buf113 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf114 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
buf116 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512), torch.float32)
# Topologically Sorted Source Nodes: [out_38, out_39], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_per_fused__native_batch_norm_legit_convolution_13.run(buf111, primals_51, buf113, buf114, buf116, 512, 256, grid=grid(512), stream=stream0)
del primals_51
buf112 = empty_strided_cuda((512, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [out_39], Original ATen: [aten.repeat]
triton_poi_fused_repeat_10.run(primals_52, buf112, 512, grid=grid(512), stream=stream0)
del primals_52
buf117 = empty_strided_cuda((32, ), (1, ), torch.int64)
# Topologically Sorted Source Nodes: [x_in], Original ATen: [aten.arange]
triton_poi_fused_arange_14.run(buf117, 32, grid=grid(32), stream=stream0)
buf118 = empty_strided_cuda((32, ), (1, ), torch.int64)
# Topologically Sorted Source Nodes: [x_in], Original ATen: [aten.arange, aten.add, aten.mul, aten._to_copy]
triton_poi_fused__to_copy_add_arange_mul_15.run(buf118, 32, grid=grid(32), stream=stream0)
buf119 = empty_strided_cuda((4, 128, 34, 34), (147968, 1156, 34, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_40, x_in, out_41], Original ATen: [aten.add, aten._unsafe_index, aten.reflection_pad2d]
triton_poi_fused__unsafe_index_add_reflection_pad2d_16.run(buf118, buf111, buf113, buf114, buf112, primals_53, buf99, buf119, 591872, grid=grid(591872), stream=stream0)
del buf114
del buf99
del primals_53
# Topologically Sorted Source Nodes: [out_42], Original ATen: [aten.convolution]
buf120 = extern_kernels.convolution(buf119, primals_54, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf120, (4, 64, 32, 32), (65536, 1024, 32, 1))
buf121 = buf120; del buf120 # reuse
buf124 = empty_strided_cuda((1, 256, 1, 1), (256, 1, 1, 1), torch.float32)
buf125 = empty_strided_cuda((1, 256, 1, 1), (256, 1, 256, 256), torch.float32)
buf127 = reinterpret_tensor(buf125, (1, 256, 1, 1), (256, 1, 1, 1), 0); del buf125 # reuse
# Topologically Sorted Source Nodes: [out_42, instance_norm_13], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_per_fused__native_batch_norm_legit_convolution_4.run(buf121, buf127, primals_55, buf124, 256, 1024, grid=grid(256), stream=stream0)
del primals_55
buf122 = empty_strided_cuda((256, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_13], Original ATen: [aten.repeat]
triton_poi_fused_repeat_5.run(primals_56, buf122, 256, grid=grid(256), stream=stream0)
del primals_56
buf123 = empty_strided_cuda((256, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_13], Original ATen: [aten.repeat]
triton_poi_fused_repeat_5.run(primals_57, buf123, 256, grid=grid(256), stream=stream0)
del primals_57
buf128 = empty_strided_cuda((64, ), (1, ), torch.int64)
# Topologically Sorted Source Nodes: [x_in_1], Original ATen: [aten.arange]
triton_poi_fused_arange_17.run(buf128, 64, grid=grid(64), stream=stream0)
buf129 = empty_strided_cuda((64, ), (1, ), torch.int64)
# Topologically Sorted Source Nodes: [x_in_1], Original ATen: [aten.arange, aten.add, aten.mul, aten._to_copy]
triton_poi_fused__to_copy_add_arange_mul_18.run(buf129, 64, grid=grid(64), stream=stream0)
buf130 = empty_strided_cuda((4, 64, 66, 66), (278784, 4356, 66, 1), torch.float32)
# Topologically Sorted Source Nodes: [y_3, x_in_1, out_43], Original ATen: [aten.relu, aten._unsafe_index, aten.reflection_pad2d]
triton_poi_fused__unsafe_index_reflection_pad2d_relu_19.run(buf129, buf121, buf124, buf127, buf122, buf123, buf130, 1115136, grid=grid(1115136), stream=stream0)
# Topologically Sorted Source Nodes: [out_44], Original ATen: [aten.convolution]
buf131 = extern_kernels.convolution(buf130, primals_58, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf131, (4, 32, 64, 64), (131072, 4096, 64, 1))
buf132 = buf131; del buf131 # reuse
buf135 = empty_strided_cuda((1, 128, 1, 1), (128, 1, 1, 1), torch.float32)
buf136 = empty_strided_cuda((1, 128, 1, 1), (128, 1, 128, 128), torch.float32)
buf138 = reinterpret_tensor(buf136, (1, 128, 1, 1), (128, 1, 1, 1), 0); del buf136 # reuse
# Topologically Sorted Source Nodes: [out_44, instance_norm_14], Original ATen: [aten.convolution, aten._native_batch_norm_legit]
triton_red_fused__native_batch_norm_legit_convolution_1.run(buf132, buf138, primals_59, buf135, 128, 4096, grid=grid(128), stream=stream0)
del primals_59
buf133 = empty_strided_cuda((128, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_14], Original ATen: [aten.repeat]
triton_poi_fused_repeat_2.run(primals_60, buf133, 128, grid=grid(128), stream=stream0)
del primals_60
buf134 = empty_strided_cuda((128, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [instance_norm_14], Original ATen: [aten.repeat]
triton_poi_fused_repeat_2.run(primals_61, buf134, 128, grid=grid(128), stream=stream0)
del primals_61
buf139 = empty_strided_cuda((4, 32, 72, 72), (165888, 5184, 72, 1), torch.float32)
# Topologically Sorted Source Nodes: [y_4, out_45], Original ATen: [aten.relu, aten.reflection_pad2d]
triton_poi_fused_reflection_pad2d_relu_20.run(buf132, buf135, buf138, buf133, buf134, buf139, 663552, grid=grid(663552), stream=stream0)
# Topologically Sorted Source Nodes: [out_46], Original ATen: [aten.convolution]
buf140 = extern_kernels.convolution(buf139, primals_62, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf140, (4, 3, 64, 64), (12288, 4096, 64, 1))
buf141 = buf140; del buf140 # reuse
# Topologically Sorted Source Nodes: [out_46], Original ATen: [aten.convolution]
triton_poi_fused_convolution_21.run(buf141, primals_63, 49152, grid=grid(49152), stream=stream0)
del primals_63
return (buf141, primals_2, primals_6, primals_10, primals_14, primals_18, primals_22, primals_26, primals_30, primals_34, primals_38, primals_42, primals_46, primals_50, primals_54, primals_58, primals_62, buf0, buf2, buf3, buf4, buf5, buf8, buf9, buf11, buf12, buf13, buf14, buf17, buf18, buf20, buf21, buf22, buf23, buf26, buf28, buf30, buf31, buf32, buf33, buf36, buf37, buf39, buf40, reinterpret_tensor(buf44, (512, ), (1, ), 0), buf46, buf48, buf49, buf50, buf51, buf54, buf55, buf57, buf58, reinterpret_tensor(buf62, (512, ), (1, ), 0), buf64, buf66, buf67, buf68, buf69, buf72, buf73, buf75, buf76, reinterpret_tensor(buf80, (512, ), (1, ), 0), buf82, buf84, buf85, buf86, buf87, buf90, buf91, buf93, buf94, reinterpret_tensor(buf98, (512, ), (1, ), 0), buf100, buf102, buf103, buf104, buf105, buf108, buf109, buf111, buf112, reinterpret_tensor(buf116, (512, ), (1, ), 0), buf117, buf118, buf119, buf121, buf122, buf123, buf124, buf127, buf128, buf129, buf130, buf132, buf133, buf134, buf135, buf138, buf139, reinterpret_tensor(buf113, (1, 512, 1, 1), (512, 1, 1, 1), 0), reinterpret_tensor(buf95, (1, 512, 1, 1), (512, 1, 1, 1), 0), reinterpret_tensor(buf77, (1, 512, 1, 1), (512, 1, 1, 1), 0), reinterpret_tensor(buf59, (1, 512, 1, 1), (512, 1, 1, 1), 0), reinterpret_tensor(buf41, (1, 512, 1, 1), (512, 1, 1, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 3, 64, 64), (12288, 4096, 64, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((32, 3, 9, 9), (243, 81, 9, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((32, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((32, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((32, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((64, 32, 3, 3), (288, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((128, 64, 3, 3), (576, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_12 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_13 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_14 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_15 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_16 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_17 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_18 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_19 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_20 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_21 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_22 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_23 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_24 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_25 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_26 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_27 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_28 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_29 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_30 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_31 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_32 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_33 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_34 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_35 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_36 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_37 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_38 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_39 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_40 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_41 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_42 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_43 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_44 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_45 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_46 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_47 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_48 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_49 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_50 = rand_strided((128, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_51 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_52 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_53 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_54 = rand_strided((64, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_55 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_56 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_57 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_58 = rand_strided((32, 64, 3, 3), (576, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_59 = rand_strided((32, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_60 = rand_strided((32, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_61 = rand_strided((32, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_62 = rand_strided((3, 32, 9, 9), (2592, 81, 9, 1), device='cuda:0', dtype=torch.float32)
primals_63 = rand_strided((3, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15, primals_16, primals_17, primals_18, primals_19, primals_20, primals_21, primals_22, primals_23, primals_24, primals_25, primals_26, primals_27, primals_28, primals_29, primals_30, primals_31, primals_32, primals_33, primals_34, primals_35, primals_36, primals_37, primals_38, primals_39, primals_40, primals_41, primals_42, primals_43, primals_44, primals_45, primals_46, primals_47, primals_48, primals_49, primals_50, primals_51, primals_52, primals_53, primals_54, primals_55, primals_56, primals_57, primals_58, primals_59, primals_60, primals_61, primals_62, primals_63])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.onnx
class ConvLayer(torch.nn.Module):
def __init__(self, in_channels, out_channels, kernel_size, stride):
super(ConvLayer, self).__init__()
reflection_padding = kernel_size // 2
self.reflection_pad = torch.nn.ReflectionPad2d(reflection_padding)
self.conv2d = torch.nn.Conv2d(in_channels, out_channels,
kernel_size, stride)
def forward(self, x):
out = self.reflection_pad(x)
out = self.conv2d(out)
return out
class ResidualBlock(torch.nn.Module):
"""ResidualBlock
introduced in: https://arxiv.org/abs/1512.03385
recommended architecture: http://torch.ch/blog/2016/02/04/resnets.html
"""
def __init__(self, channels):
super(ResidualBlock, self).__init__()
self.conv1 = ConvLayer(channels, channels, kernel_size=3, stride=1)
self.in1 = torch.nn.InstanceNorm2d(channels, affine=True)
self.conv2 = ConvLayer(channels, channels, kernel_size=3, stride=1)
self.in2 = torch.nn.InstanceNorm2d(channels, affine=True)
self.relu = torch.nn.ReLU()
def forward(self, x):
residual = x
out = self.relu(self.in1(self.conv1(x)))
out = self.in2(self.conv2(out))
out = out + residual
return out
class UpsampleConvLayer(torch.nn.Module):
"""UpsampleConvLayer
Upsamples the input and then does a convolution. This method gives better results
compared to ConvTranspose2d.
ref: http://distill.pub/2016/deconv-checkerboard/
"""
def __init__(self, in_channels, out_channels, kernel_size, stride,
upsample=None):
super(UpsampleConvLayer, self).__init__()
self.upsample = upsample
if upsample:
self.upsample_layer = torch.nn.Upsample(mode='nearest',
scale_factor=upsample)
reflection_padding = kernel_size // 2
self.reflection_pad = torch.nn.ReflectionPad2d(reflection_padding)
self.conv2d = torch.nn.Conv2d(in_channels, out_channels,
kernel_size, stride)
def forward(self, x):
x_in = x
if self.upsample:
x_in = self.upsample_layer(x_in)
out = self.reflection_pad(x_in)
out = self.conv2d(out)
return out
class TransformerNet(torch.nn.Module):
def __init__(self):
super(TransformerNet, self).__init__()
self.conv1 = ConvLayer(3, 32, kernel_size=9, stride=1)
self.in1 = torch.nn.InstanceNorm2d(32, affine=True)
self.conv2 = ConvLayer(32, 64, kernel_size=3, stride=2)
self.in2 = torch.nn.InstanceNorm2d(64, affine=True)
self.conv3 = ConvLayer(64, 128, kernel_size=3, stride=2)
self.in3 = torch.nn.InstanceNorm2d(128, affine=True)
self.res1 = ResidualBlock(128)
self.res2 = ResidualBlock(128)
self.res3 = ResidualBlock(128)
self.res4 = ResidualBlock(128)
self.res5 = ResidualBlock(128)
self.deconv1 = UpsampleConvLayer(128, 64, kernel_size=3, stride=1,
upsample=2)
self.in4 = torch.nn.InstanceNorm2d(64, affine=True)
self.deconv2 = UpsampleConvLayer(64, 32, kernel_size=3, stride=1,
upsample=2)
self.in5 = torch.nn.InstanceNorm2d(32, affine=True)
self.deconv3 = ConvLayer(32, 3, kernel_size=9, stride=1)
self.relu = torch.nn.ReLU()
def forward(self, X):
y = self.relu(self.in1(self.conv1(X)))
y = self.relu(self.in2(self.conv2(y)))
y = self.relu(self.in3(self.conv3(y)))
y = self.res1(y)
y = self.res2(y)
y = self.res3(y)
y = self.res4(y)
y = self.res5(y)
y = self.relu(self.in4(self.deconv1(y)))
y = self.relu(self.in5(self.deconv2(y)))
y = self.deconv3(y)
return y
def get_inputs():
return [torch.rand([4, 3, 64, 64])]
def get_init_inputs():
return [[], {}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.onnx
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_reflection_pad2d_0(in_ptr0, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 62208
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 72
x1 = xindex // 72 % 72
x2 = xindex // 5184
x3 = xindex
tmp0 = tl.load(in_ptr0 + (4095 + -1 * tl_math.abs(-63 + tl_math.abs(-4 +
x0)) + -64 * tl_math.abs(-63 + tl_math.abs(-4 + x1)) + 4096 * x2),
xmask, eviction_policy='evict_last')
tl.store(out_ptr0 + x3, tmp0, xmask)
@triton.jit
def triton_red_fused__native_batch_norm_legit_convolution_1(in_out_ptr0,
in_out_ptr1, in_ptr0, out_ptr0, xnumel, rnumel, XBLOCK: tl.constexpr,
RBLOCK: tl.constexpr):
xnumel = 128
rnumel = 4096
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rbase = tl.arange(0, RBLOCK)[None, :]
x3 = xindex
x0 = xindex % 32
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp4_mean = tl.zeros([XBLOCK, RBLOCK], tl.float32)
tmp4_m2 = tl.zeros([XBLOCK, RBLOCK], tl.float32)
tmp4_weight = tl.zeros([XBLOCK, RBLOCK], tl.float32)
for roffset in range(0, rnumel, RBLOCK):
rindex = roffset + rbase
rmask = rindex < rnumel
r2 = rindex
tmp0 = tl.load(in_out_ptr0 + (r2 + 4096 * x3), rmask & xmask,
eviction_policy='evict_first', other=0.0)
tmp2 = tmp0 + tmp1
tmp3 = tl.broadcast_to(tmp2, [XBLOCK, RBLOCK])
tmp4_mean_next, tmp4_m2_next, tmp4_weight_next = (triton_helpers.
welford_reduce(tmp3, tmp4_mean, tmp4_m2, tmp4_weight, roffset == 0)
)
tmp4_mean = tl.where(rmask & xmask, tmp4_mean_next, tmp4_mean)
tmp4_m2 = tl.where(rmask & xmask, tmp4_m2_next, tmp4_m2)
tmp4_weight = tl.where(rmask & xmask, tmp4_weight_next, tmp4_weight)
tl.store(in_out_ptr0 + (r2 + 4096 * x3), tmp2, rmask & xmask)
tmp4_tmp, tmp5_tmp, tmp6_tmp = triton_helpers.welford(tmp4_mean,
tmp4_m2, tmp4_weight, 1)
tmp4 = tmp4_tmp[:, None]
tmp5 = tmp5_tmp[:, None]
tmp6_tmp[:, None]
tl.store(out_ptr0 + x3, tmp4, xmask)
tmp7 = 4096.0
tmp8 = tmp5 / tmp7
tmp9 = 1e-05
tmp10 = tmp8 + tmp9
tmp11 = libdevice.rsqrt(tmp10)
tl.debug_barrier()
tl.store(in_out_ptr1 + x3, tmp11, xmask)
@triton.jit
def triton_poi_fused_repeat_2(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0 % 32, xmask)
tl.store(out_ptr0 + x0, tmp0, xmask)
@triton.jit
def triton_poi_fused_reflection_pad2d_relu_3(in_ptr0, in_ptr1, in_ptr2,
in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 557568
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 66
x1 = xindex // 66 % 66
x2 = xindex // 4356
x3 = xindex
tmp0 = tl.load(in_ptr0 + (4095 + -1 * tl_math.abs(-63 + tl_math.abs(-1 +
x0)) + -64 * tl_math.abs(-63 + tl_math.abs(-1 + x1)) + 4096 * x2),
xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + x2, xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + x2, xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + x2, xmask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + x3, tmp10, xmask)
@triton.jit
def triton_per_fused__native_batch_norm_legit_convolution_4(in_out_ptr0,
in_out_ptr1, in_ptr0, out_ptr0, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r2 = rindex
x3 = xindex
x0 = xindex % 64
tmp0 = tl.load(in_out_ptr0 + (r2 + 1024 * x3), None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.broadcast_to(tmp2, [RBLOCK])
tmp5 = tl.broadcast_to(tmp3, [RBLOCK])
tmp7 = triton_helpers.promote_to_tensor(tl.sum(tmp5, 0))
tmp8 = tl.full([1], 1024, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp3 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [RBLOCK])
tmp15 = triton_helpers.promote_to_tensor(tl.sum(tmp13, 0))
tmp16 = 1024.0
tmp17 = tmp15 / tmp16
tmp18 = 1e-05
tmp19 = tmp17 + tmp18
tmp20 = libdevice.rsqrt(tmp19)
tl.store(in_out_ptr0 + (r2 + 1024 * x3), tmp2, None)
tl.debug_barrier()
tl.store(in_out_ptr1 + x3, tmp20, None)
tl.store(out_ptr0 + x3, tmp10, None)
@triton.jit
def triton_poi_fused_repeat_5(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0 % 64, xmask)
tl.store(out_ptr0 + x0, tmp0, xmask)
@triton.jit
def triton_poi_fused_reflection_pad2d_relu_6(in_ptr0, in_ptr1, in_ptr2,
in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 295936
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 34
x1 = xindex // 34 % 34
x2 = xindex // 1156
x3 = xindex
tmp0 = tl.load(in_ptr0 + (1023 + -1 * tl_math.abs(-31 + tl_math.abs(-1 +
x0)) + -32 * tl_math.abs(-31 + tl_math.abs(-1 + x1)) + 1024 * x2),
xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + x2, xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + x2, xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + x2, xmask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + x3, tmp10, xmask)
@triton.jit
def triton_per_fused__native_batch_norm_legit_convolution_relu_repeat_7(
in_out_ptr0, in_out_ptr1, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1,
out_ptr2, out_ptr3, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 128
tmp0 = tl.load(in_ptr0 + x0 % 128, None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x0 % 128, None, eviction_policy='evict_last')
tmp2 = tl.load(in_out_ptr0 + (r3 + 256 * x0), None)
tmp3 = tl.load(in_ptr2 + x1, None, eviction_policy='evict_last')
tmp4 = tmp2 + tmp3
tmp5 = tl.broadcast_to(tmp4, [RBLOCK])
tmp7 = tl.broadcast_to(tmp5, [RBLOCK])
tmp9 = triton_helpers.promote_to_tensor(tl.sum(tmp7, 0))
tmp10 = tl.full([1], 256, tl.int32)
tmp11 = tmp10.to(tl.float32)
tmp12 = tmp9 / tmp11
tmp13 = tmp5 - tmp12
tmp14 = tmp13 * tmp13
tmp15 = tl.broadcast_to(tmp14, [RBLOCK])
tmp17 = triton_helpers.promote_to_tensor(tl.sum(tmp15, 0))
tmp18 = 256.0
tmp19 = tmp17 / tmp18
tmp20 = 1e-05
tmp21 = tmp19 + tmp20
tmp22 = libdevice.rsqrt(tmp21)
tmp23 = tmp4 - tmp12
tmp24 = tmp23 * tmp22
tmp25 = tmp24 * tmp0
tmp26 = tmp25 + tmp1
tmp27 = tl.full([1], 0, tl.int32)
tmp28 = triton_helpers.maximum(tmp27, tmp26)
tl.store(out_ptr0 + x0, tmp0, None)
tl.store(out_ptr1 + x0, tmp1, None)
tl.store(in_out_ptr0 + (r3 + 256 * x0), tmp4, None)
tl.debug_barrier()
tl.store(in_out_ptr1 + x0, tmp22, None)
tl.store(out_ptr3 + (r3 + 256 * x0), tmp28, None)
tl.store(out_ptr2 + x0, tmp12, None)
@triton.jit
def triton_poi_fused_reflection_pad2d_8(in_ptr0, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x0 = xindex % 18
x1 = xindex // 18 % 18
x2 = xindex // 324
x3 = xindex
tmp0 = tl.load(in_ptr0 + (255 + -1 * tl_math.abs(-15 + tl_math.abs(-1 +
x0)) + -16 * tl_math.abs(-15 + tl_math.abs(-1 + x1)) + 256 * x2),
None, eviction_policy='evict_last')
tl.store(out_ptr0 + x3, tmp0, None)
@triton.jit
def triton_per_fused__native_batch_norm_legit_convolution_9(in_out_ptr0,
in_out_ptr1, in_ptr0, out_ptr0, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r2 = rindex
x3 = xindex
x0 = xindex % 128
tmp0 = tl.load(in_out_ptr0 + (r2 + 256 * x3), None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.broadcast_to(tmp2, [RBLOCK])
tmp5 = tl.broadcast_to(tmp3, [RBLOCK])
tmp7 = triton_helpers.promote_to_tensor(tl.sum(tmp5, 0))
tmp8 = tl.full([1], 256, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp3 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [RBLOCK])
tmp15 = triton_helpers.promote_to_tensor(tl.sum(tmp13, 0))
tmp16 = 256.0
tmp17 = tmp15 / tmp16
tmp18 = 1e-05
tmp19 = tmp17 + tmp18
tmp20 = libdevice.rsqrt(tmp19)
tl.store(in_out_ptr0 + (r2 + 256 * x3), tmp2, None)
tl.debug_barrier()
tl.store(in_out_ptr1 + x3, tmp20, None)
tl.store(out_ptr0 + x3, tmp10, None)
@triton.jit
def triton_poi_fused_repeat_10(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 512
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0 % 128, xmask)
tl.store(out_ptr0 + x0, tmp0, xmask)
@triton.jit
def triton_poi_fused_reflection_pad2d_relu_11(in_ptr0, in_ptr1, in_ptr2,
in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x0 = xindex % 18
x1 = xindex // 18 % 18
x2 = xindex // 324
x3 = xindex
tmp0 = tl.load(in_ptr0 + (255 + -1 * tl_math.abs(-15 + tl_math.abs(-1 +
x0)) + -16 * tl_math.abs(-15 + tl_math.abs(-1 + x1)) + 256 * x2),
None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, None, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + x2, None, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + x2, None, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + x2, None, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + x3, tmp10, None)
@triton.jit
def triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12(
in_out_ptr0, in_out_ptr1, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1,
out_ptr3, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 128
tmp0 = tl.load(in_ptr0 + x0 % 128, None, eviction_policy='evict_last')
tmp1 = tl.load(in_out_ptr0 + (r3 + 256 * x0), None)
tmp2 = tl.load(in_ptr1 + x1, None, eviction_policy='evict_last')
tmp25 = tl.load(in_ptr2 + x1, None, eviction_policy='evict_last')
tmp27 = tl.load(in_out_ptr1 + (r3 + 256 * x0), None)
tmp3 = tmp1 + tmp2
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = tl.broadcast_to(tmp4, [RBLOCK])
tmp8 = triton_helpers.promote_to_tensor(tl.sum(tmp6, 0))
tmp9 = tl.full([1], 256, tl.int32)
tmp10 = tmp9.to(tl.float32)
tmp11 = tmp8 / tmp10
tmp12 = tmp4 - tmp11
tmp13 = tmp12 * tmp12
tmp14 = tl.broadcast_to(tmp13, [RBLOCK])
tmp16 = triton_helpers.promote_to_tensor(tl.sum(tmp14, 0))
tmp17 = tmp3 - tmp11
tmp18 = 256.0
tmp19 = tmp16 / tmp18
tmp20 = 1e-05
tmp21 = tmp19 + tmp20
tmp22 = libdevice.rsqrt(tmp21)
tmp23 = tmp17 * tmp22
tmp24 = tmp23 * tmp0
tmp26 = tmp24 + tmp25
tmp28 = tmp26 + tmp27
tl.store(out_ptr0 + x0, tmp0, None)
tl.store(in_out_ptr0 + (r3 + 256 * x0), tmp3, None)
tl.store(in_out_ptr1 + (r3 + 256 * x0), tmp28, None)
tl.store(out_ptr3 + x0, tmp22, None)
tl.store(out_ptr1 + x0, tmp11, None)
@triton.jit
def triton_per_fused__native_batch_norm_legit_convolution_13(in_out_ptr0,
in_ptr0, out_ptr0, out_ptr1, out_ptr2, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r2 = rindex
x3 = xindex
x0 = xindex % 128
tmp0 = tl.load(in_out_ptr0 + (r2 + 256 * x3), None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.broadcast_to(tmp2, [RBLOCK])
tmp5 = tl.broadcast_to(tmp3, [RBLOCK])
tmp7 = triton_helpers.promote_to_tensor(tl.sum(tmp5, 0))
tmp8 = tl.full([1], 256, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp3 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [RBLOCK])
tmp15 = triton_helpers.promote_to_tensor(tl.sum(tmp13, 0))
tmp16 = 256.0
tmp17 = tmp15 / tmp16
tmp18 = 1e-05
tmp19 = tmp17 + tmp18
tmp20 = libdevice.rsqrt(tmp19)
tl.store(in_out_ptr0 + (r2 + 256 * x3), tmp2, None)
tl.store(out_ptr2 + x3, tmp20, None)
tl.store(out_ptr0 + x3, tmp10, None)
tl.store(out_ptr1 + x3, tmp15, None)
@triton.jit
def triton_poi_fused_arange_14(out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 32
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = x0
tl.store(out_ptr0 + x0, tmp0, xmask)
@triton.jit
def triton_poi_fused__to_copy_add_arange_mul_15(out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 32
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = x0
tmp1 = tmp0.to(tl.float32)
tmp2 = 0.5
tmp3 = tmp1 * tmp2
tmp4 = tmp3.to(tl.int32)
tl.store(out_ptr0 + x0, tmp4, xmask)
@triton.jit
def triton_poi_fused__unsafe_index_add_reflection_pad2d_16(in_ptr0, in_ptr1,
in_ptr2, in_ptr3, in_ptr4, in_ptr5, in_ptr6, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x1 = xindex // 34 % 34
x0 = xindex % 34
x4 = xindex // 1156
x2 = xindex // 1156 % 128
x7 = xindex
tmp0 = tl.load(in_ptr0 + (31 + -1 * tl_math.abs(-31 + tl_math.abs(-1 +
x1))), None, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (31 + -1 * tl_math.abs(-31 + tl_math.abs(-1 +
x0))), None, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr2 + x4, None, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr3 + x4, None, eviction_policy='evict_last')
tmp19 = tl.load(in_ptr4 + x4, None, eviction_policy='evict_last')
tmp21 = tl.load(in_ptr5 + x2, None, eviction_policy='evict_last')
tmp1 = tl.full([XBLOCK], 16, tl.int32)
tmp2 = tmp0 + tmp1
tmp3 = tmp0 < 0
tmp4 = tl.where(tmp3, tmp2, tmp0)
tmp6 = tmp5 + tmp1
tmp7 = tmp5 < 0
tmp8 = tl.where(tmp7, tmp6, tmp5)
tmp9 = tl.load(in_ptr1 + (tmp8 + 16 * tmp4 + 256 * x4), None,
eviction_policy='evict_last')
tmp11 = tmp9 - tmp10
tmp13 = 256.0
tmp14 = tmp12 / tmp13
tmp15 = 1e-05
tmp16 = tmp14 + tmp15
tmp17 = libdevice.rsqrt(tmp16)
tmp18 = tmp11 * tmp17
tmp20 = tmp18 * tmp19
tmp22 = tmp20 + tmp21
tmp23 = tl.load(in_ptr6 + (tmp8 + 16 * tmp4 + 256 * x4), None,
eviction_policy='evict_last')
tmp24 = tmp22 + tmp23
tl.store(out_ptr0 + x7, tmp24, None)
@triton.jit
def triton_poi_fused_arange_17(out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = x0
tl.store(out_ptr0 + x0, tmp0, xmask)
@triton.jit
def triton_poi_fused__to_copy_add_arange_mul_18(out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = x0
tmp1 = tmp0.to(tl.float32)
tmp2 = 0.5
tmp3 = tmp1 * tmp2
tmp4 = tmp3.to(tl.int32)
tl.store(out_ptr0 + x0, tmp4, xmask)
@triton.jit
def triton_poi_fused__unsafe_index_reflection_pad2d_relu_19(in_ptr0,
in_ptr1, in_ptr2, in_ptr3, in_ptr4, in_ptr5, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 1115136
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 66 % 66
x0 = xindex % 66
x2 = xindex // 4356
x5 = xindex
tmp0 = tl.load(in_ptr0 + (63 + -1 * tl_math.abs(-63 + tl_math.abs(-1 +
x1))), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (63 + -1 * tl_math.abs(-63 + tl_math.abs(-1 +
x0))), xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr2 + x2, xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr3 + x2, xmask, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr4 + x2, xmask, eviction_policy='evict_last')
tmp16 = tl.load(in_ptr5 + x2, xmask, eviction_policy='evict_last')
tmp1 = tl.full([XBLOCK], 32, tl.int32)
tmp2 = tmp0 + tmp1
tmp3 = tmp0 < 0
tmp4 = tl.where(tmp3, tmp2, tmp0)
tmp6 = tmp5 + tmp1
tmp7 = tmp5 < 0
tmp8 = tl.where(tmp7, tmp6, tmp5)
tmp9 = tl.load(in_ptr1 + (tmp8 + 32 * tmp4 + 1024 * x2), xmask,
eviction_policy='evict_last')
tmp11 = tmp9 - tmp10
tmp13 = tmp11 * tmp12
tmp15 = tmp13 * tmp14
tmp17 = tmp15 + tmp16
tmp18 = tl.full([1], 0, tl.int32)
tmp19 = triton_helpers.maximum(tmp18, tmp17)
tl.store(out_ptr0 + x5, tmp19, xmask)
@triton.jit
def triton_poi_fused_reflection_pad2d_relu_20(in_ptr0, in_ptr1, in_ptr2,
in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x0 = xindex % 72
x1 = xindex // 72 % 72
x2 = xindex // 5184
x3 = xindex
tmp0 = tl.load(in_ptr0 + (4095 + -1 * tl_math.abs(-63 + tl_math.abs(-4 +
x0)) + -64 * tl_math.abs(-63 + tl_math.abs(-4 + x1)) + 4096 * x2),
None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, None, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + x2, None, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + x2, None, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + x2, None, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + x3, tmp10, None)
@triton.jit
def triton_poi_fused_convolution_21(in_out_ptr0, in_ptr0, xnumel, XBLOCK:
tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x3 = xindex
x1 = xindex // 4096 % 3
tmp0 = tl.load(in_out_ptr0 + x3, None)
tmp1 = tl.load(in_ptr0 + x1, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, None)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11, primals_12,
primals_13, primals_14, primals_15, primals_16, primals_17,
primals_18, primals_19, primals_20, primals_21, primals_22,
primals_23, primals_24, primals_25, primals_26, primals_27,
primals_28, primals_29, primals_30, primals_31, primals_32,
primals_33, primals_34, primals_35, primals_36, primals_37,
primals_38, primals_39, primals_40, primals_41, primals_42,
primals_43, primals_44, primals_45, primals_46, primals_47,
primals_48, primals_49, primals_50, primals_51, primals_52,
primals_53, primals_54, primals_55, primals_56, primals_57,
primals_58, primals_59, primals_60, primals_61, primals_62, primals_63
) = args
args.clear()
assert_size_stride(primals_1, (4, 3, 64, 64), (12288, 4096, 64, 1))
assert_size_stride(primals_2, (32, 3, 9, 9), (243, 81, 9, 1))
assert_size_stride(primals_3, (32,), (1,))
assert_size_stride(primals_4, (32,), (1,))
assert_size_stride(primals_5, (32,), (1,))
assert_size_stride(primals_6, (64, 32, 3, 3), (288, 9, 3, 1))
assert_size_stride(primals_7, (64,), (1,))
assert_size_stride(primals_8, (64,), (1,))
assert_size_stride(primals_9, (64,), (1,))
assert_size_stride(primals_10, (128, 64, 3, 3), (576, 9, 3, 1))
assert_size_stride(primals_11, (128,), (1,))
assert_size_stride(primals_12, (128,), (1,))
assert_size_stride(primals_13, (128,), (1,))
assert_size_stride(primals_14, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_15, (128,), (1,))
assert_size_stride(primals_16, (128,), (1,))
assert_size_stride(primals_17, (128,), (1,))
assert_size_stride(primals_18, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_19, (128,), (1,))
assert_size_stride(primals_20, (128,), (1,))
assert_size_stride(primals_21, (128,), (1,))
assert_size_stride(primals_22, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_23, (128,), (1,))
assert_size_stride(primals_24, (128,), (1,))
assert_size_stride(primals_25, (128,), (1,))
assert_size_stride(primals_26, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_27, (128,), (1,))
assert_size_stride(primals_28, (128,), (1,))
assert_size_stride(primals_29, (128,), (1,))
assert_size_stride(primals_30, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_31, (128,), (1,))
assert_size_stride(primals_32, (128,), (1,))
assert_size_stride(primals_33, (128,), (1,))
assert_size_stride(primals_34, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_35, (128,), (1,))
assert_size_stride(primals_36, (128,), (1,))
assert_size_stride(primals_37, (128,), (1,))
assert_size_stride(primals_38, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_39, (128,), (1,))
assert_size_stride(primals_40, (128,), (1,))
assert_size_stride(primals_41, (128,), (1,))
assert_size_stride(primals_42, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_43, (128,), (1,))
assert_size_stride(primals_44, (128,), (1,))
assert_size_stride(primals_45, (128,), (1,))
assert_size_stride(primals_46, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_47, (128,), (1,))
assert_size_stride(primals_48, (128,), (1,))
assert_size_stride(primals_49, (128,), (1,))
assert_size_stride(primals_50, (128, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_51, (128,), (1,))
assert_size_stride(primals_52, (128,), (1,))
assert_size_stride(primals_53, (128,), (1,))
assert_size_stride(primals_54, (64, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_55, (64,), (1,))
assert_size_stride(primals_56, (64,), (1,))
assert_size_stride(primals_57, (64,), (1,))
assert_size_stride(primals_58, (32, 64, 3, 3), (576, 9, 3, 1))
assert_size_stride(primals_59, (32,), (1,))
assert_size_stride(primals_60, (32,), (1,))
assert_size_stride(primals_61, (32,), (1,))
assert_size_stride(primals_62, (3, 32, 9, 9), (2592, 81, 9, 1))
assert_size_stride(primals_63, (3,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 3, 72, 72), (15552, 5184, 72, 1),
torch.float32)
get_raw_stream(0)
triton_poi_fused_reflection_pad2d_0[grid(62208)](primals_1, buf0,
62208, XBLOCK=256, num_warps=4, num_stages=1)
del primals_1
buf1 = extern_kernels.convolution(buf0, primals_2, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf1, (4, 32, 64, 64), (131072, 4096, 64, 1))
buf2 = buf1
del buf1
buf5 = empty_strided_cuda((1, 128, 1, 1), (128, 1, 1, 1), torch.float32
)
buf6 = empty_strided_cuda((1, 128, 1, 1), (128, 1, 128, 128), torch
.float32)
buf8 = reinterpret_tensor(buf6, (1, 128, 1, 1), (128, 1, 1, 1), 0)
del buf6
triton_red_fused__native_batch_norm_legit_convolution_1[grid(128)](buf2
, buf8, primals_3, buf5, 128, 4096, XBLOCK=1, RBLOCK=2048,
num_warps=16, num_stages=1)
del primals_3
buf3 = empty_strided_cuda((128,), (1,), torch.float32)
triton_poi_fused_repeat_2[grid(128)](primals_4, buf3, 128, XBLOCK=
128, num_warps=4, num_stages=1)
del primals_4
buf4 = empty_strided_cuda((128,), (1,), torch.float32)
triton_poi_fused_repeat_2[grid(128)](primals_5, buf4, 128, XBLOCK=
128, num_warps=4, num_stages=1)
del primals_5
buf9 = empty_strided_cuda((4, 32, 66, 66), (139392, 4356, 66, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_relu_3[grid(557568)](buf2, buf5,
buf8, buf3, buf4, buf9, 557568, XBLOCK=512, num_warps=8,
num_stages=1)
buf10 = extern_kernels.convolution(buf9, primals_6, stride=(2, 2),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf10, (4, 64, 32, 32), (65536, 1024, 32, 1))
buf11 = buf10
del buf10
buf14 = empty_strided_cuda((1, 256, 1, 1), (256, 1, 1, 1), torch.
float32)
buf15 = empty_strided_cuda((1, 256, 1, 1), (256, 1, 256, 256),
torch.float32)
buf17 = reinterpret_tensor(buf15, (1, 256, 1, 1), (256, 1, 1, 1), 0)
del buf15
triton_per_fused__native_batch_norm_legit_convolution_4[grid(256)](
buf11, buf17, primals_7, buf14, 256, 1024, num_warps=8,
num_stages=1)
del primals_7
buf12 = empty_strided_cuda((256,), (1,), torch.float32)
triton_poi_fused_repeat_5[grid(256)](primals_8, buf12, 256, XBLOCK=
128, num_warps=4, num_stages=1)
del primals_8
buf13 = empty_strided_cuda((256,), (1,), torch.float32)
triton_poi_fused_repeat_5[grid(256)](primals_9, buf13, 256, XBLOCK=
128, num_warps=4, num_stages=1)
del primals_9
buf18 = empty_strided_cuda((4, 64, 34, 34), (73984, 1156, 34, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_relu_6[grid(295936)](buf11, buf14,
buf17, buf12, buf13, buf18, 295936, XBLOCK=1024, num_warps=4,
num_stages=1)
buf19 = extern_kernels.convolution(buf18, primals_10, stride=(2, 2),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf19, (4, 128, 16, 16), (32768, 256, 16, 1))
buf21 = empty_strided_cuda((512,), (1,), torch.float32)
buf22 = empty_strided_cuda((512,), (1,), torch.float32)
buf20 = buf19
del buf19
buf23 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.
float32)
buf24 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf26 = reinterpret_tensor(buf24, (1, 512, 1, 1), (512, 1, 1, 1), 0)
del buf24
buf27 = empty_strided_cuda((4, 128, 16, 16), (32768, 256, 16, 1),
torch.float32)
triton_per_fused__native_batch_norm_legit_convolution_relu_repeat_7[
grid(512)](buf20, buf26, primals_12, primals_13, primals_11,
buf21, buf22, buf23, buf27, 512, 256, num_warps=2, num_stages=1)
del primals_11
del primals_12
del primals_13
buf28 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_8[grid(165888)](buf27, buf28,
165888, XBLOCK=512, num_warps=8, num_stages=1)
buf29 = extern_kernels.convolution(buf28, primals_14, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf29, (4, 128, 16, 16), (32768, 256, 16, 1))
buf30 = buf29
del buf29
buf33 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.
float32)
buf34 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf36 = reinterpret_tensor(buf34, (1, 512, 1, 1), (512, 1, 1, 1), 0)
del buf34
triton_per_fused__native_batch_norm_legit_convolution_9[grid(512)](
buf30, buf36, primals_15, buf33, 512, 256, num_warps=2,
num_stages=1)
del primals_15
buf31 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_16, buf31, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_16
buf32 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_17, buf32, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_17
buf37 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_relu_11[grid(165888)](buf30,
buf33, buf36, buf31, buf32, buf37, 165888, XBLOCK=1024,
num_warps=4, num_stages=1)
buf38 = extern_kernels.convolution(buf37, primals_18, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf38, (4, 128, 16, 16), (32768, 256, 16, 1))
buf40 = empty_strided_cuda((512,), (1,), torch.float32)
buf39 = buf38
del buf38
buf41 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf45 = buf27
del buf27
buf44 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12[
grid(512)](buf39, buf45, primals_20, primals_19, primals_21,
buf40, buf41, buf44, 512, 256, num_warps=2, num_stages=1)
del primals_19
del primals_20
del primals_21
buf46 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_8[grid(165888)](buf45, buf46,
165888, XBLOCK=512, num_warps=8, num_stages=1)
buf47 = extern_kernels.convolution(buf46, primals_22, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf47, (4, 128, 16, 16), (32768, 256, 16, 1))
buf48 = buf47
del buf47
buf51 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.
float32)
buf52 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf54 = reinterpret_tensor(buf52, (1, 512, 1, 1), (512, 1, 1, 1), 0)
del buf52
triton_per_fused__native_batch_norm_legit_convolution_9[grid(512)](
buf48, buf54, primals_23, buf51, 512, 256, num_warps=2,
num_stages=1)
del primals_23
buf49 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_24, buf49, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_24
buf50 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_25, buf50, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_25
buf55 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_relu_11[grid(165888)](buf48,
buf51, buf54, buf49, buf50, buf55, 165888, XBLOCK=1024,
num_warps=4, num_stages=1)
buf56 = extern_kernels.convolution(buf55, primals_26, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf56, (4, 128, 16, 16), (32768, 256, 16, 1))
buf58 = empty_strided_cuda((512,), (1,), torch.float32)
buf57 = buf56
del buf56
buf59 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf63 = buf45
del buf45
buf62 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12[
grid(512)](buf57, buf63, primals_28, primals_27, primals_29,
buf58, buf59, buf62, 512, 256, num_warps=2, num_stages=1)
del primals_27
del primals_28
del primals_29
buf64 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_8[grid(165888)](buf63, buf64,
165888, XBLOCK=512, num_warps=8, num_stages=1)
buf65 = extern_kernels.convolution(buf64, primals_30, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf65, (4, 128, 16, 16), (32768, 256, 16, 1))
buf66 = buf65
del buf65
buf69 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.
float32)
buf70 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf72 = reinterpret_tensor(buf70, (1, 512, 1, 1), (512, 1, 1, 1), 0)
del buf70
triton_per_fused__native_batch_norm_legit_convolution_9[grid(512)](
buf66, buf72, primals_31, buf69, 512, 256, num_warps=2,
num_stages=1)
del primals_31
buf67 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_32, buf67, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_32
buf68 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_33, buf68, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_33
buf73 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_relu_11[grid(165888)](buf66,
buf69, buf72, buf67, buf68, buf73, 165888, XBLOCK=1024,
num_warps=4, num_stages=1)
buf74 = extern_kernels.convolution(buf73, primals_34, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf74, (4, 128, 16, 16), (32768, 256, 16, 1))
buf76 = empty_strided_cuda((512,), (1,), torch.float32)
buf75 = buf74
del buf74
buf77 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf81 = buf63
del buf63
buf80 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12[
grid(512)](buf75, buf81, primals_36, primals_35, primals_37,
buf76, buf77, buf80, 512, 256, num_warps=2, num_stages=1)
del primals_35
del primals_36
del primals_37
buf82 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_8[grid(165888)](buf81, buf82,
165888, XBLOCK=512, num_warps=8, num_stages=1)
buf83 = extern_kernels.convolution(buf82, primals_38, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf83, (4, 128, 16, 16), (32768, 256, 16, 1))
buf84 = buf83
del buf83
buf87 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.
float32)
buf88 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf90 = reinterpret_tensor(buf88, (1, 512, 1, 1), (512, 1, 1, 1), 0)
del buf88
triton_per_fused__native_batch_norm_legit_convolution_9[grid(512)](
buf84, buf90, primals_39, buf87, 512, 256, num_warps=2,
num_stages=1)
del primals_39
buf85 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_40, buf85, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_40
buf86 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_41, buf86, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_41
buf91 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_relu_11[grid(165888)](buf84,
buf87, buf90, buf85, buf86, buf91, 165888, XBLOCK=1024,
num_warps=4, num_stages=1)
buf92 = extern_kernels.convolution(buf91, primals_42, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf92, (4, 128, 16, 16), (32768, 256, 16, 1))
buf94 = empty_strided_cuda((512,), (1,), torch.float32)
buf93 = buf92
del buf92
buf95 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf99 = buf81
del buf81
buf98 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
triton_per_fused__native_batch_norm_legit_add_convolution_repeat_12[
grid(512)](buf93, buf99, primals_44, primals_43, primals_45,
buf94, buf95, buf98, 512, 256, num_warps=2, num_stages=1)
del primals_43
del primals_44
del primals_45
buf100 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_8[grid(165888)](buf99, buf100,
165888, XBLOCK=512, num_warps=8, num_stages=1)
buf101 = extern_kernels.convolution(buf100, primals_46, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf101, (4, 128, 16, 16), (32768, 256, 16, 1))
buf102 = buf101
del buf101
buf105 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 1, 1), torch.
float32)
buf106 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf108 = reinterpret_tensor(buf106, (1, 512, 1, 1), (512, 1, 1, 1), 0)
del buf106
triton_per_fused__native_batch_norm_legit_convolution_9[grid(512)](
buf102, buf108, primals_47, buf105, 512, 256, num_warps=2,
num_stages=1)
del primals_47
buf103 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_48, buf103, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_48
buf104 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_49, buf104, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_49
buf109 = empty_strided_cuda((4, 128, 18, 18), (41472, 324, 18, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_relu_11[grid(165888)](buf102,
buf105, buf108, buf103, buf104, buf109, 165888, XBLOCK=1024,
num_warps=4, num_stages=1)
buf110 = extern_kernels.convolution(buf109, primals_50, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf110, (4, 128, 16, 16), (32768, 256, 16, 1))
buf111 = buf110
del buf110
buf113 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf114 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
buf116 = empty_strided_cuda((1, 512, 1, 1), (512, 1, 512, 512),
torch.float32)
triton_per_fused__native_batch_norm_legit_convolution_13[grid(512)](
buf111, primals_51, buf113, buf114, buf116, 512, 256, num_warps
=2, num_stages=1)
del primals_51
buf112 = empty_strided_cuda((512,), (1,), torch.float32)
triton_poi_fused_repeat_10[grid(512)](primals_52, buf112, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_52
buf117 = empty_strided_cuda((32,), (1,), torch.int64)
triton_poi_fused_arange_14[grid(32)](buf117, 32, XBLOCK=32,
num_warps=1, num_stages=1)
buf118 = empty_strided_cuda((32,), (1,), torch.int64)
triton_poi_fused__to_copy_add_arange_mul_15[grid(32)](buf118, 32,
XBLOCK=32, num_warps=1, num_stages=1)
buf119 = empty_strided_cuda((4, 128, 34, 34), (147968, 1156, 34, 1),
torch.float32)
triton_poi_fused__unsafe_index_add_reflection_pad2d_16[grid(591872)](
buf118, buf111, buf113, buf114, buf112, primals_53, buf99,
buf119, 591872, XBLOCK=512, num_warps=8, num_stages=1)
del buf114
del buf99
del primals_53
buf120 = extern_kernels.convolution(buf119, primals_54, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf120, (4, 64, 32, 32), (65536, 1024, 32, 1))
buf121 = buf120
del buf120
buf124 = empty_strided_cuda((1, 256, 1, 1), (256, 1, 1, 1), torch.
float32)
buf125 = empty_strided_cuda((1, 256, 1, 1), (256, 1, 256, 256),
torch.float32)
buf127 = reinterpret_tensor(buf125, (1, 256, 1, 1), (256, 1, 1, 1), 0)
del buf125
triton_per_fused__native_batch_norm_legit_convolution_4[grid(256)](
buf121, buf127, primals_55, buf124, 256, 1024, num_warps=8,
num_stages=1)
del primals_55
buf122 = empty_strided_cuda((256,), (1,), torch.float32)
triton_poi_fused_repeat_5[grid(256)](primals_56, buf122, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_56
buf123 = empty_strided_cuda((256,), (1,), torch.float32)
triton_poi_fused_repeat_5[grid(256)](primals_57, buf123, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_57
buf128 = empty_strided_cuda((64,), (1,), torch.int64)
triton_poi_fused_arange_17[grid(64)](buf128, 64, XBLOCK=64,
num_warps=1, num_stages=1)
buf129 = empty_strided_cuda((64,), (1,), torch.int64)
triton_poi_fused__to_copy_add_arange_mul_18[grid(64)](buf129, 64,
XBLOCK=64, num_warps=1, num_stages=1)
buf130 = empty_strided_cuda((4, 64, 66, 66), (278784, 4356, 66, 1),
torch.float32)
triton_poi_fused__unsafe_index_reflection_pad2d_relu_19[grid(1115136)](
buf129, buf121, buf124, buf127, buf122, buf123, buf130, 1115136,
XBLOCK=1024, num_warps=4, num_stages=1)
buf131 = extern_kernels.convolution(buf130, primals_58, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf131, (4, 32, 64, 64), (131072, 4096, 64, 1))
buf132 = buf131
del buf131
buf135 = empty_strided_cuda((1, 128, 1, 1), (128, 1, 1, 1), torch.
float32)
buf136 = empty_strided_cuda((1, 128, 1, 1), (128, 1, 128, 128),
torch.float32)
buf138 = reinterpret_tensor(buf136, (1, 128, 1, 1), (128, 1, 1, 1), 0)
del buf136
triton_red_fused__native_batch_norm_legit_convolution_1[grid(128)](
buf132, buf138, primals_59, buf135, 128, 4096, XBLOCK=1, RBLOCK
=2048, num_warps=16, num_stages=1)
del primals_59
buf133 = empty_strided_cuda((128,), (1,), torch.float32)
triton_poi_fused_repeat_2[grid(128)](primals_60, buf133, 128,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_60
buf134 = empty_strided_cuda((128,), (1,), torch.float32)
triton_poi_fused_repeat_2[grid(128)](primals_61, buf134, 128,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_61
buf139 = empty_strided_cuda((4, 32, 72, 72), (165888, 5184, 72, 1),
torch.float32)
triton_poi_fused_reflection_pad2d_relu_20[grid(663552)](buf132,
buf135, buf138, buf133, buf134, buf139, 663552, XBLOCK=1024,
num_warps=4, num_stages=1)
buf140 = extern_kernels.convolution(buf139, primals_62, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf140, (4, 3, 64, 64), (12288, 4096, 64, 1))
buf141 = buf140
del buf140
triton_poi_fused_convolution_21[grid(49152)](buf141, primals_63,
49152, XBLOCK=256, num_warps=4, num_stages=1)
del primals_63
return (buf141, primals_2, primals_6, primals_10, primals_14,
primals_18, primals_22, primals_26, primals_30, primals_34,
primals_38, primals_42, primals_46, primals_50, primals_54,
primals_58, primals_62, buf0, buf2, buf3, buf4, buf5, buf8, buf9,
buf11, buf12, buf13, buf14, buf17, buf18, buf20, buf21, buf22,
buf23, buf26, buf28, buf30, buf31, buf32, buf33, buf36, buf37,
buf39, buf40, reinterpret_tensor(buf44, (512,), (1,), 0), buf46,
buf48, buf49, buf50, buf51, buf54, buf55, buf57, buf58,
reinterpret_tensor(buf62, (512,), (1,), 0), buf64, buf66, buf67,
buf68, buf69, buf72, buf73, buf75, buf76, reinterpret_tensor(buf80,
(512,), (1,), 0), buf82, buf84, buf85, buf86, buf87, buf90, buf91,
buf93, buf94, reinterpret_tensor(buf98, (512,), (1,), 0), buf100,
buf102, buf103, buf104, buf105, buf108, buf109, buf111, buf112,
reinterpret_tensor(buf116, (512,), (1,), 0), buf117, buf118, buf119,
buf121, buf122, buf123, buf124, buf127, buf128, buf129, buf130,
buf132, buf133, buf134, buf135, buf138, buf139, reinterpret_tensor(
buf113, (1, 512, 1, 1), (512, 1, 1, 1), 0), reinterpret_tensor(
buf95, (1, 512, 1, 1), (512, 1, 1, 1), 0), reinterpret_tensor(buf77,
(1, 512, 1, 1), (512, 1, 1, 1), 0), reinterpret_tensor(buf59, (1,
512, 1, 1), (512, 1, 1, 1), 0), reinterpret_tensor(buf41, (1, 512,
1, 1), (512, 1, 1, 1), 0))
class ConvLayer(torch.nn.Module):
def __init__(self, in_channels, out_channels, kernel_size, stride):
super(ConvLayer, self).__init__()
reflection_padding = kernel_size // 2
self.reflection_pad = torch.nn.ReflectionPad2d(reflection_padding)
self.conv2d = torch.nn.Conv2d(in_channels, out_channels,
kernel_size, stride)
def forward(self, x):
out = self.reflection_pad(x)
out = self.conv2d(out)
return out
class ResidualBlock(torch.nn.Module):
"""ResidualBlock
introduced in: https://arxiv.org/abs/1512.03385
recommended architecture: http://torch.ch/blog/2016/02/04/resnets.html
"""
def __init__(self, channels):
super(ResidualBlock, self).__init__()
self.conv1 = ConvLayer(channels, channels, kernel_size=3, stride=1)
self.in1 = torch.nn.InstanceNorm2d(channels, affine=True)
self.conv2 = ConvLayer(channels, channels, kernel_size=3, stride=1)
self.in2 = torch.nn.InstanceNorm2d(channels, affine=True)
self.relu = torch.nn.ReLU()
def forward(self, x):
residual = x
out = self.relu(self.in1(self.conv1(x)))
out = self.in2(self.conv2(out))
out = out + residual
return out
class UpsampleConvLayer(torch.nn.Module):
"""UpsampleConvLayer
Upsamples the input and then does a convolution. This method gives better results
compared to ConvTranspose2d.
ref: http://distill.pub/2016/deconv-checkerboard/
"""
def __init__(self, in_channels, out_channels, kernel_size, stride,
upsample=None):
super(UpsampleConvLayer, self).__init__()
self.upsample = upsample
if upsample:
self.upsample_layer = torch.nn.Upsample(mode='nearest',
scale_factor=upsample)
reflection_padding = kernel_size // 2
self.reflection_pad = torch.nn.ReflectionPad2d(reflection_padding)
self.conv2d = torch.nn.Conv2d(in_channels, out_channels,
kernel_size, stride)
def forward(self, x):
x_in = x
if self.upsample:
x_in = self.upsample_layer(x_in)
out = self.reflection_pad(x_in)
out = self.conv2d(out)
return out
class TransformerNetNew(torch.nn.Module):
def __init__(self):
super(TransformerNetNew, self).__init__()
self.conv1 = ConvLayer(3, 32, kernel_size=9, stride=1)
self.in1 = torch.nn.InstanceNorm2d(32, affine=True)
self.conv2 = ConvLayer(32, 64, kernel_size=3, stride=2)
self.in2 = torch.nn.InstanceNorm2d(64, affine=True)
self.conv3 = ConvLayer(64, 128, kernel_size=3, stride=2)
self.in3 = torch.nn.InstanceNorm2d(128, affine=True)
self.res1 = ResidualBlock(128)
self.res2 = ResidualBlock(128)
self.res3 = ResidualBlock(128)
self.res4 = ResidualBlock(128)
self.res5 = ResidualBlock(128)
self.deconv1 = UpsampleConvLayer(128, 64, kernel_size=3, stride=1,
upsample=2)
self.in4 = torch.nn.InstanceNorm2d(64, affine=True)
self.deconv2 = UpsampleConvLayer(64, 32, kernel_size=3, stride=1,
upsample=2)
self.in5 = torch.nn.InstanceNorm2d(32, affine=True)
self.deconv3 = ConvLayer(32, 3, kernel_size=9, stride=1)
self.relu = torch.nn.ReLU()
def forward(self, input_0):
primals_2 = self.conv1.conv2d.weight
primals_3 = self.conv1.conv2d.bias
primals_4 = self.in1.weight
primals_5 = self.in1.bias
primals_6 = self.conv2.conv2d.weight
primals_7 = self.conv2.conv2d.bias
primals_8 = self.in2.weight
primals_9 = self.in2.bias
primals_10 = self.conv3.conv2d.weight
primals_11 = self.conv3.conv2d.bias
primals_12 = self.in3.weight
primals_13 = self.in3.bias
primals_14 = self.res1.conv1.conv2d.weight
primals_15 = self.res1.conv1.conv2d.bias
primals_16 = self.res1.in1.weight
primals_17 = self.res1.in1.bias
primals_18 = self.res1.conv2.conv2d.weight
primals_19 = self.res1.conv2.conv2d.bias
primals_20 = self.res1.in2.weight
primals_21 = self.res1.in2.bias
primals_22 = self.res2.conv1.conv2d.weight
primals_23 = self.res2.conv1.conv2d.bias
primals_24 = self.res2.in1.weight
primals_25 = self.res2.in1.bias
primals_26 = self.res2.conv2.conv2d.weight
primals_27 = self.res2.conv2.conv2d.bias
primals_28 = self.res2.in2.weight
primals_29 = self.res2.in2.bias
primals_30 = self.res3.conv1.conv2d.weight
primals_31 = self.res3.conv1.conv2d.bias
primals_32 = self.res3.in1.weight
primals_33 = self.res3.in1.bias
primals_34 = self.res3.conv2.conv2d.weight
primals_35 = self.res3.conv2.conv2d.bias
primals_36 = self.res3.in2.weight
primals_37 = self.res3.in2.bias
primals_38 = self.res4.conv1.conv2d.weight
primals_39 = self.res4.conv1.conv2d.bias
primals_40 = self.res4.in1.weight
primals_41 = self.res4.in1.bias
primals_42 = self.res4.conv2.conv2d.weight
primals_43 = self.res4.conv2.conv2d.bias
primals_44 = self.res4.in2.weight
primals_45 = self.res4.in2.bias
primals_46 = self.res5.conv1.conv2d.weight
primals_47 = self.res5.conv1.conv2d.bias
primals_48 = self.res5.in1.weight
primals_49 = self.res5.in1.bias
primals_50 = self.res5.conv2.conv2d.weight
primals_51 = self.res5.conv2.conv2d.bias
primals_52 = self.res5.in2.weight
primals_53 = self.res5.in2.bias
primals_54 = self.deconv1.conv2d.weight
primals_55 = self.deconv1.conv2d.bias
primals_56 = self.in4.weight
primals_57 = self.in4.bias
primals_58 = self.deconv2.conv2d.weight
primals_59 = self.deconv2.conv2d.bias
primals_60 = self.in5.weight
primals_61 = self.in5.bias
primals_62 = self.deconv3.conv2d.weight
primals_63 = self.deconv3.conv2d.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11, primals_12, primals_13, primals_14,
primals_15, primals_16, primals_17, primals_18, primals_19,
primals_20, primals_21, primals_22, primals_23, primals_24,
primals_25, primals_26, primals_27, primals_28, primals_29,
primals_30, primals_31, primals_32, primals_33, primals_34,
primals_35, primals_36, primals_37, primals_38, primals_39,
primals_40, primals_41, primals_42, primals_43, primals_44,
primals_45, primals_46, primals_47, primals_48, primals_49,
primals_50, primals_51, primals_52, primals_53, primals_54,
primals_55, primals_56, primals_57, primals_58, primals_59,
primals_60, primals_61, primals_62, primals_63])
return output[0]
|
Ali-ry/azureml-examples
|
TransformerNet
| false | 2,058 |
[
"MIT"
] | 0 |
817ae89d2766dcafd70937a22cb3a80f100a2906
|
https://github.com/Ali-ry/azureml-examples/tree/817ae89d2766dcafd70937a22cb3a80f100a2906
|
DenseGCNConv
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ia/ciadpx4ik7ocmsqscox73ya2qxek7ekkw25w6rijleysqp7lfliw.py
# Topologically Sorted Source Nodes: [setitem], Original ATen: [aten.lift_fresh, aten.index_put]
# Source node to ATen node mapping:
# setitem => full_default, index_put
# Graph fragment:
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], 1.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %index_put : [num_users=2] = call_function[target=torch.ops.aten.index_put.default](args = (%primals_2, [None, %iota, %iota], %full_default), kwargs = {})
triton_poi_fused_index_put_lift_fresh_0 = async_compile.triton('triton_poi_fused_index_put_lift_fresh_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_index_put_lift_fresh_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_index_put_lift_fresh_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/3a/c3ajks6gn2yuzdnbqm5gdhl6nslpowgffuevr4gjguhn4q6d6v4b.py
# Topologically Sorted Source Nodes: [setitem], Original ATen: [aten.lift_fresh, aten.index_put]
# Source node to ATen node mapping:
# setitem => full_default, index_put
# Graph fragment:
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], 1.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %index_put : [num_users=2] = call_function[target=torch.ops.aten.index_put.default](args = (%primals_2, [None, %iota, %iota], %full_default), kwargs = {})
triton_poi_fused_index_put_lift_fresh_1 = async_compile.triton('triton_poi_fused_index_put_lift_fresh_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_index_put_lift_fresh_1', 'mutated_arg_names': ['out_ptr0'], 'no_x_dim': False, 'num_load': 0, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_index_put_lift_fresh_1(out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = (xindex // 4)
tmp0 = 1.0
tl.store(out_ptr0 + ((5*x0) + (16*x1)), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/by/cbyfwvqabdnuhk62vp6oux4o4uoccm6mz5rjytdtikttvdu3mbex.py
# Topologically Sorted Source Nodes: [mul, adj_1], Original ATen: [aten.mul]
# Source node to ATen node mapping:
# adj_1 => mul_1
# mul => mul
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%unsqueeze, %index_put), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul, %unsqueeze_1), kwargs = {})
triton_poi_fused_mul_2 = async_compile.triton('triton_poi_fused_mul_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mul_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 9, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mul_2(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = (xindex // 4)
x4 = xindex
x0 = xindex % 4
x2 = (xindex // 16)
tmp0 = tl.load(in_ptr0 + (4*x3), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + (4*x3)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (2 + (4*x3)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (3 + (4*x3)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (x4), xmask)
tmp13 = tl.load(in_ptr0 + ((4*x0) + (16*x2)), xmask, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr0 + (1 + (4*x0) + (16*x2)), xmask, eviction_policy='evict_last')
tmp16 = tl.load(in_ptr0 + (2 + (4*x0) + (16*x2)), xmask, eviction_policy='evict_last')
tmp18 = tl.load(in_ptr0 + (3 + (4*x0) + (16*x2)), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 1.0
tmp8 = triton_helpers.maximum(tmp6, tmp7)
tmp9 = -0.5
tmp10 = libdevice.pow(tmp8, tmp9)
tmp12 = tmp10 * tmp11
tmp15 = tmp13 + tmp14
tmp17 = tmp15 + tmp16
tmp19 = tmp17 + tmp18
tmp20 = triton_helpers.maximum(tmp19, tmp7)
tmp21 = libdevice.pow(tmp20, tmp9)
tmp22 = tmp12 * tmp21
tl.store(out_ptr0 + (x4), tmp22, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/kl/ckllf6mazqhprwh2tau7vxrdurc2kivba4tykq3gqxvebmdet63s.py
# Topologically Sorted Source Nodes: [out_1], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# out_1 => clone_1
# Graph fragment:
# %clone_1 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%expand,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_3 = async_compile.triton('triton_poi_fused_clone_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_3(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 64
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x2), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/5a/c5ainvzw5uinosmtjpfsqml2wdleittg5twoainmhbtwdqayr4sw.py
# Topologically Sorted Source Nodes: [out_2], Original ATen: [aten.add]
# Source node to ATen node mapping:
# out_2 => add
# Graph fragment:
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_4, %primals_4), kwargs = {})
triton_poi_fused_add_4 = async_compile.triton('triton_poi_fused_add_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_4', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_4(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x2), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_3, (4, 4), (4, 1))
assert_size_stride(primals_4, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [setitem], Original ATen: [aten.lift_fresh, aten.index_put]
stream0 = get_raw_stream(0)
triton_poi_fused_index_put_lift_fresh_0.run(primals_2, buf0, 64, grid=grid(64), stream=stream0)
del primals_2
# Topologically Sorted Source Nodes: [setitem], Original ATen: [aten.lift_fresh, aten.index_put]
triton_poi_fused_index_put_lift_fresh_1.run(buf0, 16, grid=grid(16), stream=stream0)
buf2 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.mm]
extern_kernels.mm(reinterpret_tensor(primals_1, (64, 4), (4, 1), 0), primals_3, out=buf2)
del primals_3
buf3 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [mul, adj_1], Original ATen: [aten.mul]
triton_poi_fused_mul_2.run(buf0, buf3, 64, grid=grid(64), stream=stream0)
del buf0
buf4 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_1], Original ATen: [aten.clone]
triton_poi_fused_clone_3.run(buf3, buf4, 256, grid=grid(256), stream=stream0)
del buf3
buf5 = empty_strided_cuda((16, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_1], Original ATen: [aten.bmm]
extern_kernels.bmm(reinterpret_tensor(buf4, (16, 4, 4), (16, 4, 1), 0), reinterpret_tensor(buf2, (16, 4, 4), (16, 4, 1), 0), out=buf5)
del buf2
buf6 = reinterpret_tensor(buf5, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf5 # reuse
# Topologically Sorted Source Nodes: [out_2], Original ATen: [aten.add]
triton_poi_fused_add_4.run(buf6, primals_4, 256, grid=grid(256), stream=stream0)
del primals_4
return (buf6, reinterpret_tensor(buf4, (16, 4, 4), (16, 1, 4), 0), reinterpret_tensor(primals_1, (4, 64), (1, 4), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import math
import torch
from torch.nn import Parameter
import torch.utils.data
def glorot(tensor):
if tensor is not None:
stdv = math.sqrt(6.0 / (tensor.size(-2) + tensor.size(-1)))
tensor.data.uniform_(-stdv, stdv)
def zeros(tensor):
if tensor is not None:
tensor.data.fill_(0)
class DenseGCNConv(torch.nn.Module):
"""See :class:`torch_geometric.nn.conv.GCNConv`.
"""
def __init__(self, in_channels, out_channels, improved=False, bias=True):
super(DenseGCNConv, self).__init__()
self.in_channels = in_channels
self.out_channels = out_channels
self.improved = improved
self.weight = Parameter(torch.Tensor(self.in_channels, out_channels))
if bias:
self.bias = Parameter(torch.Tensor(out_channels))
else:
self.register_parameter('bias', None)
self.reset_parameters()
def reset_parameters(self):
glorot(self.weight)
zeros(self.bias)
def forward(self, x, adj, mask=None, add_loop=True):
"""
Args:
x (Tensor): Node feature tensor :math:`\\mathbf{X} \\in \\mathbb{R}^{B
\\times N \\times F}`, with batch-size :math:`B`, (maximum)
number of nodes :math:`N` for each graph, and feature
dimension :math:`F`.
adj (Tensor): Adjacency tensor :math:`\\mathbf{A} \\in \\mathbb{R}^{B
\\times N \\times N}`. The adjacency tensor is broadcastable in
the batch dimension, resulting in a shared adjacency matrix for
the complete batch.
mask (BoolTensor, optional): Mask matrix
:math:`\\mathbf{M} \\in {\\{ 0, 1 \\}}^{B \\times N}` indicating
the valid nodes for each graph. (default: :obj:`None`)
add_loop (bool, optional): If set to :obj:`False`, the layer will
not automatically add self-loops to the adjacency matrices.
(default: :obj:`True`)
"""
x = x.unsqueeze(0) if x.dim() == 2 else x
adj = adj.unsqueeze(0) if adj.dim() == 2 else adj
B, N, _ = adj.size()
if add_loop:
adj = adj.clone()
idx = torch.arange(N, dtype=torch.long, device=adj.device)
adj[:, idx, idx] = 1 if not self.improved else 2
out = torch.matmul(x, self.weight)
deg_inv_sqrt = adj.sum(dim=-1).clamp(min=1).pow(-0.5)
adj = deg_inv_sqrt.unsqueeze(-1) * adj * deg_inv_sqrt.unsqueeze(-2)
out = torch.matmul(adj, out)
if self.bias is not None:
out = out + self.bias
if mask is not None:
out = out * mask.view(B, N, 1)
return out
def __repr__(self):
return '{}({}, {})'.format(self.__class__.__name__, self.
in_channels, self.out_channels)
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'in_channels': 4, 'out_channels': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice
import math
from torch.nn import Parameter
import torch.utils.data
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_index_put_lift_fresh_0(in_ptr0, out_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tl.store(out_ptr0 + x0, tmp0, xmask)
@triton.jit
def triton_poi_fused_index_put_lift_fresh_1(out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = xindex // 4
tmp0 = 1.0
tl.store(out_ptr0 + (5 * x0 + 16 * x1), tmp0, xmask)
@triton.jit
def triton_poi_fused_mul_2(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex // 4
x4 = xindex
x0 = xindex % 4
x2 = xindex // 16
tmp0 = tl.load(in_ptr0 + 4 * x3, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + 4 * x3), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (2 + 4 * x3), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (3 + 4 * x3), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + x4, xmask)
tmp13 = tl.load(in_ptr0 + (4 * x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp14 = tl.load(in_ptr0 + (1 + 4 * x0 + 16 * x2), xmask,
eviction_policy='evict_last')
tmp16 = tl.load(in_ptr0 + (2 + 4 * x0 + 16 * x2), xmask,
eviction_policy='evict_last')
tmp18 = tl.load(in_ptr0 + (3 + 4 * x0 + 16 * x2), xmask,
eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 1.0
tmp8 = triton_helpers.maximum(tmp6, tmp7)
tmp9 = -0.5
tmp10 = libdevice.pow(tmp8, tmp9)
tmp12 = tmp10 * tmp11
tmp15 = tmp13 + tmp14
tmp17 = tmp15 + tmp16
tmp19 = tmp17 + tmp18
tmp20 = triton_helpers.maximum(tmp19, tmp7)
tmp21 = libdevice.pow(tmp20, tmp9)
tmp22 = tmp12 * tmp21
tl.store(out_ptr0 + x4, tmp22, xmask)
@triton.jit
def triton_poi_fused_clone_3(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 64
x2 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tl.store(out_ptr0 + x2, tmp0, xmask)
@triton.jit
def triton_poi_fused_add_4(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x2, tmp2, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_3, (4, 4), (4, 1))
assert_size_stride(primals_4, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_index_put_lift_fresh_0[grid(64)](primals_2, buf0,
64, XBLOCK=64, num_warps=1, num_stages=1)
del primals_2
triton_poi_fused_index_put_lift_fresh_1[grid(16)](buf0, 16, XBLOCK=
16, num_warps=1, num_stages=1)
buf2 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_1, (64, 4), (4, 1), 0),
primals_3, out=buf2)
del primals_3
buf3 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
triton_poi_fused_mul_2[grid(64)](buf0, buf3, 64, XBLOCK=64,
num_warps=1, num_stages=1)
del buf0
buf4 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_clone_3[grid(256)](buf3, buf4, 256, XBLOCK=256,
num_warps=4, num_stages=1)
del buf3
buf5 = empty_strided_cuda((16, 4, 4), (16, 4, 1), torch.float32)
extern_kernels.bmm(reinterpret_tensor(buf4, (16, 4, 4), (16, 4, 1),
0), reinterpret_tensor(buf2, (16, 4, 4), (16, 4, 1), 0), out=buf5)
del buf2
buf6 = reinterpret_tensor(buf5, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf5
triton_poi_fused_add_4[grid(256)](buf6, primals_4, 256, XBLOCK=256,
num_warps=4, num_stages=1)
del primals_4
return buf6, reinterpret_tensor(buf4, (16, 4, 4), (16, 1, 4), 0
), reinterpret_tensor(primals_1, (4, 64), (1, 4), 0)
def glorot(tensor):
if tensor is not None:
stdv = math.sqrt(6.0 / (tensor.size(-2) + tensor.size(-1)))
tensor.data.uniform_(-stdv, stdv)
def zeros(tensor):
if tensor is not None:
tensor.data.fill_(0)
class DenseGCNConvNew(torch.nn.Module):
"""See :class:`torch_geometric.nn.conv.GCNConv`.
"""
def __init__(self, in_channels, out_channels, improved=False, bias=True):
super(DenseGCNConvNew, self).__init__()
self.in_channels = in_channels
self.out_channels = out_channels
self.improved = improved
self.weight = Parameter(torch.Tensor(self.in_channels, out_channels))
if bias:
self.bias = Parameter(torch.Tensor(out_channels))
else:
self.register_parameter('bias', None)
self.reset_parameters()
def reset_parameters(self):
glorot(self.weight)
zeros(self.bias)
def __repr__(self):
return '{}({}, {})'.format(self.__class__.__name__, self.
in_channels, self.out_channels)
def forward(self, input_0, input_1):
primals_3 = self.weight
primals_4 = self.bias
primals_1 = input_0
primals_2 = input_1
output = call([primals_1, primals_2, primals_3, primals_4])
return output[0]
|
CFF-Dream/pytorch_geometric
|
DenseGCNConv
| false | 2,059 |
[
"MIT"
] | 0 |
7c19ad74957409ee9e07314ce81524b3113b9c84
|
https://github.com/CFF-Dream/pytorch_geometric/tree/7c19ad74957409ee9e07314ce81524b3113b9c84
|
AsymmetricLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ga/cga4e74tld64owyz36xxkvzsnmfuphjsiuzgznmo7gpta3vrpnf7.py
# Topologically Sorted Source Nodes: [pred_sigmoid, sub, add, clamp, sub_1, mul, mul_1, pt, clamp_1, log, neg, sub_2, mul_2, sub_3, mul_3, add_2, asymmetric_weight, loss, loss_1, loss_cls], Original ATen: [aten.sigmoid, aten.rsub, aten.add, aten.clamp, aten.mul, aten.log, aten.neg, aten.pow, aten.mean]
# Source node to ATen node mapping:
# add => add
# add_2 => add_2
# asymmetric_weight => pow_1
# clamp => clamp_max
# clamp_1 => clamp_min
# log => log
# loss => mul_4
# loss_1 => mean
# loss_cls => mul_5
# mul => mul
# mul_1 => mul_1
# mul_2 => mul_2
# mul_3 => mul_3
# neg => neg
# pred_sigmoid => sigmoid
# pt => add_1
# sub => sub
# sub_1 => sub_1
# sub_2 => sub_2
# sub_3 => sub_3
# Graph fragment:
# %sigmoid : [num_users=2] = call_function[target=torch.ops.aten.sigmoid.default](args = (%arg0_1,), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %sigmoid), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sub, 0.05), kwargs = {})
# %clamp_max : [num_users=1] = call_function[target=torch.ops.aten.clamp_max.default](args = (%add, 1), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg1_1), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%clamp_max, %sub_1), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sigmoid, %arg1_1), kwargs = {})
# %add_1 : [num_users=2] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, %mul_1), kwargs = {})
# %clamp_min : [num_users=1] = call_function[target=torch.ops.aten.clamp_min.default](args = (%add_1, 1e-08), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%clamp_min,), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%log,), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %add_1), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg1_1, 0.0), kwargs = {})
# %sub_3 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg1_1), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub_3, 4.0), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_2, %mul_3), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Tensor](args = (%sub_2, %add_2), kwargs = {})
# %mul_4 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%neg, %pow_1), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%mul_4,), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_add_clamp_log_mean_mul_neg_pow_rsub_sigmoid_0 = async_compile.triton('triton_per_fused_add_clamp_log_mean_mul_neg_pow_rsub_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_clamp_log_mean_mul_neg_pow_rsub_sigmoid_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_clamp_log_mean_mul_neg_pow_rsub_sigmoid_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp7 = tl.load(in_ptr1 + (r0), None)
tmp1 = tl.sigmoid(tmp0)
tmp2 = 1.0
tmp3 = tmp2 - tmp1
tmp4 = 0.05
tmp5 = tmp3 + tmp4
tmp6 = triton_helpers.minimum(tmp5, tmp2)
tmp8 = tmp2 - tmp7
tmp9 = tmp6 * tmp8
tmp10 = tmp1 * tmp7
tmp11 = tmp9 + tmp10
tmp12 = 1e-08
tmp13 = triton_helpers.maximum(tmp11, tmp12)
tmp14 = tl_math.log(tmp13)
tmp15 = -tmp14
tmp16 = tmp2 - tmp11
tmp17 = 0.0
tmp18 = tmp7 * tmp17
tmp19 = 4.0
tmp20 = tmp8 * tmp19
tmp21 = tmp18 + tmp20
tmp22 = libdevice.pow(tmp16, tmp21)
tmp23 = tmp15 * tmp22
tmp24 = tl.broadcast_to(tmp23, [RBLOCK])
tmp26 = triton_helpers.promote_to_tensor(tl.sum(tmp24, 0))
tmp27 = 256.0
tmp28 = tmp26 / tmp27
tmp29 = tmp28 * tmp2
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp29, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [pred_sigmoid, sub, add, clamp, sub_1, mul, mul_1, pt, clamp_1, log, neg, sub_2, mul_2, sub_3, mul_3, add_2, asymmetric_weight, loss, loss_1, loss_cls], Original ATen: [aten.sigmoid, aten.rsub, aten.add, aten.clamp, aten.mul, aten.log, aten.neg, aten.pow, aten.mean]
stream0 = get_raw_stream(0)
triton_per_fused_add_clamp_log_mean_mul_neg_pow_rsub_sigmoid_0.run(buf1, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Average factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def asymmetric_loss(pred, target, weight=None, gamma_pos=1.0, gamma_neg=4.0,
clip=0.05, reduction='mean', avg_factor=None):
"""asymmetric loss.
Please refer to the `paper <https://arxiv.org/abs/2009.14119>`__ for
details.
Args:
pred (torch.Tensor): The prediction with shape (N, \\*).
target (torch.Tensor): The ground truth label of the prediction with
shape (N, \\*).
weight (torch.Tensor, optional): Sample-wise loss weight with shape
(N, ). Defaults to None.
gamma_pos (float): positive focusing parameter. Defaults to 0.0.
gamma_neg (float): Negative focusing parameter. We usually set
gamma_neg > gamma_pos. Defaults to 4.0.
clip (float, optional): Probability margin. Defaults to 0.05.
reduction (str): The method used to reduce the loss.
Options are "none", "mean" and "sum". If reduction is 'none' , loss
is same shape as pred and label. Defaults to 'mean'.
avg_factor (int, optional): Average factor that is used to average
the loss. Defaults to None.
Returns:
torch.Tensor: Loss.
"""
assert pred.shape == target.shape, 'pred and target should be in the same shape.'
eps = 1e-08
pred_sigmoid = pred.sigmoid()
target = target.type_as(pred)
if clip and clip > 0:
pt = (1 - pred_sigmoid + clip).clamp(max=1) * (1 - target
) + pred_sigmoid * target
else:
pt = (1 - pred_sigmoid) * (1 - target) + pred_sigmoid * target
asymmetric_weight = (1 - pt).pow(gamma_pos * target + gamma_neg * (1 -
target))
loss = -torch.log(pt.clamp(min=eps)) * asymmetric_weight
if weight is not None:
assert weight.dim() == 1
weight = weight.float()
if pred.dim() > 1:
weight = weight.reshape(-1, 1)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
class AsymmetricLoss(nn.Module):
"""asymmetric loss.
Args:
gamma_pos (float): positive focusing parameter.
Defaults to 0.0.
gamma_neg (float): Negative focusing parameter. We
usually set gamma_neg > gamma_pos. Defaults to 4.0.
clip (float, optional): Probability margin. Defaults to 0.05.
reduction (str): The method used to reduce the loss into
a scalar.
loss_weight (float): Weight of loss. Defaults to 1.0.
"""
def __init__(self, gamma_pos=0.0, gamma_neg=4.0, clip=0.05, reduction=
'mean', loss_weight=1.0):
super(AsymmetricLoss, self).__init__()
self.gamma_pos = gamma_pos
self.gamma_neg = gamma_neg
self.clip = clip
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, pred, target, weight=None, avg_factor=None,
reduction_override=None):
"""asymmetric loss."""
assert reduction_override in (None, 'none', 'mean', 'sum')
reduction = (reduction_override if reduction_override else self.
reduction)
loss_cls = self.loss_weight * asymmetric_loss(pred, target, weight,
gamma_pos=self.gamma_pos, gamma_neg=self.gamma_neg, clip=self.
clip, reduction=reduction, avg_factor=avg_factor)
return loss_cls
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_clamp_log_mean_mul_neg_pow_rsub_sigmoid_0(in_out_ptr0,
in_ptr0, in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp7 = tl.load(in_ptr1 + r0, None)
tmp1 = tl.sigmoid(tmp0)
tmp2 = 1.0
tmp3 = tmp2 - tmp1
tmp4 = 0.05
tmp5 = tmp3 + tmp4
tmp6 = triton_helpers.minimum(tmp5, tmp2)
tmp8 = tmp2 - tmp7
tmp9 = tmp6 * tmp8
tmp10 = tmp1 * tmp7
tmp11 = tmp9 + tmp10
tmp12 = 1e-08
tmp13 = triton_helpers.maximum(tmp11, tmp12)
tmp14 = tl_math.log(tmp13)
tmp15 = -tmp14
tmp16 = tmp2 - tmp11
tmp17 = 0.0
tmp18 = tmp7 * tmp17
tmp19 = 4.0
tmp20 = tmp8 * tmp19
tmp21 = tmp18 + tmp20
tmp22 = libdevice.pow(tmp16, tmp21)
tmp23 = tmp15 * tmp22
tmp24 = tl.broadcast_to(tmp23, [RBLOCK])
tmp26 = triton_helpers.promote_to_tensor(tl.sum(tmp24, 0))
tmp27 = 256.0
tmp28 = tmp26 / tmp27
tmp29 = tmp28 * tmp2
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp29, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_add_clamp_log_mean_mul_neg_pow_rsub_sigmoid_0[grid(1)
](buf1, arg0_1, arg1_1, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Average factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def asymmetric_loss(pred, target, weight=None, gamma_pos=1.0, gamma_neg=4.0,
clip=0.05, reduction='mean', avg_factor=None):
"""asymmetric loss.
Please refer to the `paper <https://arxiv.org/abs/2009.14119>`__ for
details.
Args:
pred (torch.Tensor): The prediction with shape (N, \\*).
target (torch.Tensor): The ground truth label of the prediction with
shape (N, \\*).
weight (torch.Tensor, optional): Sample-wise loss weight with shape
(N, ). Defaults to None.
gamma_pos (float): positive focusing parameter. Defaults to 0.0.
gamma_neg (float): Negative focusing parameter. We usually set
gamma_neg > gamma_pos. Defaults to 4.0.
clip (float, optional): Probability margin. Defaults to 0.05.
reduction (str): The method used to reduce the loss.
Options are "none", "mean" and "sum". If reduction is 'none' , loss
is same shape as pred and label. Defaults to 'mean'.
avg_factor (int, optional): Average factor that is used to average
the loss. Defaults to None.
Returns:
torch.Tensor: Loss.
"""
assert pred.shape == target.shape, 'pred and target should be in the same shape.'
eps = 1e-08
pred_sigmoid = pred.sigmoid()
target = target.type_as(pred)
if clip and clip > 0:
pt = (1 - pred_sigmoid + clip).clamp(max=1) * (1 - target
) + pred_sigmoid * target
else:
pt = (1 - pred_sigmoid) * (1 - target) + pred_sigmoid * target
asymmetric_weight = (1 - pt).pow(gamma_pos * target + gamma_neg * (1 -
target))
loss = -torch.log(pt.clamp(min=eps)) * asymmetric_weight
if weight is not None:
assert weight.dim() == 1
weight = weight.float()
if pred.dim() > 1:
weight = weight.reshape(-1, 1)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
class AsymmetricLossNew(nn.Module):
"""asymmetric loss.
Args:
gamma_pos (float): positive focusing parameter.
Defaults to 0.0.
gamma_neg (float): Negative focusing parameter. We
usually set gamma_neg > gamma_pos. Defaults to 4.0.
clip (float, optional): Probability margin. Defaults to 0.05.
reduction (str): The method used to reduce the loss into
a scalar.
loss_weight (float): Weight of loss. Defaults to 1.0.
"""
def __init__(self, gamma_pos=0.0, gamma_neg=4.0, clip=0.05, reduction=
'mean', loss_weight=1.0):
super(AsymmetricLossNew, self).__init__()
self.gamma_pos = gamma_pos
self.gamma_neg = gamma_neg
self.clip = clip
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
CAMP-eXplain-AI/imba-explain
|
AsymmetricLoss
| false | 2,060 |
[
"MIT"
] | 0 |
e41b4ca5de63955cb0e925aad9599f38c5a3e973
|
https://github.com/CAMP-eXplain-AI/imba-explain/tree/e41b4ca5de63955cb0e925aad9599f38c5a3e973
|
ConvBlockLNEDense
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/d5/cd5m3j5auxbszyzvbqqxqrtrkrxq26jxju4ar5ny6zgmqowfs5hg.py
# Topologically Sorted Source Nodes: [pad], Original ATen: [aten.copy]
# Source node to ATen node mapping:
# pad => copy
# Graph fragment:
# %copy : [num_users=1] = call_function[target=torch.ops.aten.copy.default](args = (%slice_3, %slice_4), kwargs = {})
# %slice_scatter_default : [num_users=1] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_tensor, %copy, 2, 1, 5), kwargs = {})
# %slice_scatter_default_1 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%empty, %slice_scatter_default, 3, 1, 5), kwargs = {})
# %slice_scatter_default_2 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_1, %slice_11, 3, 0, 1), kwargs = {})
# %slice_scatter_default_3 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_2, %slice_16, 3, 5, 6), kwargs = {})
triton_poi_fused_copy_0 = async_compile.triton('triton_poi_fused_copy_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_copy_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_copy_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 576
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = (xindex // 6) % 6
x2 = (xindex // 36)
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp15 & xmask, other=0.0)
tmp17 = tl.load(in_ptr1 + (x4), tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float("nan")
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + ((-9) + x0 + (4*x1) + (16*x2)), tmp29 & xmask, other=0.0)
tmp31 = tl.load(in_ptr1 + ((-4) + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + ((-1) + x0 + (4*x1) + (16*x2)), tmp45 & xmask, other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp54 & xmask, other=0.0)
tmp56 = tl.load(in_ptr1 + (x4), tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + (x4), tmp62, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/w6/cw6our4iotwhi2wfr4hvczz23dzsphqyor2wfejso3djq53u3bto.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %slice_scatter_default_4 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_3, %slice_21, 2, 0, 1), kwargs = {})
# %slice_scatter_default_5 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_4, %slice_26, 2, 5, 6), kwargs = {})
triton_poi_fused_1 = async_compile.triton('triton_poi_fused_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 576
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 6) % 6
x0 = xindex % 6
x2 = (xindex // 36)
x3 = xindex
tmp14 = tl.load(in_ptr0 + (x3), xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + ((-24) + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp12 & xmask, eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/li/clirks7ygq36zaaurqxwkjeghv3dqhimkwjq5ysyv5assqq5etti.py
# Topologically Sorted Source Nodes: [x1, x1_2, x3, x4], Original ATen: [aten.convolution, aten.native_group_norm, aten.cat]
# Source node to ATen node mapping:
# x1 => convolution
# x1_2 => add, add_1, mul_1, rsqrt, var_mean
# x3 => cat_1
# x4 => cat_2
# Graph fragment:
# %convolution : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%slice_scatter_default_5, %primals_1, %primals_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %var_mean : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view, [2, 3]), kwargs = {correction: 0, keepdim: True})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem, 1e-05), kwargs = {})
# %rsqrt : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_1, %unsqueeze_5), kwargs = {})
# %add_1 : [num_users=3] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, %unsqueeze_2), kwargs = {})
# %cat_1 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%add_3, %add_1, %primals_3], 1), kwargs = {})
# %cat_2 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%add_5, %add_3, %add_1, %primals_3], 1), kwargs = {})
triton_per_fused_cat_convolution_native_group_norm_2 = async_compile.triton('triton_per_fused_cat_convolution_native_group_norm_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[4, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: '*fp32', 9: 'i32', 10: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8, 10), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_cat_convolution_native_group_norm_2', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_cat_convolution_native_group_norm_2(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr2, out_ptr3, out_ptr4, out_ptr5, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 4
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r3 = rindex
x0 = xindex
r2 = (rindex // 16)
tmp0 = tl.load(in_out_ptr0 + (r3 + (64*x0)), xmask, other=0.0)
tmp1 = tl.load(in_ptr0 + (r2), None, eviction_policy='evict_last')
tmp28 = tl.load(in_ptr1 + (r2), None, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + (r2), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1, 1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = tl.broadcast_to(tmp4, [XBLOCK, RBLOCK])
tmp7 = tl.where(xmask, tmp5, 0)
tmp8 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp10 = tl.where(xmask, tmp8, 0)
tmp11 = tl.sum(tmp10, 1)[:, None]
tmp12 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp13 = tmp12.to(tl.float32)
tmp14 = tmp11 / tmp13
tmp15 = tmp5 - tmp14
tmp16 = tmp15 * tmp15
tmp17 = tl.broadcast_to(tmp16, [XBLOCK, RBLOCK])
tmp19 = tl.where(xmask, tmp17, 0)
tmp20 = tl.sum(tmp19, 1)[:, None]
tmp21 = tmp4 - tmp14
tmp22 = 64.0
tmp23 = tmp20 / tmp22
tmp24 = 1e-05
tmp25 = tmp23 + tmp24
tmp26 = libdevice.rsqrt(tmp25)
tmp27 = tmp21 * tmp26
tmp29 = tmp27 * tmp28
tmp31 = tmp29 + tmp30
tl.store(in_out_ptr0 + (r3 + (64*x0)), tmp2, xmask)
tl.store(out_ptr2 + (r3 + (128*x0)), tmp31, xmask)
tl.store(out_ptr3 + (r3 + (192*x0)), tmp31, xmask)
tl.store(out_ptr4 + (r3 + (256*x0)), tmp31, xmask)
tl.store(out_ptr5 + (x0), tmp26, xmask)
tl.store(out_ptr0 + (x0), tmp14, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/u5/cu5x2dkgixpjrtx2uup2z6jkyeuyvwihgzv3zh3yrl7i2lpwyzyk.py
# Topologically Sorted Source Nodes: [x2, x3, x4], Original ATen: [aten.cat]
# Source node to ATen node mapping:
# x2 => cat
# x3 => cat_1
# x4 => cat_2
# Graph fragment:
# %cat : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%add_1, %primals_3], 1), kwargs = {})
# %cat_1 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%add_3, %add_1, %primals_3], 1), kwargs = {})
# %cat_2 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%add_5, %add_3, %add_1, %primals_3], 1), kwargs = {})
triton_poi_fused_cat_3 = async_compile.triton('triton_poi_fused_cat_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_3(in_ptr0, out_ptr0, out_ptr1, out_ptr2, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 64
x1 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tl.store(out_ptr0 + (x0 + (128*x1)), tmp0, xmask)
tl.store(out_ptr1 + (x0 + (192*x1)), tmp0, xmask)
tl.store(out_ptr2 + (x0 + (256*x1)), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/v2/cv266dyuvwuox4q2yeqcnngiopdemgeb2jg4czamcu6e6ikcpbts.py
# Topologically Sorted Source Nodes: [pad_1], Original ATen: [aten.copy]
# Source node to ATen node mapping:
# pad_1 => copy_5
# Graph fragment:
# %copy_5 : [num_users=1] = call_function[target=torch.ops.aten.copy.default](args = (%slice_30, %slice_31), kwargs = {})
# %slice_scatter_default_6 : [num_users=1] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_tensor_1, %copy_5, 2, 1, 5), kwargs = {})
# %slice_scatter_default_7 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%empty_1, %slice_scatter_default_6, 3, 1, 5), kwargs = {})
# %slice_scatter_default_8 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_7, %slice_40, 3, 0, 1), kwargs = {})
# %slice_scatter_default_9 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_8, %slice_46, 3, 5, 6), kwargs = {})
triton_poi_fused_copy_4 = async_compile.triton('triton_poi_fused_copy_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_copy_4', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_copy_4(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = (xindex // 6) % 6
x2 = (xindex // 36)
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp15 & xmask, other=0.0)
tmp17 = tl.load(in_ptr1 + (x4), tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float("nan")
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + ((-9) + x0 + (4*x1) + (16*x2)), tmp29 & xmask, other=0.0)
tmp31 = tl.load(in_ptr1 + ((-4) + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + ((-1) + x0 + (4*x1) + (16*x2)), tmp45 & xmask, other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp54 & xmask, other=0.0)
tmp56 = tl.load(in_ptr1 + (x4), tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + (x4), tmp62, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/bl/cbl4dw6ni4z3enptw2gt5tprqiovmm6hmoggmo6wqf3c2ph6hccs.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %slice_scatter_default_10 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_9, %slice_52, 2, 0, 1), kwargs = {})
# %slice_scatter_default_11 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_10, %slice_58, 2, 5, 6), kwargs = {})
triton_poi_fused_5 = async_compile.triton('triton_poi_fused_5', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_5', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_5(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 6) % 6
x0 = xindex % 6
x2 = (xindex // 36)
x3 = xindex
tmp14 = tl.load(in_ptr0 + (x3), xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + ((-24) + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp12 & xmask, eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/k2/ck2wvs5hevlnx6sc6w4bgazpzq7ciol7mbusdns7kbnum2yo6hhv.py
# Topologically Sorted Source Nodes: [x2_1, x2_3, x4], Original ATen: [aten.convolution, aten.native_group_norm, aten.cat]
# Source node to ATen node mapping:
# x2_1 => convolution_1
# x2_3 => add_2, add_3, mul_3, rsqrt_1, var_mean_1
# x4 => cat_2
# Graph fragment:
# %convolution_1 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%slice_scatter_default_11, %primals_6, %primals_7, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %var_mean_1 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_2, [2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_2, 1e-05), kwargs = {})
# %rsqrt_1 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_2,), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_3, %unsqueeze_11), kwargs = {})
# %add_3 : [num_users=2] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_3, %unsqueeze_8), kwargs = {})
# %cat_2 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%add_5, %add_3, %add_1, %primals_3], 1), kwargs = {})
triton_per_fused_cat_convolution_native_group_norm_6 = async_compile.triton('triton_per_fused_cat_convolution_native_group_norm_6', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[4, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: 'i32', 9: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 9), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_cat_convolution_native_group_norm_6', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_cat_convolution_native_group_norm_6(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr2, out_ptr3, out_ptr4, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 4
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r3 = rindex
x0 = xindex
r2 = (rindex // 16)
tmp0 = tl.load(in_out_ptr0 + (r3 + (64*x0)), xmask, other=0.0)
tmp1 = tl.load(in_ptr0 + (r2), None, eviction_policy='evict_last')
tmp28 = tl.load(in_ptr1 + (r2), None, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + (r2), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1, 1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = tl.broadcast_to(tmp4, [XBLOCK, RBLOCK])
tmp7 = tl.where(xmask, tmp5, 0)
tmp8 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp10 = tl.where(xmask, tmp8, 0)
tmp11 = tl.sum(tmp10, 1)[:, None]
tmp12 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp13 = tmp12.to(tl.float32)
tmp14 = tmp11 / tmp13
tmp15 = tmp5 - tmp14
tmp16 = tmp15 * tmp15
tmp17 = tl.broadcast_to(tmp16, [XBLOCK, RBLOCK])
tmp19 = tl.where(xmask, tmp17, 0)
tmp20 = tl.sum(tmp19, 1)[:, None]
tmp21 = tmp4 - tmp14
tmp22 = 64.0
tmp23 = tmp20 / tmp22
tmp24 = 1e-05
tmp25 = tmp23 + tmp24
tmp26 = libdevice.rsqrt(tmp25)
tmp27 = tmp21 * tmp26
tmp29 = tmp27 * tmp28
tmp31 = tmp29 + tmp30
tl.store(in_out_ptr0 + (r3 + (64*x0)), tmp2, xmask)
tl.store(out_ptr2 + (r3 + (192*x0)), tmp31, xmask)
tl.store(out_ptr3 + (r3 + (256*x0)), tmp31, xmask)
tl.store(out_ptr4 + (x0), tmp26, xmask)
tl.store(out_ptr0 + (x0), tmp14, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/7e/c7eo2pwbxu4vcfb4udblnmwaeqalnsdr2qphijyhavbhdhwvfmcs.py
# Topologically Sorted Source Nodes: [pad_2], Original ATen: [aten.copy]
# Source node to ATen node mapping:
# pad_2 => copy_10
# Graph fragment:
# %copy_10 : [num_users=1] = call_function[target=torch.ops.aten.copy.default](args = (%slice_63, %slice_64), kwargs = {})
# %slice_scatter_default_12 : [num_users=1] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_tensor_2, %copy_10, 2, 1, 5), kwargs = {})
# %slice_scatter_default_13 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%empty_2, %slice_scatter_default_12, 3, 1, 5), kwargs = {})
# %slice_scatter_default_14 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_13, %slice_73, 3, 0, 1), kwargs = {})
# %slice_scatter_default_15 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_14, %slice_79, 3, 5, 6), kwargs = {})
triton_poi_fused_copy_7 = async_compile.triton('triton_poi_fused_copy_7', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_copy_7', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_copy_7(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1728
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = (xindex // 6) % 6
x2 = (xindex // 36)
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp15 & xmask, other=0.0)
tmp17 = tl.load(in_ptr1 + (x4), tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float("nan")
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + ((-9) + x0 + (4*x1) + (16*x2)), tmp29 & xmask, other=0.0)
tmp31 = tl.load(in_ptr1 + ((-4) + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + ((-1) + x0 + (4*x1) + (16*x2)), tmp45 & xmask, other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp54 & xmask, other=0.0)
tmp56 = tl.load(in_ptr1 + (x4), tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + (x4), tmp62, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/x4/cx4swemiiq5ss7dkzi3fqqflwd4l3wds4gwvstjyiejfxigsymok.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %slice_scatter_default_16 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_15, %slice_85, 2, 0, 1), kwargs = {})
# %slice_scatter_default_17 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_16, %slice_91, 2, 5, 6), kwargs = {})
triton_poi_fused_8 = async_compile.triton('triton_poi_fused_8', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_8', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_8(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1728
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 6) % 6
x0 = xindex % 6
x2 = (xindex // 36)
x3 = xindex
tmp14 = tl.load(in_ptr0 + (x3), xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + ((-24) + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp12 & xmask, eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/ez/cezgtb4lga4sfmhbxw5zt6ewq2pvhqkidzfjlz4p26pzhulf6qpf.py
# Topologically Sorted Source Nodes: [x3_1, x3_3], Original ATen: [aten.convolution, aten.native_group_norm]
# Source node to ATen node mapping:
# x3_1 => convolution_2
# x3_3 => add_4, add_5, mul_5, rsqrt_2, var_mean_2
# Graph fragment:
# %convolution_2 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%slice_scatter_default_17, %primals_10, %primals_11, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %var_mean_2 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_4, [2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_4 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_4, 1e-05), kwargs = {})
# %rsqrt_2 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_4,), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_5, %unsqueeze_17), kwargs = {})
# %add_5 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_5, %unsqueeze_14), kwargs = {})
triton_per_fused_convolution_native_group_norm_9 = async_compile.triton('triton_per_fused_convolution_native_group_norm_9', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[4, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: 'i32', 8: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 8), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_convolution_native_group_norm_9', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_convolution_native_group_norm_9(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr2, out_ptr3, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 4
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r3 = rindex
x0 = xindex
r2 = (rindex // 16)
tmp0 = tl.load(in_out_ptr0 + (r3 + (64*x0)), xmask, other=0.0)
tmp1 = tl.load(in_ptr0 + (r2), None, eviction_policy='evict_last')
tmp28 = tl.load(in_ptr1 + (r2), None, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + (r2), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1, 1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = tl.broadcast_to(tmp4, [XBLOCK, RBLOCK])
tmp7 = tl.where(xmask, tmp5, 0)
tmp8 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp10 = tl.where(xmask, tmp8, 0)
tmp11 = tl.sum(tmp10, 1)[:, None]
tmp12 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp13 = tmp12.to(tl.float32)
tmp14 = tmp11 / tmp13
tmp15 = tmp5 - tmp14
tmp16 = tmp15 * tmp15
tmp17 = tl.broadcast_to(tmp16, [XBLOCK, RBLOCK])
tmp19 = tl.where(xmask, tmp17, 0)
tmp20 = tl.sum(tmp19, 1)[:, None]
tmp21 = tmp4 - tmp14
tmp22 = 64.0
tmp23 = tmp20 / tmp22
tmp24 = 1e-05
tmp25 = tmp23 + tmp24
tmp26 = libdevice.rsqrt(tmp25)
tmp27 = tmp21 * tmp26
tmp29 = tmp27 * tmp28
tmp31 = tmp29 + tmp30
tl.store(in_out_ptr0 + (r3 + (64*x0)), tmp2, xmask)
tl.store(out_ptr2 + (r3 + (256*x0)), tmp31, xmask)
tl.store(out_ptr3 + (x0), tmp26, xmask)
tl.store(out_ptr0 + (x0), tmp14, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/2b/c2bkgnd3cuthxjljazr4mj42avg33dzpmylkadwq2fkytdy5pisd.py
# Topologically Sorted Source Nodes: [pad_3], Original ATen: [aten.copy]
# Source node to ATen node mapping:
# pad_3 => copy_15
# Graph fragment:
# %copy_15 : [num_users=1] = call_function[target=torch.ops.aten.copy.default](args = (%slice_96, %slice_97), kwargs = {})
# %slice_scatter_default_18 : [num_users=1] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_tensor_3, %copy_15, 2, 1, 5), kwargs = {})
# %slice_scatter_default_19 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%empty_3, %slice_scatter_default_18, 3, 1, 5), kwargs = {})
# %slice_scatter_default_20 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_19, %slice_106, 3, 0, 1), kwargs = {})
# %slice_scatter_default_21 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_20, %slice_112, 3, 5, 6), kwargs = {})
triton_poi_fused_copy_10 = async_compile.triton('triton_poi_fused_copy_10', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4096],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_copy_10', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_copy_10(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 2304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = (xindex // 6) % 6
x2 = (xindex // 36)
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp15 & xmask, other=0.0)
tmp17 = tl.load(in_ptr1 + (x4), tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float("nan")
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + ((-9) + x0 + (4*x1) + (16*x2)), tmp29 & xmask, other=0.0)
tmp31 = tl.load(in_ptr1 + ((-4) + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + ((-1) + x0 + (4*x1) + (16*x2)), tmp45 & xmask, other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp54 & xmask, other=0.0)
tmp56 = tl.load(in_ptr1 + (x4), tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + (x4), tmp62, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/yq/cyqia2t74oth2xmpw3wy67dajhytppay533s3qznmeunx7sbnrf5.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %slice_scatter_default_22 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_21, %slice_118, 2, 0, 1), kwargs = {})
# %slice_scatter_default_23 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_22, %slice_124, 2, 5, 6), kwargs = {})
triton_poi_fused_11 = async_compile.triton('triton_poi_fused_11', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4096],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_11', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_11(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 2304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 6) % 6
x0 = xindex % 6
x2 = (xindex // 36)
x3 = xindex
tmp14 = tl.load(in_ptr0 + (x3), xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + ((-24) + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp12 & xmask, eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/3z/c3z7somucyhaymf7nx4yl5ne7522e2dc6gxs2vz3qdu6shtmayoa.py
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# out => convolution_3
# Graph fragment:
# %convolution_3 : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%slice_scatter_default_23, %primals_14, %primals_15, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_12 = async_compile.triton('triton_poi_fused_convolution_12', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_12', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_12(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, ), (1, ))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 8, 3, 3), (72, 9, 3, 1))
assert_size_stride(primals_7, (4, ), (1, ))
assert_size_stride(primals_8, (4, ), (1, ))
assert_size_stride(primals_9, (4, ), (1, ))
assert_size_stride(primals_10, (4, 12, 3, 3), (108, 9, 3, 1))
assert_size_stride(primals_11, (4, ), (1, ))
assert_size_stride(primals_12, (4, ), (1, ))
assert_size_stride(primals_13, (4, ), (1, ))
assert_size_stride(primals_14, (4, 16, 3, 3), (144, 9, 3, 1))
assert_size_stride(primals_15, (4, ), (1, ))
buf0 = empty_strided_cuda((4, 4, 6, 6), (144, 36, 6, 1), torch.float32)
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((4, 4, 6, 6), (144, 36, 6, 1), torch.float32)
# Topologically Sorted Source Nodes: [pad], Original ATen: [aten.copy]
stream0 = get_raw_stream(0)
triton_poi_fused_copy_0.run(primals_3, buf0, buf1, 576, grid=grid(576), stream=stream0)
buf2 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_1.run(buf1, buf2, 576, grid=grid(576), stream=stream0)
del buf1
# Topologically Sorted Source Nodes: [x1], Original ATen: [aten.convolution]
buf3 = extern_kernels.convolution(buf2, primals_1, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf3, (4, 4, 4, 4), (64, 16, 4, 1))
buf4 = buf3; del buf3 # reuse
buf5 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
buf11 = empty_strided_cuda((4, 8, 4, 4), (128, 16, 4, 1), torch.float32)
buf8 = reinterpret_tensor(buf11, (4, 4, 4, 4), (128, 16, 4, 1), 0) # alias
buf24 = empty_strided_cuda((4, 12, 4, 4), (192, 16, 4, 1), torch.float32)
buf22 = reinterpret_tensor(buf24, (4, 4, 4, 4), (192, 16, 4, 1), 64) # alias
buf38 = empty_strided_cuda((4, 16, 4, 4), (256, 16, 4, 1), torch.float32)
buf36 = reinterpret_tensor(buf38, (4, 4, 4, 4), (256, 16, 4, 1), 128) # alias
buf9 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
# Topologically Sorted Source Nodes: [x1, x1_2, x3, x4], Original ATen: [aten.convolution, aten.native_group_norm, aten.cat]
triton_per_fused_cat_convolution_native_group_norm_2.run(buf4, primals_2, primals_4, primals_5, buf5, buf8, buf22, buf36, buf9, 4, 64, grid=grid(4), stream=stream0)
del primals_2
del primals_5
buf10 = reinterpret_tensor(buf11, (4, 4, 4, 4), (128, 16, 4, 1), 64) # alias
buf23 = reinterpret_tensor(buf24, (4, 4, 4, 4), (192, 16, 4, 1), 128) # alias
buf37 = reinterpret_tensor(buf38, (4, 4, 4, 4), (256, 16, 4, 1), 192) # alias
# Topologically Sorted Source Nodes: [x2, x3, x4], Original ATen: [aten.cat]
triton_poi_fused_cat_3.run(primals_3, buf10, buf23, buf37, 256, grid=grid(256), stream=stream0)
del primals_3
buf12 = empty_strided_cuda((4, 8, 6, 6), (288, 36, 6, 1), torch.float32)
buf13 = empty_strided_cuda((4, 8, 6, 6), (288, 36, 6, 1), torch.float32)
# Topologically Sorted Source Nodes: [pad_1], Original ATen: [aten.copy]
triton_poi_fused_copy_4.run(buf11, buf12, buf13, 1152, grid=grid(1152), stream=stream0)
del buf10
del buf11
del buf8
buf14 = buf12; del buf12 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_5.run(buf13, buf14, 1152, grid=grid(1152), stream=stream0)
del buf13
# Topologically Sorted Source Nodes: [x2_1], Original ATen: [aten.convolution]
buf15 = extern_kernels.convolution(buf14, primals_6, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf15, (4, 4, 4, 4), (64, 16, 4, 1))
buf16 = buf15; del buf15 # reuse
buf17 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
buf20 = reinterpret_tensor(buf24, (4, 4, 4, 4), (192, 16, 4, 1), 0) # alias
buf35 = reinterpret_tensor(buf38, (4, 4, 4, 4), (256, 16, 4, 1), 64) # alias
buf21 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
# Topologically Sorted Source Nodes: [x2_1, x2_3, x4], Original ATen: [aten.convolution, aten.native_group_norm, aten.cat]
triton_per_fused_cat_convolution_native_group_norm_6.run(buf16, primals_7, primals_8, primals_9, buf17, buf20, buf35, buf21, 4, 64, grid=grid(4), stream=stream0)
del primals_7
del primals_9
buf25 = empty_strided_cuda((4, 12, 6, 6), (432, 36, 6, 1), torch.float32)
buf26 = empty_strided_cuda((4, 12, 6, 6), (432, 36, 6, 1), torch.float32)
# Topologically Sorted Source Nodes: [pad_2], Original ATen: [aten.copy]
triton_poi_fused_copy_7.run(buf24, buf25, buf26, 1728, grid=grid(1728), stream=stream0)
del buf20
del buf22
del buf23
del buf24
buf27 = buf25; del buf25 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_8.run(buf26, buf27, 1728, grid=grid(1728), stream=stream0)
del buf26
# Topologically Sorted Source Nodes: [x3_1], Original ATen: [aten.convolution]
buf28 = extern_kernels.convolution(buf27, primals_10, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf28, (4, 4, 4, 4), (64, 16, 4, 1))
buf29 = buf28; del buf28 # reuse
buf30 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
buf34 = reinterpret_tensor(buf38, (4, 4, 4, 4), (256, 16, 4, 1), 0) # alias
buf33 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
# Topologically Sorted Source Nodes: [x3_1, x3_3], Original ATen: [aten.convolution, aten.native_group_norm]
triton_per_fused_convolution_native_group_norm_9.run(buf29, primals_11, primals_12, primals_13, buf30, buf34, buf33, 4, 64, grid=grid(4), stream=stream0)
del primals_11
del primals_13
buf39 = empty_strided_cuda((4, 16, 6, 6), (576, 36, 6, 1), torch.float32)
buf40 = empty_strided_cuda((4, 16, 6, 6), (576, 36, 6, 1), torch.float32)
# Topologically Sorted Source Nodes: [pad_3], Original ATen: [aten.copy]
triton_poi_fused_copy_10.run(buf38, buf39, buf40, 2304, grid=grid(2304), stream=stream0)
del buf34
del buf35
del buf36
del buf37
del buf38
buf41 = buf39; del buf39 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_11.run(buf40, buf41, 2304, grid=grid(2304), stream=stream0)
del buf40
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
buf42 = extern_kernels.convolution(buf41, primals_14, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf42, (4, 4, 4, 4), (64, 16, 4, 1))
buf43 = buf42; del buf42 # reuse
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
triton_poi_fused_convolution_12.run(buf43, primals_15, 256, grid=grid(256), stream=stream0)
del primals_15
return (buf43, primals_1, primals_4, primals_6, primals_8, primals_10, primals_12, primals_14, buf2, buf4, reinterpret_tensor(buf5, (4, 1), (1, 1), 0), reinterpret_tensor(buf9, (4, 1), (1, 1), 0), buf14, buf16, reinterpret_tensor(buf17, (4, 1), (1, 1), 0), reinterpret_tensor(buf21, (4, 1), (1, 1), 0), buf27, buf29, reinterpret_tensor(buf30, (4, 1), (1, 1), 0), reinterpret_tensor(buf33, (4, 1), (1, 1), 0), buf41, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 8, 3, 3), (72, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((4, 12, 3, 3), (108, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_12 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_13 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_14 = rand_strided((4, 16, 3, 3), (144, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_15 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
from torch.nn import init as init
class ConvBlockLNEDense(nn.Module):
def __init__(self, n_ch, act='relu', ksize=3):
super().__init__()
padding = (ksize - 1) // 2
if act == 'lrelu':
self.act = nn.LeakyReLU(0.2, True)
else:
self.act = nn.ReLU(True)
self.conv1 = nn.Conv2d(n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode='circular')
self.conv2 = nn.Conv2d(2 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode='circular')
self.conv3 = nn.Conv2d(3 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode='circular')
self.conv4 = nn.Conv2d(4 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode='circular')
self.norm1 = nn.GroupNorm(1, n_ch, affine=True)
self.norm2 = nn.GroupNorm(1, n_ch, affine=True)
self.norm3 = nn.GroupNorm(1, n_ch, affine=True)
def forward(self, x, g=None, b=None):
x1 = self.conv1(x)
x1 = self.act(x1)
x1 = self.norm1(x1)
x2 = torch.cat([x1, x], dim=1)
x2 = self.conv2(x2)
x2 = self.act(x2)
x2 = self.norm2(x2)
x3 = torch.cat([x2, x1, x], dim=1)
x3 = self.conv3(x3)
x3 = self.act(x3)
x3 = self.norm3(x3)
x4 = torch.cat([x3, x2, x1, x], dim=1)
out = self.conv4(x4)
return out
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'n_ch': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice
from torch import nn
from torch.nn import init as init
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_copy_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 576
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = xindex // 6 % 6
x2 = xindex // 36
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp15 & xmask,
other=0.0)
tmp17 = tl.load(in_ptr1 + x4, tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float('nan')
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + (-9 + x0 + 4 * x1 + 16 * x2), tmp29 & xmask,
other=0.0)
tmp31 = tl.load(in_ptr1 + (-4 + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + (-1 + x0 + 4 * x1 + 16 * x2), tmp45 & xmask,
other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp54 & xmask,
other=0.0)
tmp56 = tl.load(in_ptr1 + x4, tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + x4, tmp62, xmask)
@triton.jit
def triton_poi_fused_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 576
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 6 % 6
x0 = xindex % 6
x2 = xindex // 36
x3 = xindex
tmp14 = tl.load(in_ptr0 + x3, xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + (-24 + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp12 & xmask,
eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_per_fused_cat_convolution_native_group_norm_2(in_out_ptr0,
in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr2, out_ptr3, out_ptr4,
out_ptr5, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 4
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r3 = rindex
x0 = xindex
r2 = rindex // 16
tmp0 = tl.load(in_out_ptr0 + (r3 + 64 * x0), xmask, other=0.0)
tmp1 = tl.load(in_ptr0 + r2, None, eviction_policy='evict_last')
tmp28 = tl.load(in_ptr1 + r2, None, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + r2, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1, 1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = tl.broadcast_to(tmp4, [XBLOCK, RBLOCK])
tl.where(xmask, tmp5, 0)
tmp8 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp10 = tl.where(xmask, tmp8, 0)
tmp11 = tl.sum(tmp10, 1)[:, None]
tmp12 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp13 = tmp12.to(tl.float32)
tmp14 = tmp11 / tmp13
tmp15 = tmp5 - tmp14
tmp16 = tmp15 * tmp15
tmp17 = tl.broadcast_to(tmp16, [XBLOCK, RBLOCK])
tmp19 = tl.where(xmask, tmp17, 0)
tmp20 = tl.sum(tmp19, 1)[:, None]
tmp21 = tmp4 - tmp14
tmp22 = 64.0
tmp23 = tmp20 / tmp22
tmp24 = 1e-05
tmp25 = tmp23 + tmp24
tmp26 = libdevice.rsqrt(tmp25)
tmp27 = tmp21 * tmp26
tmp29 = tmp27 * tmp28
tmp31 = tmp29 + tmp30
tl.store(in_out_ptr0 + (r3 + 64 * x0), tmp2, xmask)
tl.store(out_ptr2 + (r3 + 128 * x0), tmp31, xmask)
tl.store(out_ptr3 + (r3 + 192 * x0), tmp31, xmask)
tl.store(out_ptr4 + (r3 + 256 * x0), tmp31, xmask)
tl.store(out_ptr5 + x0, tmp26, xmask)
tl.store(out_ptr0 + x0, tmp14, xmask)
@triton.jit
def triton_poi_fused_cat_3(in_ptr0, out_ptr0, out_ptr1, out_ptr2, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 64
x1 = xindex // 64
tmp0 = tl.load(in_ptr0 + x2, xmask)
tl.store(out_ptr0 + (x0 + 128 * x1), tmp0, xmask)
tl.store(out_ptr1 + (x0 + 192 * x1), tmp0, xmask)
tl.store(out_ptr2 + (x0 + 256 * x1), tmp0, xmask)
@triton.jit
def triton_poi_fused_copy_4(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 1152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = xindex // 6 % 6
x2 = xindex // 36
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp15 & xmask,
other=0.0)
tmp17 = tl.load(in_ptr1 + x4, tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float('nan')
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + (-9 + x0 + 4 * x1 + 16 * x2), tmp29 & xmask,
other=0.0)
tmp31 = tl.load(in_ptr1 + (-4 + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + (-1 + x0 + 4 * x1 + 16 * x2), tmp45 & xmask,
other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp54 & xmask,
other=0.0)
tmp56 = tl.load(in_ptr1 + x4, tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + x4, tmp62, xmask)
@triton.jit
def triton_poi_fused_5(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 1152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 6 % 6
x0 = xindex % 6
x2 = xindex // 36
x3 = xindex
tmp14 = tl.load(in_ptr0 + x3, xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + (-24 + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp12 & xmask,
eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_per_fused_cat_convolution_native_group_norm_6(in_out_ptr0,
in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr2, out_ptr3, out_ptr4,
xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 4
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r3 = rindex
x0 = xindex
r2 = rindex // 16
tmp0 = tl.load(in_out_ptr0 + (r3 + 64 * x0), xmask, other=0.0)
tmp1 = tl.load(in_ptr0 + r2, None, eviction_policy='evict_last')
tmp28 = tl.load(in_ptr1 + r2, None, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + r2, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1, 1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = tl.broadcast_to(tmp4, [XBLOCK, RBLOCK])
tl.where(xmask, tmp5, 0)
tmp8 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp10 = tl.where(xmask, tmp8, 0)
tmp11 = tl.sum(tmp10, 1)[:, None]
tmp12 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp13 = tmp12.to(tl.float32)
tmp14 = tmp11 / tmp13
tmp15 = tmp5 - tmp14
tmp16 = tmp15 * tmp15
tmp17 = tl.broadcast_to(tmp16, [XBLOCK, RBLOCK])
tmp19 = tl.where(xmask, tmp17, 0)
tmp20 = tl.sum(tmp19, 1)[:, None]
tmp21 = tmp4 - tmp14
tmp22 = 64.0
tmp23 = tmp20 / tmp22
tmp24 = 1e-05
tmp25 = tmp23 + tmp24
tmp26 = libdevice.rsqrt(tmp25)
tmp27 = tmp21 * tmp26
tmp29 = tmp27 * tmp28
tmp31 = tmp29 + tmp30
tl.store(in_out_ptr0 + (r3 + 64 * x0), tmp2, xmask)
tl.store(out_ptr2 + (r3 + 192 * x0), tmp31, xmask)
tl.store(out_ptr3 + (r3 + 256 * x0), tmp31, xmask)
tl.store(out_ptr4 + x0, tmp26, xmask)
tl.store(out_ptr0 + x0, tmp14, xmask)
@triton.jit
def triton_poi_fused_copy_7(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 1728
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = xindex // 6 % 6
x2 = xindex // 36
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp15 & xmask,
other=0.0)
tmp17 = tl.load(in_ptr1 + x4, tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float('nan')
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + (-9 + x0 + 4 * x1 + 16 * x2), tmp29 & xmask,
other=0.0)
tmp31 = tl.load(in_ptr1 + (-4 + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + (-1 + x0 + 4 * x1 + 16 * x2), tmp45 & xmask,
other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp54 & xmask,
other=0.0)
tmp56 = tl.load(in_ptr1 + x4, tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + x4, tmp62, xmask)
@triton.jit
def triton_poi_fused_8(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 1728
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 6 % 6
x0 = xindex % 6
x2 = xindex // 36
x3 = xindex
tmp14 = tl.load(in_ptr0 + x3, xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + (-24 + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp12 & xmask,
eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_per_fused_convolution_native_group_norm_9(in_out_ptr0, in_ptr0,
in_ptr1, in_ptr2, out_ptr0, out_ptr2, out_ptr3, xnumel, rnumel, XBLOCK:
tl.constexpr):
xnumel = 4
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r3 = rindex
x0 = xindex
r2 = rindex // 16
tmp0 = tl.load(in_out_ptr0 + (r3 + 64 * x0), xmask, other=0.0)
tmp1 = tl.load(in_ptr0 + r2, None, eviction_policy='evict_last')
tmp28 = tl.load(in_ptr1 + r2, None, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + r2, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1, 1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = tl.broadcast_to(tmp4, [XBLOCK, RBLOCK])
tl.where(xmask, tmp5, 0)
tmp8 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp10 = tl.where(xmask, tmp8, 0)
tmp11 = tl.sum(tmp10, 1)[:, None]
tmp12 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp13 = tmp12.to(tl.float32)
tmp14 = tmp11 / tmp13
tmp15 = tmp5 - tmp14
tmp16 = tmp15 * tmp15
tmp17 = tl.broadcast_to(tmp16, [XBLOCK, RBLOCK])
tmp19 = tl.where(xmask, tmp17, 0)
tmp20 = tl.sum(tmp19, 1)[:, None]
tmp21 = tmp4 - tmp14
tmp22 = 64.0
tmp23 = tmp20 / tmp22
tmp24 = 1e-05
tmp25 = tmp23 + tmp24
tmp26 = libdevice.rsqrt(tmp25)
tmp27 = tmp21 * tmp26
tmp29 = tmp27 * tmp28
tmp31 = tmp29 + tmp30
tl.store(in_out_ptr0 + (r3 + 64 * x0), tmp2, xmask)
tl.store(out_ptr2 + (r3 + 256 * x0), tmp31, xmask)
tl.store(out_ptr3 + x0, tmp26, xmask)
tl.store(out_ptr0 + x0, tmp14, xmask)
@triton.jit
def triton_poi_fused_copy_10(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 2304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = xindex // 6 % 6
x2 = xindex // 36
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp15 & xmask,
other=0.0)
tmp17 = tl.load(in_ptr1 + x4, tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float('nan')
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + (-9 + x0 + 4 * x1 + 16 * x2), tmp29 & xmask,
other=0.0)
tmp31 = tl.load(in_ptr1 + (-4 + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + (-1 + x0 + 4 * x1 + 16 * x2), tmp45 & xmask,
other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp54 & xmask,
other=0.0)
tmp56 = tl.load(in_ptr1 + x4, tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + x4, tmp62, xmask)
@triton.jit
def triton_poi_fused_11(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 2304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 6 % 6
x0 = xindex % 6
x2 = xindex // 36
x3 = xindex
tmp14 = tl.load(in_ptr0 + x3, xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + (-24 + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp12 & xmask,
eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_poi_fused_convolution_12(in_out_ptr0, in_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 16 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11, primals_12,
primals_13, primals_14, primals_15) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4,), (1,))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 8, 3, 3), (72, 9, 3, 1))
assert_size_stride(primals_7, (4,), (1,))
assert_size_stride(primals_8, (4,), (1,))
assert_size_stride(primals_9, (4,), (1,))
assert_size_stride(primals_10, (4, 12, 3, 3), (108, 9, 3, 1))
assert_size_stride(primals_11, (4,), (1,))
assert_size_stride(primals_12, (4,), (1,))
assert_size_stride(primals_13, (4,), (1,))
assert_size_stride(primals_14, (4, 16, 3, 3), (144, 9, 3, 1))
assert_size_stride(primals_15, (4,), (1,))
buf0 = empty_strided_cuda((4, 4, 6, 6), (144, 36, 6, 1), torch.float32)
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((4, 4, 6, 6), (144, 36, 6, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_copy_0[grid(576)](primals_3, buf0, buf1, 576,
XBLOCK=256, num_warps=4, num_stages=1)
buf2 = buf0
del buf0
triton_poi_fused_1[grid(576)](buf1, buf2, 576, XBLOCK=256,
num_warps=4, num_stages=1)
del buf1
buf3 = extern_kernels.convolution(buf2, primals_1, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf3, (4, 4, 4, 4), (64, 16, 4, 1))
buf4 = buf3
del buf3
buf5 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
buf11 = empty_strided_cuda((4, 8, 4, 4), (128, 16, 4, 1), torch.float32
)
buf8 = reinterpret_tensor(buf11, (4, 4, 4, 4), (128, 16, 4, 1), 0)
buf24 = empty_strided_cuda((4, 12, 4, 4), (192, 16, 4, 1), torch.
float32)
buf22 = reinterpret_tensor(buf24, (4, 4, 4, 4), (192, 16, 4, 1), 64)
buf38 = empty_strided_cuda((4, 16, 4, 4), (256, 16, 4, 1), torch.
float32)
buf36 = reinterpret_tensor(buf38, (4, 4, 4, 4), (256, 16, 4, 1), 128)
buf9 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
triton_per_fused_cat_convolution_native_group_norm_2[grid(4)](buf4,
primals_2, primals_4, primals_5, buf5, buf8, buf22, buf36, buf9,
4, 64, XBLOCK=1, num_warps=2, num_stages=1)
del primals_2
del primals_5
buf10 = reinterpret_tensor(buf11, (4, 4, 4, 4), (128, 16, 4, 1), 64)
buf23 = reinterpret_tensor(buf24, (4, 4, 4, 4), (192, 16, 4, 1), 128)
buf37 = reinterpret_tensor(buf38, (4, 4, 4, 4), (256, 16, 4, 1), 192)
triton_poi_fused_cat_3[grid(256)](primals_3, buf10, buf23, buf37,
256, XBLOCK=128, num_warps=4, num_stages=1)
del primals_3
buf12 = empty_strided_cuda((4, 8, 6, 6), (288, 36, 6, 1), torch.float32
)
buf13 = empty_strided_cuda((4, 8, 6, 6), (288, 36, 6, 1), torch.float32
)
triton_poi_fused_copy_4[grid(1152)](buf11, buf12, buf13, 1152,
XBLOCK=256, num_warps=4, num_stages=1)
del buf10
del buf11
del buf8
buf14 = buf12
del buf12
triton_poi_fused_5[grid(1152)](buf13, buf14, 1152, XBLOCK=256,
num_warps=4, num_stages=1)
del buf13
buf15 = extern_kernels.convolution(buf14, primals_6, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf15, (4, 4, 4, 4), (64, 16, 4, 1))
buf16 = buf15
del buf15
buf17 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
buf20 = reinterpret_tensor(buf24, (4, 4, 4, 4), (192, 16, 4, 1), 0)
buf35 = reinterpret_tensor(buf38, (4, 4, 4, 4), (256, 16, 4, 1), 64)
buf21 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
triton_per_fused_cat_convolution_native_group_norm_6[grid(4)](buf16,
primals_7, primals_8, primals_9, buf17, buf20, buf35, buf21, 4,
64, XBLOCK=1, num_warps=2, num_stages=1)
del primals_7
del primals_9
buf25 = empty_strided_cuda((4, 12, 6, 6), (432, 36, 6, 1), torch.
float32)
buf26 = empty_strided_cuda((4, 12, 6, 6), (432, 36, 6, 1), torch.
float32)
triton_poi_fused_copy_7[grid(1728)](buf24, buf25, buf26, 1728,
XBLOCK=128, num_warps=4, num_stages=1)
del buf20
del buf22
del buf23
del buf24
buf27 = buf25
del buf25
triton_poi_fused_8[grid(1728)](buf26, buf27, 1728, XBLOCK=256,
num_warps=4, num_stages=1)
del buf26
buf28 = extern_kernels.convolution(buf27, primals_10, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf28, (4, 4, 4, 4), (64, 16, 4, 1))
buf29 = buf28
del buf28
buf30 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
buf34 = reinterpret_tensor(buf38, (4, 4, 4, 4), (256, 16, 4, 1), 0)
buf33 = empty_strided_cuda((4, 1, 1, 1), (1, 4, 4, 4), torch.float32)
triton_per_fused_convolution_native_group_norm_9[grid(4)](buf29,
primals_11, primals_12, primals_13, buf30, buf34, buf33, 4, 64,
XBLOCK=1, num_warps=2, num_stages=1)
del primals_11
del primals_13
buf39 = empty_strided_cuda((4, 16, 6, 6), (576, 36, 6, 1), torch.
float32)
buf40 = empty_strided_cuda((4, 16, 6, 6), (576, 36, 6, 1), torch.
float32)
triton_poi_fused_copy_10[grid(2304)](buf38, buf39, buf40, 2304,
XBLOCK=128, num_warps=4, num_stages=1)
del buf34
del buf35
del buf36
del buf37
del buf38
buf41 = buf39
del buf39
triton_poi_fused_11[grid(2304)](buf40, buf41, 2304, XBLOCK=256,
num_warps=4, num_stages=1)
del buf40
buf42 = extern_kernels.convolution(buf41, primals_14, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf42, (4, 4, 4, 4), (64, 16, 4, 1))
buf43 = buf42
del buf42
triton_poi_fused_convolution_12[grid(256)](buf43, primals_15, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_15
return (buf43, primals_1, primals_4, primals_6, primals_8, primals_10,
primals_12, primals_14, buf2, buf4, reinterpret_tensor(buf5, (4, 1),
(1, 1), 0), reinterpret_tensor(buf9, (4, 1), (1, 1), 0), buf14,
buf16, reinterpret_tensor(buf17, (4, 1), (1, 1), 0),
reinterpret_tensor(buf21, (4, 1), (1, 1), 0), buf27, buf29,
reinterpret_tensor(buf30, (4, 1), (1, 1), 0), reinterpret_tensor(
buf33, (4, 1), (1, 1), 0), buf41)
class ConvBlockLNEDenseNew(nn.Module):
def __init__(self, n_ch, act='relu', ksize=3):
super().__init__()
padding = (ksize - 1) // 2
if act == 'lrelu':
self.act = nn.LeakyReLU(0.2, True)
else:
self.act = nn.ReLU(True)
self.conv1 = nn.Conv2d(n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode='circular')
self.conv2 = nn.Conv2d(2 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode='circular')
self.conv3 = nn.Conv2d(3 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode='circular')
self.conv4 = nn.Conv2d(4 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode='circular')
self.norm1 = nn.GroupNorm(1, n_ch, affine=True)
self.norm2 = nn.GroupNorm(1, n_ch, affine=True)
self.norm3 = nn.GroupNorm(1, n_ch, affine=True)
def forward(self, input_0):
primals_1 = self.conv1.weight
primals_2 = self.conv1.bias
primals_6 = self.conv2.weight
primals_4 = self.conv2.bias
primals_10 = self.conv3.weight
primals_5 = self.conv3.bias
primals_14 = self.conv4.weight
primals_7 = self.conv4.bias
primals_8 = self.norm1.weight
primals_9 = self.norm1.bias
primals_11 = self.norm2.weight
primals_12 = self.norm2.bias
primals_13 = self.norm3.weight
primals_15 = self.norm3.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11, primals_12, primals_13, primals_14,
primals_15])
return output[0]
|
BaekduChoi/Halftoning_v2
|
ConvBlockLNEDense
| false | 2,061 |
[
"BSD-3-Clause"
] | 0 |
fdb7040e1a4044f23ef9c92757bbb90c23685afe
|
https://github.com/BaekduChoi/Halftoning_v2/tree/fdb7040e1a4044f23ef9c92757bbb90c23685afe
|
WingLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/5y/c5yx2tmktzc5brhfqiwvzfmmrhkpiscn4gi6kct3s3fnisnd7xlo.py
# Topologically Sorted Source Nodes: [sub, delta, lt, truediv, add, log, mul, sub_1, losses, sum_1], Original ATen: [aten.sub, aten.abs, aten.lt, aten.div, aten.add, aten.log, aten.mul, aten.where, aten.sum]
# Source node to ATen node mapping:
# add => add
# delta => abs_1
# log => log
# losses => where
# lt => lt
# mul => mul
# sub => sub
# sub_1 => sub_1
# sum_1 => sum_1
# truediv => div
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %abs_1 : [num_users=3] = call_function[target=torch.ops.aten.abs.default](args = (%sub,), kwargs = {})
# %lt : [num_users=1] = call_function[target=torch.ops.aten.lt.Scalar](args = (%abs_1, 10.0), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%abs_1, 2.0), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%div, 1.0), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%add,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%log, 10.0), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%abs_1, -7.91759469228055), kwargs = {})
# %where : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%lt, %mul, %sub_1), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%where, [1, 2]), kwargs = {})
triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0 = async_compile.triton('triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 16],
reduction_hint=ReductionHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0(in_ptr0, in_ptr1, out_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r2 = rindex
x0 = xindex % 4
x1 = (xindex // 4)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (4*r2) + (64*x1)), xmask, other=0.0)
tmp1 = tl.load(in_ptr1 + (x0 + (4*r2) + (64*x1)), xmask, other=0.0)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = 10.0
tmp5 = tmp3 < tmp4
tmp6 = 0.5
tmp7 = tmp3 * tmp6
tmp8 = 1.0
tmp9 = tmp7 + tmp8
tmp10 = tl_math.log(tmp9)
tmp11 = tmp10 * tmp4
tmp12 = -7.91759469228055
tmp13 = tmp3 - tmp12
tmp14 = tl.where(tmp5, tmp11, tmp13)
tmp15 = tl.broadcast_to(tmp14, [XBLOCK, RBLOCK])
tmp17 = tl.where(xmask, tmp15, 0)
tmp18 = tl.sum(tmp17, 1)[:, None]
tl.store(out_ptr0 + (x3), tmp18, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/yi/cyivqxc32riwmi4nsqtijcqefjxyivwafk4qjnscryb6cwpfnqim.py
# Topologically Sorted Source Nodes: [loss, mul_1], Original ATen: [aten.mean, aten.mul]
# Source node to ATen node mapping:
# loss => mean
# mul_1 => mul_1
# Graph fragment:
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%sum_1, [0]), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_poi_fused_mean_mul_1 = async_compile.triton('triton_poi_fused_mean_mul_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mean_mul_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mean_mul_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = tl.load(in_ptr0 + (4 + x0), xmask)
tmp3 = tl.load(in_ptr0 + (8 + x0), xmask)
tmp5 = tl.load(in_ptr0 + (12 + x0), xmask)
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 4.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.store(out_ptr0 + (x0), tmp10, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [sub, delta, lt, truediv, add, log, mul, sub_1, losses, sum_1], Original ATen: [aten.sub, aten.abs, aten.lt, aten.div, aten.add, aten.log, aten.mul, aten.where, aten.sum]
stream0 = get_raw_stream(0)
triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0.run(arg0_1, arg1_1, buf0, 16, 16, grid=grid(16), stream=stream0)
del arg0_1
del arg1_1
buf1 = empty_strided_cuda((4, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [loss, mul_1], Original ATen: [aten.mean, aten.mul]
triton_poi_fused_mean_mul_1.run(buf0, buf1, 4, grid=grid(4), stream=stream0)
del buf0
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import math
import torch
import torch.nn as nn
class WingLoss(nn.Module):
"""Wing Loss. paper ref: 'Wing Loss for Robust Facial Landmark Localisation
with Convolutional Neural Networks' Feng et al. CVPR'2018.
Args:
omega (float): Also referred to as width.
epsilon (float): Also referred to as curvature.
use_target_weight (bool): Option to use weighted MSE loss.
Different joint types may have different target weights.
loss_weight (float): Weight of the loss. Default: 1.0.
"""
def __init__(self, omega=10.0, epsilon=2.0, use_target_weight=False,
loss_weight=1.0):
super().__init__()
self.omega = omega
self.epsilon = epsilon
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
self.C = self.omega * (1.0 - math.log(1.0 + self.omega / self.epsilon))
def criterion(self, pred, target):
"""Criterion of wingloss.
Note:
- batch_size: N
- num_keypoints: K
- dimension of keypoints: D (D=2 or D=3)
Args:
pred (torch.Tensor[N, K, D]): Output regression.
target (torch.Tensor[N, K, D]): Target regression.
"""
delta = (target - pred).abs()
losses = torch.where(delta < self.omega, self.omega * torch.log(1.0 +
delta / self.epsilon), delta - self.C)
return torch.mean(torch.sum(losses, dim=[1, 2]), dim=0)
def forward(self, output, target, target_weight=None):
"""Forward function.
Note:
- batch_size: N
- num_keypoints: K
- dimension of keypoints: D (D=2 or D=3)
Args:
output (torch.Tensor[N, K, D]): Output regression.
target (torch.Tensor[N, K, D]): Target regression.
target_weight (torch.Tensor[N,K,D]):
Weights across different joint types.
"""
if self.use_target_weight:
assert target_weight is not None
loss = self.criterion(output * target_weight, target *
target_weight)
else:
loss = self.criterion(output, target)
return loss * self.loss_weight
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import math as tl_math
import math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0(in_ptr0,
in_ptr1, out_ptr0, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r2 = rindex
x0 = xindex % 4
x1 = xindex // 4
x3 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 4 * r2 + 64 * x1), xmask, other=0.0)
tmp1 = tl.load(in_ptr1 + (x0 + 4 * r2 + 64 * x1), xmask, other=0.0)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = 10.0
tmp5 = tmp3 < tmp4
tmp6 = 0.5
tmp7 = tmp3 * tmp6
tmp8 = 1.0
tmp9 = tmp7 + tmp8
tmp10 = tl_math.log(tmp9)
tmp11 = tmp10 * tmp4
tmp12 = -7.91759469228055
tmp13 = tmp3 - tmp12
tmp14 = tl.where(tmp5, tmp11, tmp13)
tmp15 = tl.broadcast_to(tmp14, [XBLOCK, RBLOCK])
tmp17 = tl.where(xmask, tmp15, 0)
tmp18 = tl.sum(tmp17, 1)[:, None]
tl.store(out_ptr0 + x3, tmp18, xmask)
@triton.jit
def triton_poi_fused_mean_mul_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = tl.load(in_ptr0 + (4 + x0), xmask)
tmp3 = tl.load(in_ptr0 + (8 + x0), xmask)
tmp5 = tl.load(in_ptr0 + (12 + x0), xmask)
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 4.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.store(out_ptr0 + x0, tmp10, xmask)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
get_raw_stream(0)
triton_per_fused_abs_add_div_log_lt_mul_sub_sum_where_0[grid(16)](
arg0_1, arg1_1, buf0, 16, 16, XBLOCK=1, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
buf1 = empty_strided_cuda((4,), (1,), torch.float32)
triton_poi_fused_mean_mul_1[grid(4)](buf0, buf1, 4, XBLOCK=4,
num_warps=1, num_stages=1)
del buf0
return buf1,
class WingLossNew(nn.Module):
"""Wing Loss. paper ref: 'Wing Loss for Robust Facial Landmark Localisation
with Convolutional Neural Networks' Feng et al. CVPR'2018.
Args:
omega (float): Also referred to as width.
epsilon (float): Also referred to as curvature.
use_target_weight (bool): Option to use weighted MSE loss.
Different joint types may have different target weights.
loss_weight (float): Weight of the loss. Default: 1.0.
"""
def __init__(self, omega=10.0, epsilon=2.0, use_target_weight=False,
loss_weight=1.0):
super().__init__()
self.omega = omega
self.epsilon = epsilon
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
self.C = self.omega * (1.0 - math.log(1.0 + self.omega / self.epsilon))
def criterion(self, pred, target):
"""Criterion of wingloss.
Note:
- batch_size: N
- num_keypoints: K
- dimension of keypoints: D (D=2 or D=3)
Args:
pred (torch.Tensor[N, K, D]): Output regression.
target (torch.Tensor[N, K, D]): Target regression.
"""
delta = (target - pred).abs()
losses = torch.where(delta < self.omega, self.omega * torch.log(1.0 +
delta / self.epsilon), delta - self.C)
return torch.mean(torch.sum(losses, dim=[1, 2]), dim=0)
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ALISCIFP/mmpose
|
WingLoss
| false | 2,062 |
[
"Apache-2.0"
] | 0 |
2433e3dbcc44baa2253e2a7c748ba0216937933e
|
https://github.com/ALISCIFP/mmpose/tree/2433e3dbcc44baa2253e2a7c748ba0216937933e
|
L1Loss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/i5/ci5r22vnwphjxav3oibgww4fkm25q4egp3rofzniyjru2u4b563f.py
# Topologically Sorted Source Nodes: [sub, loss, loss_1, loss_bbox], Original ATen: [aten.sub, aten.abs, aten.mean, aten.mul]
# Source node to ATen node mapping:
# loss => abs_1
# loss_1 => mean
# loss_bbox => mul
# sub => sub
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %abs_1 : [num_users=1] = call_function[target=torch.ops.aten.abs.default](args = (%sub,), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%abs_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_abs_mean_mul_sub_0 = async_compile.triton('triton_per_fused_abs_mean_mul_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_abs_mean_mul_sub_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_abs_mean_mul_sub_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.load(in_ptr1 + (r0), None)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tmp7 = 256.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp10, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [sub, loss, loss_1, loss_bbox], Original ATen: [aten.sub, aten.abs, aten.mean, aten.mul]
stream0 = get_raw_stream(0)
triton_per_fused_abs_mean_mul_sub_0.run(buf1, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import functools
import torch
import torch.nn as nn
import torch.nn.functional as F
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def l1_loss(pred, target):
assert pred.size() == target.size() and target.numel() > 0
loss = torch.abs(pred - target)
return loss
class L1Loss(nn.Module):
def __init__(self, reduction='mean', loss_weight=1.0):
super(L1Loss, self).__init__()
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, pred, target, weight=None, avg_factor=None,
reduction_override=None):
assert reduction_override in (None, 'none', 'mean', 'sum')
reduction = (reduction_override if reduction_override else self.
reduction)
loss_bbox = self.loss_weight * l1_loss(pred, target, weight,
reduction=reduction, avg_factor=avg_factor)
return loss_bbox
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import functools
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_abs_mean_mul_sub_0(in_out_ptr0, in_ptr0, in_ptr1,
xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.load(in_ptr1 + r0, None)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tmp7 = 256.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp10, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_abs_mean_mul_sub_0[grid(1)](buf1, arg0_1, arg1_1,
1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def l1_loss(pred, target):
assert pred.size() == target.size() and target.numel() > 0
loss = torch.abs(pred - target)
return loss
class L1LossNew(nn.Module):
def __init__(self, reduction='mean', loss_weight=1.0):
super(L1LossNew, self).__init__()
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
CK-er/mmdet
|
L1Loss
| false | 2,063 |
[
"Apache-2.0"
] | 0 |
9bea4068efbcf7bf739dbe41917a68d525c29868
|
https://github.com/CK-er/mmdet/tree/9bea4068efbcf7bf739dbe41917a68d525c29868
|
SmoothNetResBlock
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/xq/cxq5gf6fvkdaf4nlflmjjam5s54pkng7rwuy4ocdtqxfwauulkm3.py
# Topologically Sorted Source Nodes: [x_2], Original ATen: [aten.leaky_relu, aten.leaky_relu_backward]
# Source node to ATen node mapping:
# x_2 => gt, mul, where
# Graph fragment:
# %gt : [num_users=1] = call_function[target=torch.ops.aten.gt.Scalar](args = (%view_1, 0), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_1, 0.2), kwargs = {})
# %where : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt, %view_1, %mul), kwargs = {})
# %gt_3 : [num_users=1] = call_function[target=torch.ops.aten.gt.Scalar](args = (%view_6, 0), kwargs = {})
triton_poi_fused_leaky_relu_leaky_relu_backward_0 = async_compile.triton('triton_poi_fused_leaky_relu_leaky_relu_backward_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_leaky_relu_leaky_relu_backward_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_leaky_relu_leaky_relu_backward_0(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x4 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x4), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = 0.0
tmp4 = tmp2 > tmp3
tmp5 = 0.2
tmp6 = tmp2 * tmp5
tmp7 = tl.where(tmp4, tmp2, tmp6)
tmp8 = tmp7 > tmp3
tl.store(in_out_ptr0 + (x4), tmp7, xmask)
tl.store(out_ptr0 + (x4), tmp8, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/6h/c6hgrncbhy7kjladlqflhqnw52mciqxt6qj53hxyw2giskevmcnl.py
# Topologically Sorted Source Nodes: [x_3], Original ATen: [aten.view]
# Source node to ATen node mapping:
# x_3 => view_7
# Graph fragment:
# %view_7 : [num_users=2] = call_function[target=torch.ops.aten.reshape.default](args = (%view_6, [64, 4]), kwargs = {})
triton_poi_fused_view_1 = async_compile.triton('triton_poi_fused_view_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_view_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_view_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = (xindex // 4)
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (4*x1) + (16*((x1 % 4) // 4)) + (64*(((4*((x1 // 4) % 4)) + (x1 % 4)) // 16))), xmask)
tl.store(out_ptr0 + (x2), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/3p/c3pn54vktnqrwzecjl443qler76w375obyy2bchjiwnavjqvule7.py
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.add, aten.leaky_relu_backward]
# Source node to ATen node mapping:
# out => add
# Graph fragment:
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_10, %primals_1), kwargs = {})
# %gt_2 : [num_users=1] = call_function[target=torch.ops.aten.gt.Scalar](args = (%view_10, 0), kwargs = {})
triton_poi_fused_add_leaky_relu_backward_2 = async_compile.triton('triton_poi_fused_add_leaky_relu_backward_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*i1', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_leaky_relu_backward_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_leaky_relu_backward_2(in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr1 + (x0), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr2 + (x3), xmask)
tmp2 = tmp0 + tmp1
tmp3 = 0.0
tmp4 = tmp2 > tmp3
tmp5 = 0.2
tmp6 = tmp2 * tmp5
tmp7 = tl.where(tmp4, tmp2, tmp6)
tmp9 = tmp7 + tmp8
tmp10 = tmp7 > tmp3
tl.store(out_ptr0 + (x3), tmp9, xmask)
tl.store(out_ptr1 + (x3), tmp10, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4, ), (1, ))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_1, (64, 4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), out=buf0)
del primals_2
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf0 # reuse
buf6 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
# Topologically Sorted Source Nodes: [x_2], Original ATen: [aten.leaky_relu, aten.leaky_relu_backward]
stream0 = get_raw_stream(0)
triton_poi_fused_leaky_relu_leaky_relu_backward_0.run(buf1, primals_3, buf6, 256, grid=grid(256), stream=stream0)
del primals_3
buf2 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x_3], Original ATen: [aten.view]
triton_poi_fused_view_1.run(buf1, buf2, 256, grid=grid(256), stream=stream0)
buf3 = reinterpret_tensor(buf1, (64, 4), (4, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(buf2, reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), out=buf3)
buf4 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf5 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.add, aten.leaky_relu_backward]
triton_poi_fused_add_leaky_relu_backward_2.run(buf3, primals_5, primals_1, buf4, buf5, 256, grid=grid(256), stream=stream0)
del buf3
del primals_5
return (buf4, reinterpret_tensor(primals_1, (64, 4), (4, 1), 0), buf2, buf5, primals_4, buf6, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class SmoothNetResBlock(nn.Module):
"""Residual block module used in SmoothNet.
Args:
in_channels (int): Input channel number.
hidden_channels (int): The hidden feature channel number.
dropout (float): Dropout probability. Default: 0.5
Shape:
Input: (*, in_channels)
Output: (*, in_channels)
"""
def __init__(self, in_channels, hidden_channels, dropout=0.5):
super().__init__()
self.linear1 = nn.Linear(in_channels, hidden_channels)
self.linear2 = nn.Linear(hidden_channels, in_channels)
self.lrelu = nn.LeakyReLU(0.2, inplace=True)
self.dropout = nn.Dropout(p=dropout, inplace=True)
def forward(self, x):
identity = x
x = self.linear1(x)
x = self.dropout(x)
x = self.lrelu(x)
x = self.linear2(x)
x = self.dropout(x)
x = self.lrelu(x)
out = x + identity
return out
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'in_channels': 4, 'hidden_channels': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_leaky_relu_leaky_relu_backward_0(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x4 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x4, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = 0.0
tmp4 = tmp2 > tmp3
tmp5 = 0.2
tmp6 = tmp2 * tmp5
tmp7 = tl.where(tmp4, tmp2, tmp6)
tmp8 = tmp7 > tmp3
tl.store(in_out_ptr0 + x4, tmp7, xmask)
tl.store(out_ptr0 + x4, tmp8, xmask)
@triton.jit
def triton_poi_fused_view_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = xindex // 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 4 * x1 + 16 * (x1 % 4 // 4) + 64 * ((4 *
(x1 // 4 % 4) + x1 % 4) // 16)), xmask)
tl.store(out_ptr0 + x2, tmp0, xmask)
@triton.jit
def triton_poi_fused_add_leaky_relu_backward_2(in_ptr0, in_ptr1, in_ptr2,
out_ptr0, out_ptr1, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr1 + x0, xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr2 + x3, xmask)
tmp2 = tmp0 + tmp1
tmp3 = 0.0
tmp4 = tmp2 > tmp3
tmp5 = 0.2
tmp6 = tmp2 * tmp5
tmp7 = tl.where(tmp4, tmp2, tmp6)
tmp9 = tmp7 + tmp8
tmp10 = tmp7 > tmp3
tl.store(out_ptr0 + x3, tmp9, xmask)
tl.store(out_ptr1 + x3, tmp10, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4,), (1,))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_1, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), out=buf0)
del primals_2
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf0
buf6 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
get_raw_stream(0)
triton_poi_fused_leaky_relu_leaky_relu_backward_0[grid(256)](buf1,
primals_3, buf6, 256, XBLOCK=128, num_warps=4, num_stages=1)
del primals_3
buf2 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
triton_poi_fused_view_1[grid(256)](buf1, buf2, 256, XBLOCK=256,
num_warps=4, num_stages=1)
buf3 = reinterpret_tensor(buf1, (64, 4), (4, 1), 0)
del buf1
extern_kernels.mm(buf2, reinterpret_tensor(primals_4, (4, 4), (1, 4
), 0), out=buf3)
buf4 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf5 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
triton_poi_fused_add_leaky_relu_backward_2[grid(256)](buf3,
primals_5, primals_1, buf4, buf5, 256, XBLOCK=128, num_warps=4,
num_stages=1)
del buf3
del primals_5
return buf4, reinterpret_tensor(primals_1, (64, 4), (4, 1), 0
), buf2, buf5, primals_4, buf6
class SmoothNetResBlockNew(nn.Module):
"""Residual block module used in SmoothNet.
Args:
in_channels (int): Input channel number.
hidden_channels (int): The hidden feature channel number.
dropout (float): Dropout probability. Default: 0.5
Shape:
Input: (*, in_channels)
Output: (*, in_channels)
"""
def __init__(self, in_channels, hidden_channels, dropout=0.5):
super().__init__()
self.linear1 = nn.Linear(in_channels, hidden_channels)
self.linear2 = nn.Linear(hidden_channels, in_channels)
self.lrelu = nn.LeakyReLU(0.2, inplace=True)
self.dropout = nn.Dropout(p=dropout, inplace=True)
def forward(self, input_0):
primals_2 = self.linear1.weight
primals_3 = self.linear1.bias
primals_4 = self.linear2.weight
primals_5 = self.linear2.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
ALISCIFP/mmpose
|
SmoothNetResBlock
| false | 2,064 |
[
"Apache-2.0"
] | 0 |
2433e3dbcc44baa2253e2a7c748ba0216937933e
|
https://github.com/ALISCIFP/mmpose/tree/2433e3dbcc44baa2253e2a7c748ba0216937933e
|
SmoothL1Loss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/t7/ct7n4vk2rjfplrvzzjcijiow2tdczppexhay5gcikb3dfjajcdzu.py
# Topologically Sorted Source Nodes: [sub, diff, lt, mul, mul_1, truediv, sub_1, loss, loss_1, loss_bbox], Original ATen: [aten.sub, aten.abs, aten.lt, aten.mul, aten.div, aten.where, aten.mean]
# Source node to ATen node mapping:
# diff => abs_1
# loss => where
# loss_1 => mean
# loss_bbox => mul_2
# lt => lt
# mul => mul
# mul_1 => mul_1
# sub => sub
# sub_1 => sub_1
# truediv => div
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %abs_1 : [num_users=4] = call_function[target=torch.ops.aten.abs.default](args = (%sub,), kwargs = {})
# %lt : [num_users=1] = call_function[target=torch.ops.aten.lt.Scalar](args = (%abs_1, 1.0), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%abs_1, 0.5), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul, %abs_1), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%mul_1, 1.0), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%abs_1, 0.5), kwargs = {})
# %where : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%lt, %div, %sub_1), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%where,), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_abs_div_lt_mean_mul_sub_where_0 = async_compile.triton('triton_per_fused_abs_div_lt_mean_mul_sub_where_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_abs_div_lt_mean_mul_sub_where_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_abs_div_lt_mean_mul_sub_where_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.load(in_ptr1 + (r0), None)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = 1.0
tmp5 = tmp3 < tmp4
tmp6 = 0.5
tmp7 = tmp3 * tmp6
tmp8 = tmp7 * tmp3
tmp9 = tmp8 * tmp4
tmp10 = tmp3 - tmp6
tmp11 = tl.where(tmp5, tmp9, tmp10)
tmp12 = tl.broadcast_to(tmp11, [RBLOCK])
tmp14 = triton_helpers.promote_to_tensor(tl.sum(tmp12, 0))
tmp15 = 256.0
tmp16 = tmp14 / tmp15
tmp17 = tmp16 * tmp4
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp17, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [sub, diff, lt, mul, mul_1, truediv, sub_1, loss, loss_1, loss_bbox], Original ATen: [aten.sub, aten.abs, aten.lt, aten.mul, aten.div, aten.where, aten.mean]
stream0 = get_raw_stream(0)
triton_per_fused_abs_div_lt_mean_mul_sub_where_0.run(buf1, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import functools
import torch
import torch.nn as nn
import torch.nn.functional as F
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def smooth_l1_loss(pred, target, beta=1.0):
assert beta > 0
assert pred.size() == target.size() and target.numel() > 0
diff = torch.abs(pred - target)
loss = torch.where(diff < beta, 0.5 * diff * diff / beta, diff - 0.5 * beta
)
return loss
class SmoothL1Loss(nn.Module):
def __init__(self, beta=1.0, reduction='mean', loss_weight=1.0):
super(SmoothL1Loss, self).__init__()
self.beta = beta
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, pred, target, weight=None, avg_factor=None,
reduction_override=None, **kwargs):
assert reduction_override in (None, 'none', 'mean', 'sum')
reduction = (reduction_override if reduction_override else self.
reduction)
loss_bbox = self.loss_weight * smooth_l1_loss(pred, target, weight,
beta=self.beta, reduction=reduction, avg_factor=avg_factor, **
kwargs)
return loss_bbox
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import functools
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_abs_div_lt_mean_mul_sub_where_0(in_out_ptr0, in_ptr0,
in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.load(in_ptr1 + r0, None)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = 1.0
tmp5 = tmp3 < tmp4
tmp6 = 0.5
tmp7 = tmp3 * tmp6
tmp8 = tmp7 * tmp3
tmp9 = tmp8 * tmp4
tmp10 = tmp3 - tmp6
tmp11 = tl.where(tmp5, tmp9, tmp10)
tmp12 = tl.broadcast_to(tmp11, [RBLOCK])
tmp14 = triton_helpers.promote_to_tensor(tl.sum(tmp12, 0))
tmp15 = 256.0
tmp16 = tmp14 / tmp15
tmp17 = tmp16 * tmp4
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp17, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_abs_div_lt_mean_mul_sub_where_0[grid(1)](buf1,
arg0_1, arg1_1, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def smooth_l1_loss(pred, target, beta=1.0):
assert beta > 0
assert pred.size() == target.size() and target.numel() > 0
diff = torch.abs(pred - target)
loss = torch.where(diff < beta, 0.5 * diff * diff / beta, diff - 0.5 * beta
)
return loss
class SmoothL1LossNew(nn.Module):
def __init__(self, beta=1.0, reduction='mean', loss_weight=1.0):
super(SmoothL1LossNew, self).__init__()
self.beta = beta
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
CK-er/mmdet
|
SmoothL1Loss
| false | 2,065 |
[
"Apache-2.0"
] | 0 |
9bea4068efbcf7bf739dbe41917a68d525c29868
|
https://github.com/CK-er/mmdet/tree/9bea4068efbcf7bf739dbe41917a68d525c29868
|
CrossEntropyLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/td/ctdj5kazgiki6gdaadhqtp2x7tq2ee5ey5hqqdcoqmp54jyhf74f.py
# Topologically Sorted Source Nodes: [loss], Original ATen: [aten._log_softmax]
# Source node to ATen node mapping:
# loss => amax, sub
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%arg0_1, [1], True), kwargs = {})
# %sub : [num_users=2] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %amax), kwargs = {})
triton_poi_fused__log_softmax_0 = async_compile.triton('triton_poi_fused__log_softmax_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__log_softmax_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__log_softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tl.store(out_ptr0 + (x3), tmp8, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/57/c572rujtphach6djeurlg5nv3rt5e37ifechqsganatcxbygg5m5.py
# Topologically Sorted Source Nodes: [loss, loss_1, loss_cls], Original ATen: [aten._log_softmax, aten.mul, aten.sum, aten.neg, aten.mean]
# Source node to ATen node mapping:
# loss => exp, log, mul, neg, sub_1, sum_1, sum_2
# loss_1 => mean
# loss_cls => mul_1
# Graph fragment:
# %exp : [num_users=1] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [1], True), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%sum_1,), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sub, %log), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub_1, %arg1_1), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%mul, [1]), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%sum_2,), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%neg,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused__log_softmax_mean_mul_neg_sum_1 = async_compile.triton('triton_per_fused__log_softmax_mean_mul_neg_sum_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__log_softmax_mean_mul_neg_sum_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__log_softmax_mean_mul_neg_sum_1(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 1
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex % 16
r1 = (rindex // 16)
tmp0 = tl.load(in_ptr0 + (r0 + (64*r1)), None)
tmp2 = tl.load(in_ptr0 + (16 + r0 + (64*r1)), None)
tmp5 = tl.load(in_ptr0 + (32 + r0 + (64*r1)), None)
tmp8 = tl.load(in_ptr0 + (48 + r0 + (64*r1)), None)
tmp13 = tl.load(in_ptr1 + (r0 + (64*r1)), None)
tmp16 = tl.load(in_ptr1 + (16 + r0 + (64*r1)), None)
tmp20 = tl.load(in_ptr1 + (32 + r0 + (64*r1)), None)
tmp24 = tl.load(in_ptr1 + (48 + r0 + (64*r1)), None)
tmp1 = tl_math.exp(tmp0)
tmp3 = tl_math.exp(tmp2)
tmp4 = tmp1 + tmp3
tmp6 = tl_math.exp(tmp5)
tmp7 = tmp4 + tmp6
tmp9 = tl_math.exp(tmp8)
tmp10 = tmp7 + tmp9
tmp11 = tl_math.log(tmp10)
tmp12 = tmp0 - tmp11
tmp14 = tmp12 * tmp13
tmp15 = tmp2 - tmp11
tmp17 = tmp15 * tmp16
tmp18 = tmp14 + tmp17
tmp19 = tmp5 - tmp11
tmp21 = tmp19 * tmp20
tmp22 = tmp18 + tmp21
tmp23 = tmp8 - tmp11
tmp25 = tmp23 * tmp24
tmp26 = tmp22 + tmp25
tmp27 = -tmp26
tmp28 = tl.broadcast_to(tmp27, [XBLOCK, RBLOCK])
tmp30 = tl.sum(tmp28, 1)[:, None]
tmp31 = 64.0
tmp32 = tmp30 / tmp31
tmp33 = 1.0
tmp34 = tmp32 * tmp33
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([XBLOCK, 1], 0, tl.int32)), tmp34, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [loss], Original ATen: [aten._log_softmax]
stream0 = get_raw_stream(0)
triton_poi_fused__log_softmax_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
buf1 = empty_strided_cuda((), (), torch.float32)
buf2 = buf1; del buf1 # reuse
# Topologically Sorted Source Nodes: [loss, loss_1, loss_cls], Original ATen: [aten._log_softmax, aten.mul, aten.sum, aten.neg, aten.mean]
triton_per_fused__log_softmax_mean_mul_neg_sum_1.run(buf2, buf0, arg1_1, 1, 64, grid=grid(1), stream=stream0)
del arg1_1
del buf0
return (buf2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Average factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def binary_cross_entropy(pred, label, weight=None, reduction='mean',
avg_factor=None, class_weight=None, pos_weight=None):
"""Calculate the binary CrossEntropy loss with logits.
Args:
pred (torch.Tensor): The prediction with shape (N, \\*).
label (torch.Tensor): The gt label with shape (N, \\*).
weight (torch.Tensor, optional): Element-wise weight of loss with shape
(N, ). Defaults to None.
reduction (str): The method used to reduce the loss.
Options are "none", "mean" and "sum". If reduction is 'none' , loss
is same shape as pred and label. Defaults to 'mean'.
avg_factor (int, optional): Average factor that is used to average
the loss. Defaults to None.
class_weight (torch.Tensor, optional): The weight for each class with
shape (C), C is the number of classes. Default None.
pos_weight (torch.Tensor, optional): The positive weight for each
class with shape (C), C is the number of classes. Default None.
Returns:
torch.Tensor: The calculated loss
"""
assert pred.dim() == label.dim()
if class_weight is not None:
N = pred.size()[0]
class_weight = class_weight.repeat(N, 1)
loss = F.binary_cross_entropy_with_logits(pred, label, weight=
class_weight, pos_weight=pos_weight, reduction='none')
if weight is not None:
assert weight.dim() == 1
weight = weight.float()
if pred.dim() > 1:
weight = weight.reshape(-1, 1)
loss = weight_reduce_loss(loss, weight=weight, reduction=reduction,
avg_factor=avg_factor)
return loss
def cross_entropy(pred, label, weight=None, reduction='mean', avg_factor=
None, class_weight=None):
"""Calculate the CrossEntropy loss.
Args:
pred (torch.Tensor): The prediction with shape (N, C), C is the number
of classes.
label (torch.Tensor): The gt label of the prediction.
weight (torch.Tensor, optional): Sample-wise loss weight.
reduction (str): The method used to reduce the loss.
avg_factor (int, optional): Average factor that is used to average
the loss. Defaults to None.
class_weight (torch.Tensor, optional): The weight for each class with
shape (C), C is the number of classes. Default None.
Returns:
torch.Tensor: The calculated loss
"""
loss = F.cross_entropy(pred, label, weight=class_weight, reduction='none')
if weight is not None:
weight = weight.float()
loss = weight_reduce_loss(loss, weight=weight, reduction=reduction,
avg_factor=avg_factor)
return loss
def soft_cross_entropy(pred, label, weight=None, reduction='mean',
class_weight=None, avg_factor=None):
"""Calculate the Soft CrossEntropy loss.
The label can be float.
Args:
pred (torch.Tensor): The prediction with shape (N, C), C is the number
of classes.
label (torch.Tensor): The gt label of the prediction with shape (N, C).
When using "mixup", the label can be float.
weight (torch.Tensor, optional): Sample-wise loss weight.
reduction (str): The method used to reduce the loss.
avg_factor (int, optional): Average factor that is used to average
the loss. Defaults to None.
class_weight (torch.Tensor, optional): The weight for each class with
shape (C), C is the number of classes. Default None.
Returns:
torch.Tensor: The calculated loss
"""
loss = -label * F.log_softmax(pred, dim=-1)
if class_weight is not None:
loss *= class_weight
loss = loss.sum(dim=-1)
if weight is not None:
weight = weight.float()
loss = weight_reduce_loss(loss, weight=weight, reduction=reduction,
avg_factor=avg_factor)
return loss
class CrossEntropyLoss(nn.Module):
"""Cross entropy loss.
Args:
use_sigmoid (bool): Whether the prediction uses sigmoid
of softmax. Defaults to False.
use_soft (bool): Whether to use the soft version of CrossEntropyLoss.
Defaults to False.
reduction (str): The method used to reduce the loss.
Options are "none", "mean" and "sum". Defaults to 'mean'.
loss_weight (float): Weight of the loss. Defaults to 1.0.
class_weight (List[float], optional): The weight for each class with
shape (C), C is the number of classes. Default None.
pos_weight (List[float], optional): The positive weight for each
class with shape (C), C is the number of classes. Only enabled in
BCE loss when ``use_sigmoid`` is True. Default None.
"""
def __init__(self, use_sigmoid=False, use_soft=False, reduction='mean',
loss_weight=1.0, class_weight=None, pos_weight=None):
super(CrossEntropyLoss, self).__init__()
self.use_sigmoid = use_sigmoid
self.use_soft = use_soft
assert not (self.use_soft and self.use_sigmoid
), 'use_sigmoid and use_soft could not be set simultaneously'
self.reduction = reduction
self.loss_weight = loss_weight
self.class_weight = class_weight
self.pos_weight = pos_weight
if self.use_sigmoid:
self.cls_criterion = binary_cross_entropy
elif self.use_soft:
self.cls_criterion = soft_cross_entropy
else:
self.cls_criterion = cross_entropy
def forward(self, cls_score, label, weight=None, avg_factor=None,
reduction_override=None, **kwargs):
assert reduction_override in (None, 'none', 'mean', 'sum')
reduction = (reduction_override if reduction_override else self.
reduction)
if self.class_weight is not None:
class_weight = cls_score.new_tensor(self.class_weight)
else:
class_weight = None
if self.pos_weight is not None and self.use_sigmoid:
pos_weight = cls_score.new_tensor(self.pos_weight)
kwargs.update({'pos_weight': pos_weight})
else:
pos_weight = None
loss_cls = self.loss_weight * self.cls_criterion(cls_score, label,
weight, class_weight=class_weight, reduction=reduction,
avg_factor=avg_factor, **kwargs)
return loss_cls
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused__log_softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tl.store(out_ptr0 + x3, tmp8, xmask)
@triton.jit
def triton_per_fused__log_softmax_mean_mul_neg_sum_1(in_out_ptr0, in_ptr0,
in_ptr1, xnumel, rnumel, XBLOCK: tl.constexpr):
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xoffset + tl.arange(0, XBLOCK)[:, None]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex % 16
r1 = rindex // 16
tmp0 = tl.load(in_ptr0 + (r0 + 64 * r1), None)
tmp2 = tl.load(in_ptr0 + (16 + r0 + 64 * r1), None)
tmp5 = tl.load(in_ptr0 + (32 + r0 + 64 * r1), None)
tmp8 = tl.load(in_ptr0 + (48 + r0 + 64 * r1), None)
tmp13 = tl.load(in_ptr1 + (r0 + 64 * r1), None)
tmp16 = tl.load(in_ptr1 + (16 + r0 + 64 * r1), None)
tmp20 = tl.load(in_ptr1 + (32 + r0 + 64 * r1), None)
tmp24 = tl.load(in_ptr1 + (48 + r0 + 64 * r1), None)
tmp1 = tl_math.exp(tmp0)
tmp3 = tl_math.exp(tmp2)
tmp4 = tmp1 + tmp3
tmp6 = tl_math.exp(tmp5)
tmp7 = tmp4 + tmp6
tmp9 = tl_math.exp(tmp8)
tmp10 = tmp7 + tmp9
tmp11 = tl_math.log(tmp10)
tmp12 = tmp0 - tmp11
tmp14 = tmp12 * tmp13
tmp15 = tmp2 - tmp11
tmp17 = tmp15 * tmp16
tmp18 = tmp14 + tmp17
tmp19 = tmp5 - tmp11
tmp21 = tmp19 * tmp20
tmp22 = tmp18 + tmp21
tmp23 = tmp8 - tmp11
tmp25 = tmp23 * tmp24
tmp26 = tmp22 + tmp25
tmp27 = -tmp26
tmp28 = tl.broadcast_to(tmp27, [XBLOCK, RBLOCK])
tmp30 = tl.sum(tmp28, 1)[:, None]
tmp31 = 64.0
tmp32 = tmp30 / tmp31
tmp33 = 1.0
tmp34 = tmp32 * tmp33
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([XBLOCK, 1], 0, tl.int32), tmp34, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused__log_softmax_0[grid(256)](arg0_1, buf0, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del arg0_1
buf1 = empty_strided_cuda((), (), torch.float32)
buf2 = buf1
del buf1
triton_per_fused__log_softmax_mean_mul_neg_sum_1[grid(1)](buf2,
buf0, arg1_1, 1, 64, XBLOCK=1, num_warps=2, num_stages=1)
del arg1_1
del buf0
return buf2,
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Average factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def binary_cross_entropy(pred, label, weight=None, reduction='mean',
avg_factor=None, class_weight=None, pos_weight=None):
"""Calculate the binary CrossEntropy loss with logits.
Args:
pred (torch.Tensor): The prediction with shape (N, \\*).
label (torch.Tensor): The gt label with shape (N, \\*).
weight (torch.Tensor, optional): Element-wise weight of loss with shape
(N, ). Defaults to None.
reduction (str): The method used to reduce the loss.
Options are "none", "mean" and "sum". If reduction is 'none' , loss
is same shape as pred and label. Defaults to 'mean'.
avg_factor (int, optional): Average factor that is used to average
the loss. Defaults to None.
class_weight (torch.Tensor, optional): The weight for each class with
shape (C), C is the number of classes. Default None.
pos_weight (torch.Tensor, optional): The positive weight for each
class with shape (C), C is the number of classes. Default None.
Returns:
torch.Tensor: The calculated loss
"""
assert pred.dim() == label.dim()
if class_weight is not None:
N = pred.size()[0]
class_weight = class_weight.repeat(N, 1)
loss = F.binary_cross_entropy_with_logits(pred, label, weight=
class_weight, pos_weight=pos_weight, reduction='none')
if weight is not None:
assert weight.dim() == 1
weight = weight.float()
if pred.dim() > 1:
weight = weight.reshape(-1, 1)
loss = weight_reduce_loss(loss, weight=weight, reduction=reduction,
avg_factor=avg_factor)
return loss
def cross_entropy(pred, label, weight=None, reduction='mean', avg_factor=
None, class_weight=None):
"""Calculate the CrossEntropy loss.
Args:
pred (torch.Tensor): The prediction with shape (N, C), C is the number
of classes.
label (torch.Tensor): The gt label of the prediction.
weight (torch.Tensor, optional): Sample-wise loss weight.
reduction (str): The method used to reduce the loss.
avg_factor (int, optional): Average factor that is used to average
the loss. Defaults to None.
class_weight (torch.Tensor, optional): The weight for each class with
shape (C), C is the number of classes. Default None.
Returns:
torch.Tensor: The calculated loss
"""
loss = F.cross_entropy(pred, label, weight=class_weight, reduction='none')
if weight is not None:
weight = weight.float()
loss = weight_reduce_loss(loss, weight=weight, reduction=reduction,
avg_factor=avg_factor)
return loss
def soft_cross_entropy(pred, label, weight=None, reduction='mean',
class_weight=None, avg_factor=None):
"""Calculate the Soft CrossEntropy loss.
The label can be float.
Args:
pred (torch.Tensor): The prediction with shape (N, C), C is the number
of classes.
label (torch.Tensor): The gt label of the prediction with shape (N, C).
When using "mixup", the label can be float.
weight (torch.Tensor, optional): Sample-wise loss weight.
reduction (str): The method used to reduce the loss.
avg_factor (int, optional): Average factor that is used to average
the loss. Defaults to None.
class_weight (torch.Tensor, optional): The weight for each class with
shape (C), C is the number of classes. Default None.
Returns:
torch.Tensor: The calculated loss
"""
loss = -label * F.log_softmax(pred, dim=-1)
if class_weight is not None:
loss *= class_weight
loss = loss.sum(dim=-1)
if weight is not None:
weight = weight.float()
loss = weight_reduce_loss(loss, weight=weight, reduction=reduction,
avg_factor=avg_factor)
return loss
class CrossEntropyLossNew(nn.Module):
"""Cross entropy loss.
Args:
use_sigmoid (bool): Whether the prediction uses sigmoid
of softmax. Defaults to False.
use_soft (bool): Whether to use the soft version of CrossEntropyLoss.
Defaults to False.
reduction (str): The method used to reduce the loss.
Options are "none", "mean" and "sum". Defaults to 'mean'.
loss_weight (float): Weight of the loss. Defaults to 1.0.
class_weight (List[float], optional): The weight for each class with
shape (C), C is the number of classes. Default None.
pos_weight (List[float], optional): The positive weight for each
class with shape (C), C is the number of classes. Only enabled in
BCE loss when ``use_sigmoid`` is True. Default None.
"""
def __init__(self, use_sigmoid=False, use_soft=False, reduction='mean',
loss_weight=1.0, class_weight=None, pos_weight=None):
super(CrossEntropyLossNew, self).__init__()
self.use_sigmoid = use_sigmoid
self.use_soft = use_soft
assert not (self.use_soft and self.use_sigmoid
), 'use_sigmoid and use_soft could not be set simultaneously'
self.reduction = reduction
self.loss_weight = loss_weight
self.class_weight = class_weight
self.pos_weight = pos_weight
if self.use_sigmoid:
self.cls_criterion = binary_cross_entropy
elif self.use_soft:
self.cls_criterion = soft_cross_entropy
else:
self.cls_criterion = cross_entropy
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
CAMP-eXplain-AI/imba-explain
|
CrossEntropyLoss
| false | 2,066 |
[
"MIT"
] | 0 |
e41b4ca5de63955cb0e925aad9599f38c5a3e973
|
https://github.com/CAMP-eXplain-AI/imba-explain/tree/e41b4ca5de63955cb0e925aad9599f38c5a3e973
|
ConvBlockINEDense
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/d5/cd5m3j5auxbszyzvbqqxqrtrkrxq26jxju4ar5ny6zgmqowfs5hg.py
# Topologically Sorted Source Nodes: [pad], Original ATen: [aten.copy]
# Source node to ATen node mapping:
# pad => copy
# Graph fragment:
# %copy : [num_users=1] = call_function[target=torch.ops.aten.copy.default](args = (%slice_3, %slice_4), kwargs = {})
# %slice_scatter_default : [num_users=1] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_tensor, %copy, 2, 1, 5), kwargs = {})
# %slice_scatter_default_1 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%empty, %slice_scatter_default, 3, 1, 5), kwargs = {})
# %slice_scatter_default_2 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_1, %slice_11, 3, 0, 1), kwargs = {})
# %slice_scatter_default_3 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_2, %slice_16, 3, 5, 6), kwargs = {})
triton_poi_fused_copy_0 = async_compile.triton('triton_poi_fused_copy_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_copy_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_copy_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 576
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = (xindex // 6) % 6
x2 = (xindex // 36)
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp15 & xmask, other=0.0)
tmp17 = tl.load(in_ptr1 + (x4), tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float("nan")
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + ((-9) + x0 + (4*x1) + (16*x2)), tmp29 & xmask, other=0.0)
tmp31 = tl.load(in_ptr1 + ((-4) + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + ((-1) + x0 + (4*x1) + (16*x2)), tmp45 & xmask, other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp54 & xmask, other=0.0)
tmp56 = tl.load(in_ptr1 + (x4), tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + (x4), tmp62, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/w6/cw6our4iotwhi2wfr4hvczz23dzsphqyor2wfejso3djq53u3bto.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %slice_scatter_default_4 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_3, %slice_21, 2, 0, 1), kwargs = {})
# %slice_scatter_default_5 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_4, %slice_26, 2, 5, 6), kwargs = {})
triton_poi_fused_1 = async_compile.triton('triton_poi_fused_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 576
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 6) % 6
x0 = xindex % 6
x2 = (xindex // 36)
x3 = xindex
tmp14 = tl.load(in_ptr0 + (x3), xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + ((-24) + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp12 & xmask, eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/pf/cpfj2j5thtmk2ayd6xbswuvgaicbzkut5yj72bijwuwed2t2c6lr.py
# Topologically Sorted Source Nodes: [x1, x1_2, x2, x3, x4], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.cat]
# Source node to ATen node mapping:
# x1 => convolution
# x1_2 => add, add_1, mul, mul_1, repeat, rsqrt, sub, var_mean
# x2 => cat
# x3 => cat_1
# x4 => cat_2
# Graph fragment:
# %convolution : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%slice_scatter_default_5, %primals_1, %primals_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %repeat : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_4, [4]), kwargs = {})
# %var_mean : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_1, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem, 1e-05), kwargs = {})
# %rsqrt : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add,), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_1, %getitem_1), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, %rsqrt), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul, %unsqueeze_1), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, %unsqueeze_3), kwargs = {})
# %cat : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_2, %primals_3], 1), kwargs = {})
# %cat_1 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_5, %view_2, %primals_3], 1), kwargs = {})
# %cat_2 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_8, %view_5, %view_2, %primals_3], 1), kwargs = {})
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_2 = async_compile.triton('triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 16],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: '*fp32', 9: '*fp32', 10: 'i32', 11: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_2', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_2(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr4, out_ptr5, out_ptr6, out_ptr7, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 4
x2 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x0 % 4), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_out_ptr0 + (r3 + (16*x0)), xmask, other=0.0)
tmp2 = tl.load(in_ptr1 + (x1), xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + (x0 % 4), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp4 = tl.full([1, 1], 0, tl.int32)
tmp5 = triton_helpers.maximum(tmp4, tmp3)
tmp6 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp8 = tl.where(xmask, tmp6, 0)
tmp9 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp11 = tl.where(xmask, tmp9, 0)
tmp12 = tl.sum(tmp11, 1)[:, None]
tmp13 = tl.full([XBLOCK, 1], 16, tl.int32)
tmp14 = tmp13.to(tl.float32)
tmp15 = tmp12 / tmp14
tmp16 = tmp6 - tmp15
tmp17 = tmp16 * tmp16
tmp18 = tl.broadcast_to(tmp17, [XBLOCK, RBLOCK])
tmp20 = tl.where(xmask, tmp18, 0)
tmp21 = tl.sum(tmp20, 1)[:, None]
tmp22 = tmp5 - tmp15
tmp23 = 16.0
tmp24 = tmp21 / tmp23
tmp25 = 1e-05
tmp26 = tmp24 + tmp25
tmp27 = libdevice.rsqrt(tmp26)
tmp28 = tmp22 * tmp27
tmp29 = tmp28 * tmp0
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + (x0), tmp0, xmask)
tl.store(in_out_ptr0 + (r3 + (16*x0)), tmp3, xmask)
tl.store(out_ptr4 + (r3 + (16*x1) + (128*x2)), tmp31, xmask)
tl.store(out_ptr5 + (r3 + (16*x1) + (192*x2)), tmp31, xmask)
tl.store(out_ptr6 + (r3 + (16*x1) + (256*x2)), tmp31, xmask)
tl.store(out_ptr7 + (x0), tmp27, xmask)
tl.store(out_ptr1 + (x0), tmp15, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/u5/cu5x2dkgixpjrtx2uup2z6jkyeuyvwihgzv3zh3yrl7i2lpwyzyk.py
# Topologically Sorted Source Nodes: [x2, x3, x4], Original ATen: [aten.cat]
# Source node to ATen node mapping:
# x2 => cat
# x3 => cat_1
# x4 => cat_2
# Graph fragment:
# %cat : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_2, %primals_3], 1), kwargs = {})
# %cat_1 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_5, %view_2, %primals_3], 1), kwargs = {})
# %cat_2 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_8, %view_5, %view_2, %primals_3], 1), kwargs = {})
triton_poi_fused_cat_3 = async_compile.triton('triton_poi_fused_cat_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_3(in_ptr0, out_ptr0, out_ptr1, out_ptr2, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 64
x1 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tl.store(out_ptr0 + (x0 + (128*x1)), tmp0, xmask)
tl.store(out_ptr1 + (x0 + (192*x1)), tmp0, xmask)
tl.store(out_ptr2 + (x0 + (256*x1)), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/v2/cv266dyuvwuox4q2yeqcnngiopdemgeb2jg4czamcu6e6ikcpbts.py
# Topologically Sorted Source Nodes: [pad_1], Original ATen: [aten.copy]
# Source node to ATen node mapping:
# pad_1 => copy_5
# Graph fragment:
# %copy_5 : [num_users=1] = call_function[target=torch.ops.aten.copy.default](args = (%slice_30, %slice_31), kwargs = {})
# %slice_scatter_default_6 : [num_users=1] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_tensor_1, %copy_5, 2, 1, 5), kwargs = {})
# %slice_scatter_default_7 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%empty_1, %slice_scatter_default_6, 3, 1, 5), kwargs = {})
# %slice_scatter_default_8 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_7, %slice_40, 3, 0, 1), kwargs = {})
# %slice_scatter_default_9 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_8, %slice_46, 3, 5, 6), kwargs = {})
triton_poi_fused_copy_4 = async_compile.triton('triton_poi_fused_copy_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_copy_4', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_copy_4(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = (xindex // 6) % 6
x2 = (xindex // 36)
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp15 & xmask, other=0.0)
tmp17 = tl.load(in_ptr1 + (x4), tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float("nan")
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + ((-9) + x0 + (4*x1) + (16*x2)), tmp29 & xmask, other=0.0)
tmp31 = tl.load(in_ptr1 + ((-4) + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + ((-1) + x0 + (4*x1) + (16*x2)), tmp45 & xmask, other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp54 & xmask, other=0.0)
tmp56 = tl.load(in_ptr1 + (x4), tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + (x4), tmp62, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/bl/cbl4dw6ni4z3enptw2gt5tprqiovmm6hmoggmo6wqf3c2ph6hccs.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %slice_scatter_default_10 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_9, %slice_52, 2, 0, 1), kwargs = {})
# %slice_scatter_default_11 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_10, %slice_58, 2, 5, 6), kwargs = {})
triton_poi_fused_5 = async_compile.triton('triton_poi_fused_5', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_5', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_5(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 6) % 6
x0 = xindex % 6
x2 = (xindex // 36)
x3 = xindex
tmp14 = tl.load(in_ptr0 + (x3), xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + ((-24) + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp12 & xmask, eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/5k/c5kfm2w5wf3ffipda5umbqwjxacqgc5nw37meorne5sojjxx2abp.py
# Topologically Sorted Source Nodes: [x2_1, x2_3, x3, x4], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.cat]
# Source node to ATen node mapping:
# x2_1 => convolution_1
# x2_3 => add_2, add_3, mul_2, mul_3, repeat_2, rsqrt_1, sub_1, var_mean_1
# x3 => cat_1
# x4 => cat_2
# Graph fragment:
# %convolution_1 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%slice_scatter_default_11, %primals_6, %primals_7, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %repeat_2 : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_8, [4]), kwargs = {})
# %var_mean_1 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_4, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_2, 1e-05), kwargs = {})
# %rsqrt_1 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_2,), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_4, %getitem_3), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub_1, %rsqrt_1), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_2, %unsqueeze_5), kwargs = {})
# %add_3 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_3, %unsqueeze_7), kwargs = {})
# %cat_1 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_5, %view_2, %primals_3], 1), kwargs = {})
# %cat_2 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_8, %view_5, %view_2, %primals_3], 1), kwargs = {})
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_6 = async_compile.triton('triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_6', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 16],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: '*fp32', 9: 'i32', 10: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_6', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_6(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr4, out_ptr5, out_ptr6, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 4
x2 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x0 % 4), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_out_ptr0 + (r3 + (16*x0)), xmask, other=0.0)
tmp2 = tl.load(in_ptr1 + (x1), xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + (x0 % 4), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp4 = tl.full([1, 1], 0, tl.int32)
tmp5 = triton_helpers.maximum(tmp4, tmp3)
tmp6 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp8 = tl.where(xmask, tmp6, 0)
tmp9 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp11 = tl.where(xmask, tmp9, 0)
tmp12 = tl.sum(tmp11, 1)[:, None]
tmp13 = tl.full([XBLOCK, 1], 16, tl.int32)
tmp14 = tmp13.to(tl.float32)
tmp15 = tmp12 / tmp14
tmp16 = tmp6 - tmp15
tmp17 = tmp16 * tmp16
tmp18 = tl.broadcast_to(tmp17, [XBLOCK, RBLOCK])
tmp20 = tl.where(xmask, tmp18, 0)
tmp21 = tl.sum(tmp20, 1)[:, None]
tmp22 = tmp5 - tmp15
tmp23 = 16.0
tmp24 = tmp21 / tmp23
tmp25 = 1e-05
tmp26 = tmp24 + tmp25
tmp27 = libdevice.rsqrt(tmp26)
tmp28 = tmp22 * tmp27
tmp29 = tmp28 * tmp0
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + (x0), tmp0, xmask)
tl.store(in_out_ptr0 + (r3 + (16*x0)), tmp3, xmask)
tl.store(out_ptr4 + (r3 + (16*x1) + (192*x2)), tmp31, xmask)
tl.store(out_ptr5 + (r3 + (16*x1) + (256*x2)), tmp31, xmask)
tl.store(out_ptr6 + (x0), tmp27, xmask)
tl.store(out_ptr1 + (x0), tmp15, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/7e/c7eo2pwbxu4vcfb4udblnmwaeqalnsdr2qphijyhavbhdhwvfmcs.py
# Topologically Sorted Source Nodes: [pad_2], Original ATen: [aten.copy]
# Source node to ATen node mapping:
# pad_2 => copy_10
# Graph fragment:
# %copy_10 : [num_users=1] = call_function[target=torch.ops.aten.copy.default](args = (%slice_63, %slice_64), kwargs = {})
# %slice_scatter_default_12 : [num_users=1] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_tensor_2, %copy_10, 2, 1, 5), kwargs = {})
# %slice_scatter_default_13 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%empty_2, %slice_scatter_default_12, 3, 1, 5), kwargs = {})
# %slice_scatter_default_14 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_13, %slice_73, 3, 0, 1), kwargs = {})
# %slice_scatter_default_15 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_14, %slice_79, 3, 5, 6), kwargs = {})
triton_poi_fused_copy_7 = async_compile.triton('triton_poi_fused_copy_7', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_copy_7', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_copy_7(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1728
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = (xindex // 6) % 6
x2 = (xindex // 36)
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp15 & xmask, other=0.0)
tmp17 = tl.load(in_ptr1 + (x4), tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float("nan")
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + ((-9) + x0 + (4*x1) + (16*x2)), tmp29 & xmask, other=0.0)
tmp31 = tl.load(in_ptr1 + ((-4) + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + ((-1) + x0 + (4*x1) + (16*x2)), tmp45 & xmask, other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp54 & xmask, other=0.0)
tmp56 = tl.load(in_ptr1 + (x4), tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + (x4), tmp62, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/x4/cx4swemiiq5ss7dkzi3fqqflwd4l3wds4gwvstjyiejfxigsymok.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %slice_scatter_default_16 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_15, %slice_85, 2, 0, 1), kwargs = {})
# %slice_scatter_default_17 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_16, %slice_91, 2, 5, 6), kwargs = {})
triton_poi_fused_8 = async_compile.triton('triton_poi_fused_8', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_8', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_8(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1728
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 6) % 6
x0 = xindex % 6
x2 = (xindex // 36)
x3 = xindex
tmp14 = tl.load(in_ptr0 + (x3), xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + ((-24) + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp12 & xmask, eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/tu/ctuulksaeggyrw7cyhr37rdzzxlul6j2pscc7n4gedj32vagu5jl.py
# Topologically Sorted Source Nodes: [x3_1, x3_3, x4], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.cat]
# Source node to ATen node mapping:
# x3_1 => convolution_2
# x3_3 => add_4, repeat_4, rsqrt_2, var_mean_2
# x4 => cat_2
# Graph fragment:
# %convolution_2 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%slice_scatter_default_17, %primals_10, %primals_11, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %repeat_4 : [num_users=2] = call_function[target=torch.ops.aten.repeat.default](args = (%primals_12, [4]), kwargs = {})
# %var_mean_2 : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view_7, [0, 2, 3]), kwargs = {correction: 0, keepdim: True})
# %add_4 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem_4, 1e-05), kwargs = {})
# %rsqrt_2 : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add_4,), kwargs = {})
# %cat_2 : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_8, %view_5, %view_2, %primals_3], 1), kwargs = {})
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_9 = async_compile.triton('triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_9', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 16],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: 'i32', 9: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8, 9), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_9', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_9(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr3, out_ptr4, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 4
x2 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x0 % 4), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_out_ptr0 + (r3 + (16*x0)), xmask, other=0.0)
tmp2 = tl.load(in_ptr1 + (x1), xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + (x1), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp4 = tl.full([1, 1], 0, tl.int32)
tmp5 = triton_helpers.maximum(tmp4, tmp3)
tmp6 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tmp8 = tl.where(xmask, tmp6, 0)
tmp9 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp11 = tl.where(xmask, tmp9, 0)
tmp12 = tl.sum(tmp11, 1)[:, None]
tmp13 = tl.full([XBLOCK, 1], 16, tl.int32)
tmp14 = tmp13.to(tl.float32)
tmp15 = tmp12 / tmp14
tmp16 = tmp6 - tmp15
tmp17 = tmp16 * tmp16
tmp18 = tl.broadcast_to(tmp17, [XBLOCK, RBLOCK])
tmp20 = tl.where(xmask, tmp18, 0)
tmp21 = tl.sum(tmp20, 1)[:, None]
tmp22 = tmp5 - tmp15
tmp23 = 16.0
tmp24 = tmp21 / tmp23
tmp25 = 1e-05
tmp26 = tmp24 + tmp25
tmp27 = libdevice.rsqrt(tmp26)
tmp28 = tmp22 * tmp27
tmp29 = tmp28 * tmp0
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + (x0), tmp0, xmask)
tl.store(in_out_ptr0 + (r3 + (16*x0)), tmp3, xmask)
tl.store(out_ptr3 + (r3 + (16*x1) + (256*x2)), tmp31, xmask)
tl.store(out_ptr4 + (x0), tmp27, xmask)
tl.store(out_ptr1 + (x0), tmp15, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/2b/c2bkgnd3cuthxjljazr4mj42avg33dzpmylkadwq2fkytdy5pisd.py
# Topologically Sorted Source Nodes: [pad_3], Original ATen: [aten.copy]
# Source node to ATen node mapping:
# pad_3 => copy_15
# Graph fragment:
# %copy_15 : [num_users=1] = call_function[target=torch.ops.aten.copy.default](args = (%slice_96, %slice_97), kwargs = {})
# %slice_scatter_default_18 : [num_users=1] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_tensor_3, %copy_15, 2, 1, 5), kwargs = {})
# %slice_scatter_default_19 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%empty_3, %slice_scatter_default_18, 3, 1, 5), kwargs = {})
# %slice_scatter_default_20 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_19, %slice_106, 3, 0, 1), kwargs = {})
# %slice_scatter_default_21 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_20, %slice_112, 3, 5, 6), kwargs = {})
triton_poi_fused_copy_10 = async_compile.triton('triton_poi_fused_copy_10', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4096],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_copy_10', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_copy_10(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 2304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = (xindex // 6) % 6
x2 = (xindex // 36)
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp15 & xmask, other=0.0)
tmp17 = tl.load(in_ptr1 + (x4), tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float("nan")
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + ((-9) + x0 + (4*x1) + (16*x2)), tmp29 & xmask, other=0.0)
tmp31 = tl.load(in_ptr1 + ((-4) + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + ((-1) + x0 + (4*x1) + (16*x2)), tmp45 & xmask, other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp54 & xmask, other=0.0)
tmp56 = tl.load(in_ptr1 + (x4), tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + (x4), tmp62, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/yq/cyqia2t74oth2xmpw3wy67dajhytppay533s3qznmeunx7sbnrf5.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %slice_scatter_default_22 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_21, %slice_118, 2, 0, 1), kwargs = {})
# %slice_scatter_default_23 : [num_users=2] = call_function[target=torch.ops.aten.slice_scatter.default](args = (%slice_scatter_default_22, %slice_124, 2, 5, 6), kwargs = {})
triton_poi_fused_11 = async_compile.triton('triton_poi_fused_11', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4096],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_11', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_11(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 2304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 6) % 6
x0 = xindex % 6
x2 = (xindex // 36)
x3 = xindex
tmp14 = tl.load(in_ptr0 + (x3), xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = (-4) + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + ((-24) + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + (36*x2)), tmp12 & xmask, eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/3z/c3z7somucyhaymf7nx4yl5ne7522e2dc6gxs2vz3qdu6shtmayoa.py
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# out => convolution_3
# Graph fragment:
# %convolution_3 : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%slice_scatter_default_23, %primals_14, %primals_15, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_12 = async_compile.triton('triton_poi_fused_convolution_12', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_12', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_12(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, ), (1, ))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 8, 3, 3), (72, 9, 3, 1))
assert_size_stride(primals_7, (4, ), (1, ))
assert_size_stride(primals_8, (4, ), (1, ))
assert_size_stride(primals_9, (4, ), (1, ))
assert_size_stride(primals_10, (4, 12, 3, 3), (108, 9, 3, 1))
assert_size_stride(primals_11, (4, ), (1, ))
assert_size_stride(primals_12, (4, ), (1, ))
assert_size_stride(primals_13, (4, ), (1, ))
assert_size_stride(primals_14, (4, 16, 3, 3), (144, 9, 3, 1))
assert_size_stride(primals_15, (4, ), (1, ))
buf0 = empty_strided_cuda((4, 4, 6, 6), (144, 36, 6, 1), torch.float32)
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((4, 4, 6, 6), (144, 36, 6, 1), torch.float32)
# Topologically Sorted Source Nodes: [pad], Original ATen: [aten.copy]
stream0 = get_raw_stream(0)
triton_poi_fused_copy_0.run(primals_3, buf0, buf1, 576, grid=grid(576), stream=stream0)
buf2 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_1.run(buf1, buf2, 576, grid=grid(576), stream=stream0)
del buf1
# Topologically Sorted Source Nodes: [x1], Original ATen: [aten.convolution]
buf3 = extern_kernels.convolution(buf2, primals_1, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf3, (4, 4, 4, 4), (64, 16, 4, 1))
buf5 = empty_strided_cuda((16, ), (1, ), torch.float32)
buf4 = buf3; del buf3 # reuse
buf6 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.float32)
buf13 = empty_strided_cuda((4, 8, 4, 4), (128, 16, 4, 1), torch.float32)
buf11 = reinterpret_tensor(buf13, (4, 4, 4, 4), (128, 16, 4, 1), 0) # alias
buf28 = empty_strided_cuda((4, 12, 4, 4), (192, 16, 4, 1), torch.float32)
buf26 = reinterpret_tensor(buf28, (4, 4, 4, 4), (192, 16, 4, 1), 64) # alias
buf43 = empty_strided_cuda((4, 16, 4, 4), (256, 16, 4, 1), torch.float32)
buf41 = reinterpret_tensor(buf43, (4, 4, 4, 4), (256, 16, 4, 1), 128) # alias
buf9 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.float32)
# Topologically Sorted Source Nodes: [x1, x1_2, x2, x3, x4], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.cat]
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_2.run(buf4, primals_4, primals_2, primals_5, buf5, buf6, buf11, buf26, buf41, buf9, 16, 16, grid=grid(16), stream=stream0)
del primals_2
del primals_4
del primals_5
buf12 = reinterpret_tensor(buf13, (4, 4, 4, 4), (128, 16, 4, 1), 64) # alias
buf27 = reinterpret_tensor(buf28, (4, 4, 4, 4), (192, 16, 4, 1), 128) # alias
buf42 = reinterpret_tensor(buf43, (4, 4, 4, 4), (256, 16, 4, 1), 192) # alias
# Topologically Sorted Source Nodes: [x2, x3, x4], Original ATen: [aten.cat]
triton_poi_fused_cat_3.run(primals_3, buf12, buf27, buf42, 256, grid=grid(256), stream=stream0)
del primals_3
buf14 = empty_strided_cuda((4, 8, 6, 6), (288, 36, 6, 1), torch.float32)
buf15 = empty_strided_cuda((4, 8, 6, 6), (288, 36, 6, 1), torch.float32)
# Topologically Sorted Source Nodes: [pad_1], Original ATen: [aten.copy]
triton_poi_fused_copy_4.run(buf13, buf14, buf15, 1152, grid=grid(1152), stream=stream0)
del buf11
del buf12
del buf13
buf16 = buf14; del buf14 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_5.run(buf15, buf16, 1152, grid=grid(1152), stream=stream0)
del buf15
# Topologically Sorted Source Nodes: [x2_1], Original ATen: [aten.convolution]
buf17 = extern_kernels.convolution(buf16, primals_6, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf17, (4, 4, 4, 4), (64, 16, 4, 1))
buf19 = empty_strided_cuda((16, ), (1, ), torch.float32)
buf18 = buf17; del buf17 # reuse
buf20 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.float32)
buf25 = reinterpret_tensor(buf28, (4, 4, 4, 4), (192, 16, 4, 1), 0) # alias
buf40 = reinterpret_tensor(buf43, (4, 4, 4, 4), (256, 16, 4, 1), 64) # alias
buf23 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.float32)
# Topologically Sorted Source Nodes: [x2_1, x2_3, x3, x4], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.cat]
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_6.run(buf18, primals_8, primals_7, primals_9, buf19, buf20, buf25, buf40, buf23, 16, 16, grid=grid(16), stream=stream0)
del primals_7
del primals_8
del primals_9
buf29 = empty_strided_cuda((4, 12, 6, 6), (432, 36, 6, 1), torch.float32)
buf30 = empty_strided_cuda((4, 12, 6, 6), (432, 36, 6, 1), torch.float32)
# Topologically Sorted Source Nodes: [pad_2], Original ATen: [aten.copy]
triton_poi_fused_copy_7.run(buf28, buf29, buf30, 1728, grid=grid(1728), stream=stream0)
del buf25
del buf26
del buf27
del buf28
buf31 = buf29; del buf29 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_8.run(buf30, buf31, 1728, grid=grid(1728), stream=stream0)
del buf30
# Topologically Sorted Source Nodes: [x3_1], Original ATen: [aten.convolution]
buf32 = extern_kernels.convolution(buf31, primals_10, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf32, (4, 4, 4, 4), (64, 16, 4, 1))
buf34 = empty_strided_cuda((16, ), (1, ), torch.float32)
buf33 = buf32; del buf32 # reuse
buf35 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.float32)
buf39 = reinterpret_tensor(buf43, (4, 4, 4, 4), (256, 16, 4, 1), 0) # alias
buf38 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.float32)
# Topologically Sorted Source Nodes: [x3_1, x3_3, x4], Original ATen: [aten.convolution, aten.repeat, aten._native_batch_norm_legit, aten.cat]
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_9.run(buf33, primals_12, primals_11, primals_13, buf34, buf35, buf39, buf38, 16, 16, grid=grid(16), stream=stream0)
del primals_11
del primals_12
del primals_13
buf44 = empty_strided_cuda((4, 16, 6, 6), (576, 36, 6, 1), torch.float32)
buf45 = empty_strided_cuda((4, 16, 6, 6), (576, 36, 6, 1), torch.float32)
# Topologically Sorted Source Nodes: [pad_3], Original ATen: [aten.copy]
triton_poi_fused_copy_10.run(buf43, buf44, buf45, 2304, grid=grid(2304), stream=stream0)
del buf39
del buf40
del buf41
del buf42
del buf43
buf46 = buf44; del buf44 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_11.run(buf45, buf46, 2304, grid=grid(2304), stream=stream0)
del buf45
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
buf47 = extern_kernels.convolution(buf46, primals_14, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf47, (4, 4, 4, 4), (64, 16, 4, 1))
buf48 = buf47; del buf47 # reuse
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
triton_poi_fused_convolution_12.run(buf48, primals_15, 256, grid=grid(256), stream=stream0)
del primals_15
return (buf48, primals_1, primals_6, primals_10, primals_14, buf2, buf4, buf5, reinterpret_tensor(buf9, (16, ), (1, ), 0), buf16, buf18, buf19, reinterpret_tensor(buf23, (16, ), (1, ), 0), buf31, buf33, buf34, reinterpret_tensor(buf38, (16, ), (1, ), 0), buf46, reinterpret_tensor(buf35, (1, 16, 1, 1), (16, 1, 1, 1), 0), reinterpret_tensor(buf20, (1, 16, 1, 1), (16, 1, 1, 1), 0), reinterpret_tensor(buf6, (1, 16, 1, 1), (16, 1, 1, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 8, 3, 3), (72, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((4, 12, 3, 3), (108, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_12 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_13 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_14 = rand_strided((4, 16, 3, 3), (144, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_15 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
from torch.nn import init as init
class ConvBlockINEDense(nn.Module):
def __init__(self, n_ch, act='relu', ksize=3, norm='in', padding_mode=
'circular'):
super().__init__()
padding = (ksize - 1) // 2
if act == 'lrelu':
self.act = nn.LeakyReLU(0.2, True)
else:
self.act = nn.ReLU(True)
self.conv1 = nn.Conv2d(n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode=padding_mode)
self.conv2 = nn.Conv2d(2 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode=padding_mode)
self.conv3 = nn.Conv2d(3 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode=padding_mode)
self.conv4 = nn.Conv2d(4 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode=padding_mode)
self.norm = norm
if norm == 'in':
self.norm1 = nn.InstanceNorm2d(n_ch, affine=True)
self.norm2 = nn.InstanceNorm2d(n_ch, affine=True)
self.norm3 = nn.InstanceNorm2d(n_ch, affine=True)
def forward(self, x, g=None, b=None):
x1 = self.conv1(x)
x1 = self.act(x1)
if self.norm == 'in':
x1 = self.norm1(x1)
x2 = torch.cat([x1, x], dim=1)
x2 = self.conv2(x2)
x2 = self.act(x2)
if self.norm == 'in':
x2 = self.norm2(x2)
x3 = torch.cat([x2, x1, x], dim=1)
x3 = self.conv3(x3)
x3 = self.act(x3)
if self.norm == 'in':
x3 = self.norm3(x3)
x4 = torch.cat([x3, x2, x1, x], dim=1)
out = self.conv4(x4)
return out
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'n_ch': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice
from torch import nn
from torch.nn import init as init
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_copy_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 576
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = xindex // 6 % 6
x2 = xindex // 36
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp15 & xmask,
other=0.0)
tmp17 = tl.load(in_ptr1 + x4, tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float('nan')
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + (-9 + x0 + 4 * x1 + 16 * x2), tmp29 & xmask,
other=0.0)
tmp31 = tl.load(in_ptr1 + (-4 + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + (-1 + x0 + 4 * x1 + 16 * x2), tmp45 & xmask,
other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp54 & xmask,
other=0.0)
tmp56 = tl.load(in_ptr1 + x4, tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + x4, tmp62, xmask)
@triton.jit
def triton_poi_fused_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 576
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 6 % 6
x0 = xindex % 6
x2 = xindex // 36
x3 = xindex
tmp14 = tl.load(in_ptr0 + x3, xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + (-24 + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp12 & xmask,
eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_2(
in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr4,
out_ptr5, out_ptr6, out_ptr7, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 4
x2 = xindex // 4
tmp0 = tl.load(in_ptr0 + x0 % 4, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_out_ptr0 + (r3 + 16 * x0), xmask, other=0.0)
tmp2 = tl.load(in_ptr1 + x1, xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + x0 % 4, xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp4 = tl.full([1, 1], 0, tl.int32)
tmp5 = triton_helpers.maximum(tmp4, tmp3)
tmp6 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tl.where(xmask, tmp6, 0)
tmp9 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp11 = tl.where(xmask, tmp9, 0)
tmp12 = tl.sum(tmp11, 1)[:, None]
tmp13 = tl.full([XBLOCK, 1], 16, tl.int32)
tmp14 = tmp13.to(tl.float32)
tmp15 = tmp12 / tmp14
tmp16 = tmp6 - tmp15
tmp17 = tmp16 * tmp16
tmp18 = tl.broadcast_to(tmp17, [XBLOCK, RBLOCK])
tmp20 = tl.where(xmask, tmp18, 0)
tmp21 = tl.sum(tmp20, 1)[:, None]
tmp22 = tmp5 - tmp15
tmp23 = 16.0
tmp24 = tmp21 / tmp23
tmp25 = 1e-05
tmp26 = tmp24 + tmp25
tmp27 = libdevice.rsqrt(tmp26)
tmp28 = tmp22 * tmp27
tmp29 = tmp28 * tmp0
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + x0, tmp0, xmask)
tl.store(in_out_ptr0 + (r3 + 16 * x0), tmp3, xmask)
tl.store(out_ptr4 + (r3 + 16 * x1 + 128 * x2), tmp31, xmask)
tl.store(out_ptr5 + (r3 + 16 * x1 + 192 * x2), tmp31, xmask)
tl.store(out_ptr6 + (r3 + 16 * x1 + 256 * x2), tmp31, xmask)
tl.store(out_ptr7 + x0, tmp27, xmask)
tl.store(out_ptr1 + x0, tmp15, xmask)
@triton.jit
def triton_poi_fused_cat_3(in_ptr0, out_ptr0, out_ptr1, out_ptr2, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 64
x1 = xindex // 64
tmp0 = tl.load(in_ptr0 + x2, xmask)
tl.store(out_ptr0 + (x0 + 128 * x1), tmp0, xmask)
tl.store(out_ptr1 + (x0 + 192 * x1), tmp0, xmask)
tl.store(out_ptr2 + (x0 + 256 * x1), tmp0, xmask)
@triton.jit
def triton_poi_fused_copy_4(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 1152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = xindex // 6 % 6
x2 = xindex // 36
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp15 & xmask,
other=0.0)
tmp17 = tl.load(in_ptr1 + x4, tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float('nan')
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + (-9 + x0 + 4 * x1 + 16 * x2), tmp29 & xmask,
other=0.0)
tmp31 = tl.load(in_ptr1 + (-4 + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + (-1 + x0 + 4 * x1 + 16 * x2), tmp45 & xmask,
other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp54 & xmask,
other=0.0)
tmp56 = tl.load(in_ptr1 + x4, tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + x4, tmp62, xmask)
@triton.jit
def triton_poi_fused_5(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 1152
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 6 % 6
x0 = xindex % 6
x2 = xindex // 36
x3 = xindex
tmp14 = tl.load(in_ptr0 + x3, xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + (-24 + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp12 & xmask,
eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_6(
in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr4,
out_ptr5, out_ptr6, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 4
x2 = xindex // 4
tmp0 = tl.load(in_ptr0 + x0 % 4, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_out_ptr0 + (r3 + 16 * x0), xmask, other=0.0)
tmp2 = tl.load(in_ptr1 + x1, xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + x0 % 4, xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp4 = tl.full([1, 1], 0, tl.int32)
tmp5 = triton_helpers.maximum(tmp4, tmp3)
tmp6 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tl.where(xmask, tmp6, 0)
tmp9 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp11 = tl.where(xmask, tmp9, 0)
tmp12 = tl.sum(tmp11, 1)[:, None]
tmp13 = tl.full([XBLOCK, 1], 16, tl.int32)
tmp14 = tmp13.to(tl.float32)
tmp15 = tmp12 / tmp14
tmp16 = tmp6 - tmp15
tmp17 = tmp16 * tmp16
tmp18 = tl.broadcast_to(tmp17, [XBLOCK, RBLOCK])
tmp20 = tl.where(xmask, tmp18, 0)
tmp21 = tl.sum(tmp20, 1)[:, None]
tmp22 = tmp5 - tmp15
tmp23 = 16.0
tmp24 = tmp21 / tmp23
tmp25 = 1e-05
tmp26 = tmp24 + tmp25
tmp27 = libdevice.rsqrt(tmp26)
tmp28 = tmp22 * tmp27
tmp29 = tmp28 * tmp0
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + x0, tmp0, xmask)
tl.store(in_out_ptr0 + (r3 + 16 * x0), tmp3, xmask)
tl.store(out_ptr4 + (r3 + 16 * x1 + 192 * x2), tmp31, xmask)
tl.store(out_ptr5 + (r3 + 16 * x1 + 256 * x2), tmp31, xmask)
tl.store(out_ptr6 + x0, tmp27, xmask)
tl.store(out_ptr1 + x0, tmp15, xmask)
@triton.jit
def triton_poi_fused_copy_7(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 1728
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = xindex // 6 % 6
x2 = xindex // 36
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp15 & xmask,
other=0.0)
tmp17 = tl.load(in_ptr1 + x4, tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float('nan')
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + (-9 + x0 + 4 * x1 + 16 * x2), tmp29 & xmask,
other=0.0)
tmp31 = tl.load(in_ptr1 + (-4 + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + (-1 + x0 + 4 * x1 + 16 * x2), tmp45 & xmask,
other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp54 & xmask,
other=0.0)
tmp56 = tl.load(in_ptr1 + x4, tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + x4, tmp62, xmask)
@triton.jit
def triton_poi_fused_8(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 1728
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 6 % 6
x0 = xindex % 6
x2 = xindex // 36
x3 = xindex
tmp14 = tl.load(in_ptr0 + x3, xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + (-24 + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp12 & xmask,
eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_9(
in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr3,
out_ptr4, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
x0 = xindex
r3 = rindex
x1 = xindex % 4
x2 = xindex // 4
tmp0 = tl.load(in_ptr0 + x0 % 4, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_out_ptr0 + (r3 + 16 * x0), xmask, other=0.0)
tmp2 = tl.load(in_ptr1 + x1, xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + x1, xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp4 = tl.full([1, 1], 0, tl.int32)
tmp5 = triton_helpers.maximum(tmp4, tmp3)
tmp6 = tl.broadcast_to(tmp5, [XBLOCK, RBLOCK])
tl.where(xmask, tmp6, 0)
tmp9 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp11 = tl.where(xmask, tmp9, 0)
tmp12 = tl.sum(tmp11, 1)[:, None]
tmp13 = tl.full([XBLOCK, 1], 16, tl.int32)
tmp14 = tmp13.to(tl.float32)
tmp15 = tmp12 / tmp14
tmp16 = tmp6 - tmp15
tmp17 = tmp16 * tmp16
tmp18 = tl.broadcast_to(tmp17, [XBLOCK, RBLOCK])
tmp20 = tl.where(xmask, tmp18, 0)
tmp21 = tl.sum(tmp20, 1)[:, None]
tmp22 = tmp5 - tmp15
tmp23 = 16.0
tmp24 = tmp21 / tmp23
tmp25 = 1e-05
tmp26 = tmp24 + tmp25
tmp27 = libdevice.rsqrt(tmp26)
tmp28 = tmp22 * tmp27
tmp29 = tmp28 * tmp0
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + x0, tmp0, xmask)
tl.store(in_out_ptr0 + (r3 + 16 * x0), tmp3, xmask)
tl.store(out_ptr3 + (r3 + 16 * x1 + 256 * x2), tmp31, xmask)
tl.store(out_ptr4 + x0, tmp27, xmask)
tl.store(out_ptr1 + x0, tmp15, xmask)
@triton.jit
def triton_poi_fused_copy_10(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 2304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 6
x1 = xindex // 6 % 6
x2 = xindex // 36
x4 = xindex
tmp0 = x0
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x0
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tmp0 >= tmp4
tmp8 = tmp0 < tmp1
tmp9 = tmp7 & tmp8
tmp10 = tmp9 & tmp6
tmp11 = x1
tmp12 = tmp11 >= tmp4
tmp13 = tmp11 < tmp1
tmp14 = tmp12 & tmp13
tmp15 = tmp14 & tmp10
tmp16 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp15 & xmask,
other=0.0)
tmp17 = tl.load(in_ptr1 + x4, tmp10 & xmask, other=0.0)
tmp18 = tl.where(tmp14, tmp16, tmp17)
tmp19 = tl.full(tmp18.shape, 0.0, tmp18.dtype)
tmp20 = tl.where(tmp10, tmp18, tmp19)
tmp21 = float('nan')
tmp22 = tl.where(tmp9, tmp20, tmp21)
tmp23 = tl.full(tmp22.shape, 0.0, tmp22.dtype)
tmp24 = tl.where(tmp6, tmp22, tmp23)
tmp25 = tmp3 >= tmp4
tmp26 = tmp3 < tmp1
tmp27 = tmp25 & tmp26
tmp28 = tmp27 & tmp2
tmp29 = tmp14 & tmp28
tmp30 = tl.load(in_ptr0 + (-9 + x0 + 4 * x1 + 16 * x2), tmp29 & xmask,
other=0.0)
tmp31 = tl.load(in_ptr1 + (-4 + x4), tmp28 & xmask, other=0.0)
tmp32 = tl.where(tmp14, tmp30, tmp31)
tmp33 = tl.full(tmp32.shape, 0.0, tmp32.dtype)
tmp34 = tl.where(tmp28, tmp32, tmp33)
tmp35 = tl.where(tmp27, tmp34, tmp21)
tmp36 = tl.where(tmp5, tmp24, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp2, tmp36, tmp37)
tmp39 = tmp0 < tmp4
tmp40 = 4 + x0
tmp41 = tmp40 >= tmp4
tmp42 = tmp40 < tmp1
tmp43 = tmp41 & tmp42
tmp44 = tmp43 & tmp39
tmp45 = tmp14 & tmp44
tmp46 = tl.load(in_ptr0 + (-1 + x0 + 4 * x1 + 16 * x2), tmp45 & xmask,
other=0.0)
tmp47 = tl.load(in_ptr1 + (4 + x4), tmp44 & xmask, other=0.0)
tmp48 = tl.where(tmp14, tmp46, tmp47)
tmp49 = tl.full(tmp48.shape, 0.0, tmp48.dtype)
tmp50 = tl.where(tmp44, tmp48, tmp49)
tmp51 = tl.where(tmp43, tmp50, tmp21)
tmp52 = tl.full(tmp51.shape, 0.0, tmp51.dtype)
tmp53 = tl.where(tmp39, tmp51, tmp52)
tmp54 = tmp14 & tmp9
tmp55 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp54 & xmask,
other=0.0)
tmp56 = tl.load(in_ptr1 + x4, tmp9 & xmask, other=0.0)
tmp57 = tl.where(tmp14, tmp55, tmp56)
tmp58 = tl.full(tmp57.shape, 0.0, tmp57.dtype)
tmp59 = tl.where(tmp9, tmp57, tmp58)
tmp60 = tl.where(tmp9, tmp59, tmp21)
tmp61 = tl.where(tmp39, tmp53, tmp60)
tmp62 = tl.where(tmp2, tmp38, tmp61)
tl.store(out_ptr0 + x4, tmp62, xmask)
@triton.jit
def triton_poi_fused_11(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 2304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 6 % 6
x0 = xindex % 6
x2 = xindex // 36
x3 = xindex
tmp14 = tl.load(in_ptr0 + x3, xmask)
tmp0 = x1
tmp1 = tl.full([1], 5, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = -4 + x1
tmp4 = tl.full([1], 1, tl.int64)
tmp5 = tmp3 < tmp4
tmp6 = tmp5 & tmp2
tmp7 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp8 = tl.load(in_ptr0 + (-24 + x3), tmp2 & xmask, other=0.0)
tmp9 = tl.where(tmp5, tmp7, tmp8)
tmp10 = tl.full(tmp9.shape, 0.0, tmp9.dtype)
tmp11 = tl.where(tmp2, tmp9, tmp10)
tmp12 = tmp0 < tmp4
tmp13 = tl.load(in_ptr0 + (24 + x0 + 36 * x2), tmp12 & xmask,
eviction_policy='evict_last', other=0.0)
tmp15 = tl.where(tmp12, tmp13, tmp14)
tmp16 = tl.where(tmp2, tmp11, tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_poi_fused_convolution_12(in_out_ptr0, in_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 16 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11, primals_12,
primals_13, primals_14, primals_15) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4,), (1,))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 8, 3, 3), (72, 9, 3, 1))
assert_size_stride(primals_7, (4,), (1,))
assert_size_stride(primals_8, (4,), (1,))
assert_size_stride(primals_9, (4,), (1,))
assert_size_stride(primals_10, (4, 12, 3, 3), (108, 9, 3, 1))
assert_size_stride(primals_11, (4,), (1,))
assert_size_stride(primals_12, (4,), (1,))
assert_size_stride(primals_13, (4,), (1,))
assert_size_stride(primals_14, (4, 16, 3, 3), (144, 9, 3, 1))
assert_size_stride(primals_15, (4,), (1,))
buf0 = empty_strided_cuda((4, 4, 6, 6), (144, 36, 6, 1), torch.float32)
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((4, 4, 6, 6), (144, 36, 6, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_copy_0[grid(576)](primals_3, buf0, buf1, 576,
XBLOCK=256, num_warps=4, num_stages=1)
buf2 = buf0
del buf0
triton_poi_fused_1[grid(576)](buf1, buf2, 576, XBLOCK=256,
num_warps=4, num_stages=1)
del buf1
buf3 = extern_kernels.convolution(buf2, primals_1, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf3, (4, 4, 4, 4), (64, 16, 4, 1))
buf5 = empty_strided_cuda((16,), (1,), torch.float32)
buf4 = buf3
del buf3
buf6 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.float32
)
buf13 = empty_strided_cuda((4, 8, 4, 4), (128, 16, 4, 1), torch.float32
)
buf11 = reinterpret_tensor(buf13, (4, 4, 4, 4), (128, 16, 4, 1), 0)
buf28 = empty_strided_cuda((4, 12, 4, 4), (192, 16, 4, 1), torch.
float32)
buf26 = reinterpret_tensor(buf28, (4, 4, 4, 4), (192, 16, 4, 1), 64)
buf43 = empty_strided_cuda((4, 16, 4, 4), (256, 16, 4, 1), torch.
float32)
buf41 = reinterpret_tensor(buf43, (4, 4, 4, 4), (256, 16, 4, 1), 128)
buf9 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.float32
)
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_2[grid
(16)](buf4, primals_4, primals_2, primals_5, buf5, buf6, buf11,
buf26, buf41, buf9, 16, 16, XBLOCK=8, num_warps=2, num_stages=1)
del primals_2
del primals_4
del primals_5
buf12 = reinterpret_tensor(buf13, (4, 4, 4, 4), (128, 16, 4, 1), 64)
buf27 = reinterpret_tensor(buf28, (4, 4, 4, 4), (192, 16, 4, 1), 128)
buf42 = reinterpret_tensor(buf43, (4, 4, 4, 4), (256, 16, 4, 1), 192)
triton_poi_fused_cat_3[grid(256)](primals_3, buf12, buf27, buf42,
256, XBLOCK=128, num_warps=4, num_stages=1)
del primals_3
buf14 = empty_strided_cuda((4, 8, 6, 6), (288, 36, 6, 1), torch.float32
)
buf15 = empty_strided_cuda((4, 8, 6, 6), (288, 36, 6, 1), torch.float32
)
triton_poi_fused_copy_4[grid(1152)](buf13, buf14, buf15, 1152,
XBLOCK=256, num_warps=4, num_stages=1)
del buf11
del buf12
del buf13
buf16 = buf14
del buf14
triton_poi_fused_5[grid(1152)](buf15, buf16, 1152, XBLOCK=256,
num_warps=4, num_stages=1)
del buf15
buf17 = extern_kernels.convolution(buf16, primals_6, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf17, (4, 4, 4, 4), (64, 16, 4, 1))
buf19 = empty_strided_cuda((16,), (1,), torch.float32)
buf18 = buf17
del buf17
buf20 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.
float32)
buf25 = reinterpret_tensor(buf28, (4, 4, 4, 4), (192, 16, 4, 1), 0)
buf40 = reinterpret_tensor(buf43, (4, 4, 4, 4), (256, 16, 4, 1), 64)
buf23 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.
float32)
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_6[grid
(16)](buf18, primals_8, primals_7, primals_9, buf19, buf20,
buf25, buf40, buf23, 16, 16, XBLOCK=1, num_warps=2, num_stages=1)
del primals_7
del primals_8
del primals_9
buf29 = empty_strided_cuda((4, 12, 6, 6), (432, 36, 6, 1), torch.
float32)
buf30 = empty_strided_cuda((4, 12, 6, 6), (432, 36, 6, 1), torch.
float32)
triton_poi_fused_copy_7[grid(1728)](buf28, buf29, buf30, 1728,
XBLOCK=128, num_warps=4, num_stages=1)
del buf25
del buf26
del buf27
del buf28
buf31 = buf29
del buf29
triton_poi_fused_8[grid(1728)](buf30, buf31, 1728, XBLOCK=256,
num_warps=4, num_stages=1)
del buf30
buf32 = extern_kernels.convolution(buf31, primals_10, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf32, (4, 4, 4, 4), (64, 16, 4, 1))
buf34 = empty_strided_cuda((16,), (1,), torch.float32)
buf33 = buf32
del buf32
buf35 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.
float32)
buf39 = reinterpret_tensor(buf43, (4, 4, 4, 4), (256, 16, 4, 1), 0)
buf38 = empty_strided_cuda((1, 16, 1, 1), (16, 1, 16, 16), torch.
float32)
triton_per_fused__native_batch_norm_legit_cat_convolution_repeat_9[grid
(16)](buf33, primals_12, primals_11, primals_13, buf34, buf35,
buf39, buf38, 16, 16, XBLOCK=8, num_warps=2, num_stages=1)
del primals_11
del primals_12
del primals_13
buf44 = empty_strided_cuda((4, 16, 6, 6), (576, 36, 6, 1), torch.
float32)
buf45 = empty_strided_cuda((4, 16, 6, 6), (576, 36, 6, 1), torch.
float32)
triton_poi_fused_copy_10[grid(2304)](buf43, buf44, buf45, 2304,
XBLOCK=128, num_warps=4, num_stages=1)
del buf39
del buf40
del buf41
del buf42
del buf43
buf46 = buf44
del buf44
triton_poi_fused_11[grid(2304)](buf45, buf46, 2304, XBLOCK=256,
num_warps=4, num_stages=1)
del buf45
buf47 = extern_kernels.convolution(buf46, primals_14, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf47, (4, 4, 4, 4), (64, 16, 4, 1))
buf48 = buf47
del buf47
triton_poi_fused_convolution_12[grid(256)](buf48, primals_15, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_15
return (buf48, primals_1, primals_6, primals_10, primals_14, buf2, buf4,
buf5, reinterpret_tensor(buf9, (16,), (1,), 0), buf16, buf18, buf19,
reinterpret_tensor(buf23, (16,), (1,), 0), buf31, buf33, buf34,
reinterpret_tensor(buf38, (16,), (1,), 0), buf46,
reinterpret_tensor(buf35, (1, 16, 1, 1), (16, 1, 1, 1), 0),
reinterpret_tensor(buf20, (1, 16, 1, 1), (16, 1, 1, 1), 0),
reinterpret_tensor(buf6, (1, 16, 1, 1), (16, 1, 1, 1), 0))
class ConvBlockINEDenseNew(nn.Module):
def __init__(self, n_ch, act='relu', ksize=3, norm='in', padding_mode=
'circular'):
super().__init__()
padding = (ksize - 1) // 2
if act == 'lrelu':
self.act = nn.LeakyReLU(0.2, True)
else:
self.act = nn.ReLU(True)
self.conv1 = nn.Conv2d(n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode=padding_mode)
self.conv2 = nn.Conv2d(2 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode=padding_mode)
self.conv3 = nn.Conv2d(3 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode=padding_mode)
self.conv4 = nn.Conv2d(4 * n_ch, n_ch, kernel_size=ksize, padding=
padding, padding_mode=padding_mode)
self.norm = norm
if norm == 'in':
self.norm1 = nn.InstanceNorm2d(n_ch, affine=True)
self.norm2 = nn.InstanceNorm2d(n_ch, affine=True)
self.norm3 = nn.InstanceNorm2d(n_ch, affine=True)
def forward(self, input_0):
primals_1 = self.conv1.weight
primals_2 = self.conv1.bias
primals_6 = self.conv2.weight
primals_4 = self.conv2.bias
primals_10 = self.conv3.weight
primals_5 = self.conv3.bias
primals_14 = self.conv4.weight
primals_7 = self.conv4.bias
primals_8 = self.norm1.weight
primals_9 = self.norm1.bias
primals_11 = self.norm2.weight
primals_12 = self.norm2.bias
primals_13 = self.norm3.weight
primals_15 = self.norm3.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11, primals_12, primals_13, primals_14,
primals_15])
return output[0]
|
BaekduChoi/Halftoning_v2
|
ConvBlockINEDense
| false | 2,067 |
[
"BSD-3-Clause"
] | 0 |
fdb7040e1a4044f23ef9c92757bbb90c23685afe
|
https://github.com/BaekduChoi/Halftoning_v2/tree/fdb7040e1a4044f23ef9c92757bbb90c23685afe
|
GaussianFocalLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/mc/cmcjnrkcniypkwkusrjjxvk7xd3n4rxefn5nz4mqn47gca6icbsg.py
# Topologically Sorted Source Nodes: [add, log, neg, sub_1, pow_2, mul, pos_weights, pos_loss, sub_2, add_1, log_1, neg_1, pow_3, mul_2, sub, neg_weights, neg_loss, loss, loss_1, loss_reg], Original ATen: [aten.add, aten.log, aten.neg, aten.rsub, aten.pow, aten.mul, aten.eq, aten.mean]
# Source node to ATen node mapping:
# add => add
# add_1 => add_1
# log => log
# log_1 => log_1
# loss => add_2
# loss_1 => mean
# loss_reg => mul_4
# mul => mul
# mul_2 => mul_2
# neg => neg
# neg_1 => neg_1
# neg_loss => mul_3
# neg_weights => pow_1
# pos_loss => mul_1
# pos_weights => eq
# pow_2 => pow_2
# pow_3 => pow_3
# sub => sub
# sub_1 => sub_1
# sub_2 => sub_2
# Graph fragment:
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%arg0_1, 1e-12), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%add,), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%log,), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg0_1), kwargs = {})
# %pow_2 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub_1, 2.0), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%neg, %pow_2), kwargs = {})
# %eq : [num_users=1] = call_function[target=torch.ops.aten.eq.Scalar](args = (%arg1_1, 1), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul, %eq), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg0_1), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sub_2, 1e-12), kwargs = {})
# %log_1 : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%add_1,), kwargs = {})
# %neg_1 : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%log_1,), kwargs = {})
# %pow_3 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%arg0_1, 2.0), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%neg_1, %pow_3), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg1_1), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub, 4.0), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_2, %pow_1), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, %mul_3), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%add_2,), kwargs = {})
# %mul_4 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_add_eq_log_mean_mul_neg_pow_rsub_0 = async_compile.triton('triton_per_fused_add_eq_log_mean_mul_neg_pow_rsub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_eq_log_mean_mul_neg_pow_rsub_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_eq_log_mean_mul_neg_pow_rsub_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp9 = tl.load(in_ptr1 + (r0), None)
tmp1 = 1e-12
tmp2 = tmp0 + tmp1
tmp3 = tl_math.log(tmp2)
tmp4 = -tmp3
tmp5 = 1.0
tmp6 = tmp5 - tmp0
tmp7 = tmp6 * tmp6
tmp8 = tmp4 * tmp7
tmp10 = tmp9 == tmp5
tmp11 = tmp10.to(tl.float32)
tmp12 = tmp8 * tmp11
tmp13 = tmp6 + tmp1
tmp14 = tl_math.log(tmp13)
tmp15 = -tmp14
tmp16 = tmp0 * tmp0
tmp17 = tmp15 * tmp16
tmp18 = tmp5 - tmp9
tmp19 = tmp18 * tmp18
tmp20 = tmp19 * tmp19
tmp21 = tmp17 * tmp20
tmp22 = tmp12 + tmp21
tmp23 = tl.broadcast_to(tmp22, [RBLOCK])
tmp25 = triton_helpers.promote_to_tensor(tl.sum(tmp23, 0))
tmp26 = 256.0
tmp27 = tmp25 / tmp26
tmp28 = tmp27 * tmp5
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp28, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [add, log, neg, sub_1, pow_2, mul, pos_weights, pos_loss, sub_2, add_1, log_1, neg_1, pow_3, mul_2, sub, neg_weights, neg_loss, loss, loss_1, loss_reg], Original ATen: [aten.add, aten.log, aten.neg, aten.rsub, aten.pow, aten.mul, aten.eq, aten.mean]
stream0 = get_raw_stream(0)
triton_per_fused_add_eq_log_mean_mul_neg_pow_rsub_0.run(buf1, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import functools
import torch
import torch.nn as nn
import torch.nn.functional as F
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def gaussian_focal_loss(pred, gaussian_target, alpha=2.0, gamma=4.0):
eps = 1e-12
pos_weights = gaussian_target.eq(1)
neg_weights = (1 - gaussian_target).pow(gamma)
pos_loss = -(pred + eps).log() * (1 - pred).pow(alpha) * pos_weights
neg_loss = -(1 - pred + eps).log() * pred.pow(alpha) * neg_weights
return pos_loss + neg_loss
class GaussianFocalLoss(nn.Module):
""" GaussianFocalLoss is a variant of focal loss.
More details can be found in the `paper
<https://arxiv.org/abs/1808.01244>`_
Code is modified from `kp_utils.py
<https://github.com/princeton-vl/CornerNet/blob/master/models/py_utils/kp_utils.py#L152>`_ # noqa: E501
Please notice that the target in GaussianFocalLoss is a gaussian heatmap,
not 0/1 binary target.
Args:
alpha (float): Power of prediction.
gamma (float): Power of target for negtive samples.
reduction (str): Options are "none", "mean" and "sum".
loss_weight (float): Loss weight of current loss.
"""
def __init__(self, alpha=2.0, gamma=4.0, reduction='mean', loss_weight=1.0
):
super(GaussianFocalLoss, self).__init__()
self.alpha = alpha
self.gamma = gamma
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, pred, target, weight=None, avg_factor=None,
reduction_override=None):
assert reduction_override in (None, 'none', 'mean', 'sum')
reduction = (reduction_override if reduction_override else self.
reduction)
loss_reg = self.loss_weight * gaussian_focal_loss(pred, target,
weight, alpha=self.alpha, gamma=self.gamma, reduction=reduction,
avg_factor=avg_factor)
return loss_reg
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import functools
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_eq_log_mean_mul_neg_pow_rsub_0(in_out_ptr0,
in_ptr0, in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp9 = tl.load(in_ptr1 + r0, None)
tmp1 = 1e-12
tmp2 = tmp0 + tmp1
tmp3 = tl_math.log(tmp2)
tmp4 = -tmp3
tmp5 = 1.0
tmp6 = tmp5 - tmp0
tmp7 = tmp6 * tmp6
tmp8 = tmp4 * tmp7
tmp10 = tmp9 == tmp5
tmp11 = tmp10.to(tl.float32)
tmp12 = tmp8 * tmp11
tmp13 = tmp6 + tmp1
tmp14 = tl_math.log(tmp13)
tmp15 = -tmp14
tmp16 = tmp0 * tmp0
tmp17 = tmp15 * tmp16
tmp18 = tmp5 - tmp9
tmp19 = tmp18 * tmp18
tmp20 = tmp19 * tmp19
tmp21 = tmp17 * tmp20
tmp22 = tmp12 + tmp21
tmp23 = tl.broadcast_to(tmp22, [RBLOCK])
tmp25 = triton_helpers.promote_to_tensor(tl.sum(tmp23, 0))
tmp26 = 256.0
tmp27 = tmp25 / tmp26
tmp28 = tmp27 * tmp5
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp28, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_add_eq_log_mean_mul_neg_pow_rsub_0[grid(1)](buf1,
arg0_1, arg1_1, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def gaussian_focal_loss(pred, gaussian_target, alpha=2.0, gamma=4.0):
eps = 1e-12
pos_weights = gaussian_target.eq(1)
neg_weights = (1 - gaussian_target).pow(gamma)
pos_loss = -(pred + eps).log() * (1 - pred).pow(alpha) * pos_weights
neg_loss = -(1 - pred + eps).log() * pred.pow(alpha) * neg_weights
return pos_loss + neg_loss
class GaussianFocalLossNew(nn.Module):
""" GaussianFocalLoss is a variant of focal loss.
More details can be found in the `paper
<https://arxiv.org/abs/1808.01244>`_
Code is modified from `kp_utils.py
<https://github.com/princeton-vl/CornerNet/blob/master/models/py_utils/kp_utils.py#L152>`_ # noqa: E501
Please notice that the target in GaussianFocalLoss is a gaussian heatmap,
not 0/1 binary target.
Args:
alpha (float): Power of prediction.
gamma (float): Power of target for negtive samples.
reduction (str): Options are "none", "mean" and "sum".
loss_weight (float): Loss weight of current loss.
"""
def __init__(self, alpha=2.0, gamma=4.0, reduction='mean', loss_weight=1.0
):
super(GaussianFocalLossNew, self).__init__()
self.alpha = alpha
self.gamma = gamma
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
CK-er/mmdet
|
GaussianFocalLoss
| false | 2,068 |
[
"Apache-2.0"
] | 0 |
9bea4068efbcf7bf739dbe41917a68d525c29868
|
https://github.com/CK-er/mmdet/tree/9bea4068efbcf7bf739dbe41917a68d525c29868
|
MSELoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/3o/c3ojeovop77jtjsbc2sbf6phxmf3ewz3f7gszih7ehz6obviaiu2.py
# Topologically Sorted Source Nodes: [loss, loss_1, loss_2], Original ATen: [aten.mse_loss, aten.mean, aten.mul]
# Source node to ATen node mapping:
# loss => pow_1, sub
# loss_1 => mean
# loss_2 => mul
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub, 2), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%pow_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_mean_mse_loss_mul_0 = async_compile.triton('triton_per_fused_mean_mse_loss_mul_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_mean_mse_loss_mul_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_mean_mse_loss_mul_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.load(in_ptr1 + (r0), None)
tmp2 = tmp0 - tmp1
tmp3 = tmp2 * tmp2
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tmp7 = 256.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp10, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [loss, loss_1, loss_2], Original ATen: [aten.mse_loss, aten.mean, aten.mul]
stream0 = get_raw_stream(0)
triton_per_fused_mean_mse_loss_mul_0.run(buf1, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import functools
import torch
import torch.nn as nn
import torch.nn.functional as F
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def mse_loss(pred, target):
return F.mse_loss(pred, target, reduction='none')
class MSELoss(nn.Module):
def __init__(self, reduction='mean', loss_weight=1.0):
super().__init__()
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, pred, target, weight=None, avg_factor=None):
loss = self.loss_weight * mse_loss(pred, target, weight, reduction=
self.reduction, avg_factor=avg_factor)
return loss
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import functools
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_mean_mse_loss_mul_0(in_out_ptr0, in_ptr0, in_ptr1,
xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.load(in_ptr1 + r0, None)
tmp2 = tmp0 - tmp1
tmp3 = tmp2 * tmp2
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tmp7 = 256.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp10, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_mean_mse_loss_mul_0[grid(1)](buf1, arg0_1, arg1_1,
1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def mse_loss(pred, target):
return F.mse_loss(pred, target, reduction='none')
class MSELossNew(nn.Module):
def __init__(self, reduction='mean', loss_weight=1.0):
super().__init__()
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
CK-er/mmdet
|
MSELoss
| false | 2,069 |
[
"Apache-2.0"
] | 0 |
9bea4068efbcf7bf739dbe41917a68d525c29868
|
https://github.com/CK-er/mmdet/tree/9bea4068efbcf7bf739dbe41917a68d525c29868
|
L1Loss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/i5/ci5r22vnwphjxav3oibgww4fkm25q4egp3rofzniyjru2u4b563f.py
# Topologically Sorted Source Nodes: [loss, mul], Original ATen: [aten.sub, aten.abs, aten.mean, aten.mul]
# Source node to ATen node mapping:
# loss => abs_1, mean, sub
# mul => mul
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg1_1, %arg0_1), kwargs = {})
# %abs_1 : [num_users=1] = call_function[target=torch.ops.aten.abs.default](args = (%sub,), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%abs_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_abs_mean_mul_sub_0 = async_compile.triton('triton_per_fused_abs_mean_mul_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_abs_mean_mul_sub_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_abs_mean_mul_sub_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.load(in_ptr1 + (r0), None)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tmp7 = 256.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp10, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [loss, mul], Original ATen: [aten.sub, aten.abs, aten.mean, aten.mul]
stream0 = get_raw_stream(0)
triton_per_fused_abs_mean_mul_sub_0.run(buf1, arg1_1, arg0_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class L1Loss(nn.Module):
"""L1Loss loss ."""
def __init__(self, use_target_weight=False, loss_weight=1.0):
super().__init__()
self.criterion = F.l1_loss
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
def forward(self, output, target, target_weight=None):
"""Forward function.
Note:
- batch_size: N
- num_keypoints: K
Args:
output (torch.Tensor[N, K, 2]): Output regression.
target (torch.Tensor[N, K, 2]): Target regression.
target_weight (torch.Tensor[N, K, 2]):
Weights across different joint types.
"""
if self.use_target_weight:
assert target_weight is not None
loss = self.criterion(output * target_weight, target *
target_weight)
else:
loss = self.criterion(output, target)
return loss * self.loss_weight
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_abs_mean_mul_sub_0(in_out_ptr0, in_ptr0, in_ptr1,
xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.load(in_ptr1 + r0, None)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tmp7 = 256.0
tmp8 = tmp6 / tmp7
tmp9 = 1.0
tmp10 = tmp8 * tmp9
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp10, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_abs_mean_mul_sub_0[grid(1)](buf1, arg1_1, arg0_1,
1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
class L1LossNew(nn.Module):
"""L1Loss loss ."""
def __init__(self, use_target_weight=False, loss_weight=1.0):
super().__init__()
self.criterion = F.l1_loss
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ALISCIFP/mmpose
|
L1Loss
| false | 2,070 |
[
"Apache-2.0"
] | 0 |
2433e3dbcc44baa2253e2a7c748ba0216937933e
|
https://github.com/ALISCIFP/mmpose/tree/2433e3dbcc44baa2253e2a7c748ba0216937933e
|
SelfAttention
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ao/caoovxtqrx42gvkmjirowqmmbh6kppvfh5ebrzzv4kzkgwm2umii.py
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# linear => clone
# Graph fragment:
# %clone : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_0 = async_compile.triton('triton_poi_fused_clone_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = (xindex // 4) % 4
x2 = (xindex // 16)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (4*x2) + (16*x1)), xmask)
tl.store(out_ptr0 + (x3), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/xk/cxkmdbptgejnxqvvct3m5fm7bc7kxfsd3om2bbyghjd5mlsywsie.py
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.tanh]
# Source node to ATen node mapping:
# x => tanh
# Graph fragment:
# %tanh : [num_users=2] = call_function[target=torch.ops.aten.tanh.default](args = (%view_1,), kwargs = {})
triton_poi_fused_tanh_1 = async_compile.triton('triton_poi_fused_tanh_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_tanh_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_tanh_1(in_out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1600
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + (x0), xmask)
tmp1 = libdevice.tanh(tmp0)
tl.store(in_out_ptr0 + (x0), tmp1, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/gd/cgdtd7uw2iemby2kfb22fx3vkhdbrpyx2y2l6nq45fmox3ad7stv.py
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# x_1 => amax, exp, sub
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%view_3, [1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_3, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
triton_poi_fused__softmax_2 = async_compile.triton('triton_poi_fused__softmax_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_2(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + (x2), tmp9, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/qs/cqsyda2m63ct5ijcfgcipyyfn273chi5d3kmpjuf5asa7h4wdpdv.py
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# x_1 => div, sum_1
# Graph fragment:
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [1], True), kwargs = {})
# %div : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
triton_poi_fused__softmax_3 = async_compile.triton('triton_poi_fused__softmax_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_3(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + (x2), tmp8, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (100, 4), (4, 1))
assert_size_stride(primals_3, (1, 100), (100, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.clone]
stream0 = get_raw_stream(0)
triton_poi_fused_clone_0.run(primals_1, buf0, 64, grid=grid(64), stream=stream0)
buf1 = empty_strided_cuda((16, 100), (100, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.mm]
extern_kernels.mm(reinterpret_tensor(buf0, (16, 4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 100), (1, 4), 0), out=buf1)
del primals_2
buf2 = reinterpret_tensor(buf1, (4, 4, 100), (400, 100, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.tanh]
triton_poi_fused_tanh_1.run(buf2, 1600, grid=grid(1600), stream=stream0)
buf3 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_1], Original ATen: [aten.mm]
extern_kernels.mm(reinterpret_tensor(buf2, (16, 100), (100, 1), 0), reinterpret_tensor(primals_3, (100, 1), (1, 100), 0), out=buf3)
buf4 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten._softmax]
triton_poi_fused__softmax_2.run(buf3, buf4, 16, grid=grid(16), stream=stream0)
buf5 = reinterpret_tensor(buf3, (4, 4, 1), (4, 1, 1), 0); del buf3 # reuse
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten._softmax]
triton_poi_fused__softmax_3.run(buf4, buf5, 16, grid=grid(16), stream=stream0)
buf6 = reinterpret_tensor(buf4, (4, 1, 4), (4, 4, 1), 0); del buf4 # reuse
# Topologically Sorted Source Nodes: [M], Original ATen: [aten.bmm]
extern_kernels.bmm(reinterpret_tensor(buf5, (4, 1, 4), (4, 1, 1), 0), reinterpret_tensor(primals_1, (4, 4, 4), (4, 16, 1), 0), out=buf6)
return (buf6, reinterpret_tensor(buf5, (4, 1, 4), (4, 1, 1), 0), reinterpret_tensor(buf0, (16, 4), (4, 1), 0), buf2, buf5, reinterpret_tensor(primals_1, (4, 4, 4), (4, 1, 16), 0), primals_3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((100, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((1, 100), (100, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class SelfAttention(nn.Module):
def __init__(self, hidden_size, attention_size=100, n_attention_heads=1):
super().__init__()
self.hidden_size = hidden_size
self.attention_size = attention_size
self.n_attention_heads = n_attention_heads
self.W1 = nn.Linear(hidden_size, attention_size, bias=False)
self.W2 = nn.Linear(attention_size, n_attention_heads, bias=False)
def forward(self, hidden):
hidden = hidden.transpose(0, 1)
x = torch.tanh(self.W1(hidden))
x = F.softmax(self.W2(x), dim=1)
A = x.transpose(1, 2)
M = A @ hidden
return M, A
def get_inputs():
return [torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'hidden_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = xindex // 4 % 4
x2 = xindex // 16
x3 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 4 * x2 + 16 * x1), xmask)
tl.store(out_ptr0 + x3, tmp0, xmask)
@triton.jit
def triton_poi_fused_tanh_1(in_out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 1600
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + x0, xmask)
tmp1 = libdevice.tanh(tmp0)
tl.store(in_out_ptr0 + x0, tmp1, xmask)
@triton.jit
def triton_poi_fused__softmax_2(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + x2, tmp9, xmask)
@triton.jit
def triton_poi_fused__softmax_3(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + x2, tmp8, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (100, 4), (4, 1))
assert_size_stride(primals_3, (1, 100), (100, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_clone_0[grid(64)](primals_1, buf0, 64, XBLOCK=64,
num_warps=1, num_stages=1)
buf1 = empty_strided_cuda((16, 100), (100, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf0, (16, 4), (4, 1), 0),
reinterpret_tensor(primals_2, (4, 100), (1, 4), 0), out=buf1)
del primals_2
buf2 = reinterpret_tensor(buf1, (4, 4, 100), (400, 100, 1), 0)
del buf1
triton_poi_fused_tanh_1[grid(1600)](buf2, 1600, XBLOCK=256,
num_warps=4, num_stages=1)
buf3 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf2, (16, 100), (100, 1), 0),
reinterpret_tensor(primals_3, (100, 1), (1, 100), 0), out=buf3)
buf4 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
triton_poi_fused__softmax_2[grid(16)](buf3, buf4, 16, XBLOCK=16,
num_warps=1, num_stages=1)
buf5 = reinterpret_tensor(buf3, (4, 4, 1), (4, 1, 1), 0)
del buf3
triton_poi_fused__softmax_3[grid(16)](buf4, buf5, 16, XBLOCK=16,
num_warps=1, num_stages=1)
buf6 = reinterpret_tensor(buf4, (4, 1, 4), (4, 4, 1), 0)
del buf4
extern_kernels.bmm(reinterpret_tensor(buf5, (4, 1, 4), (4, 1, 1), 0
), reinterpret_tensor(primals_1, (4, 4, 4), (4, 16, 1), 0), out
=buf6)
return buf6, reinterpret_tensor(buf5, (4, 1, 4), (4, 1, 1), 0
), reinterpret_tensor(buf0, (16, 4), (4, 1), 0
), buf2, buf5, reinterpret_tensor(primals_1, (4, 4, 4), (4, 1, 16), 0
), primals_3
class SelfAttentionNew(nn.Module):
def __init__(self, hidden_size, attention_size=100, n_attention_heads=1):
super().__init__()
self.hidden_size = hidden_size
self.attention_size = attention_size
self.n_attention_heads = n_attention_heads
self.W1 = nn.Linear(hidden_size, attention_size, bias=False)
self.W2 = nn.Linear(attention_size, n_attention_heads, bias=False)
def forward(self, input_0):
primals_2 = self.W1.weight
primals_3 = self.W2.weight
primals_1 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0], output[1]
|
CS475-NLP/cs475-nlp-project
|
SelfAttention
| false | 2,071 |
[
"MIT"
] | 0 |
d73ec7d4b08abd3a5ba6445b99705fe8716a0151
|
https://github.com/CS475-NLP/cs475-nlp-project/tree/d73ec7d4b08abd3a5ba6445b99705fe8716a0151
|
GHMC
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/eu/ceuv7b3vtgnm54c77ljfgp5gdzt44um3527nmb7duufsy6ufr57k.py
# Topologically Sorted Source Nodes: [valid, float_3, sum_1], Original ATen: [aten.gt, aten._to_copy, aten.sum]
# Source node to ATen node mapping:
# float_3 => convert_element_type
# sum_1 => sum_1
# valid => gt
# Graph fragment:
# %gt : [num_users=2] = call_function[target=torch.ops.aten.gt.Scalar](args = (%arg2_1, 0), kwargs = {})
# %convert_element_type : [num_users=1] = call_function[target=torch.ops.prims.convert_element_type.default](args = (%gt, torch.float32), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%convert_element_type,), kwargs = {})
triton_per_fused__to_copy_gt_sum_0 = async_compile.triton('triton_per_fused__to_copy_gt_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*i1', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__to_copy_gt_sum_0', 'mutated_arg_names': [], 'no_x_dim': True, 'num_load': 1, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__to_copy_gt_sum_0(in_ptr0, out_ptr0, out_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = 0.0
tmp2 = tmp0 > tmp1
tmp3 = tmp2.to(tl.float32)
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tl.store(out_ptr0 + (tl.broadcast_to(r0, [RBLOCK])), tmp2, None)
tl.store(out_ptr1 + (tl.full([1], 0, tl.int32)), tmp6, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/yx/cyx33b4cuc5wetqcfqkvlznxkkeck5wuib3zqzten6pdyhb3nib2.py
# Topologically Sorted Source Nodes: [weights], Original ATen: [aten.zeros_like]
# Source node to ATen node mapping:
# weights => full_default
# Graph fragment:
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([4, 4, 4, 4], 0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
triton_poi_fused_zeros_like_1 = async_compile.triton('triton_poi_fused_zeros_like_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_zeros_like_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 0, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_zeros_like_1(out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = 0.0
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/o3/co3ohsiccha2jedxkbuuzgpfkttvcqovi7edh443hag7dzlqgnfb.py
# Topologically Sorted Source Nodes: [sigmoid, sub, g], Original ATen: [aten.sigmoid, aten.sub, aten.abs]
# Source node to ATen node mapping:
# g => abs_1
# sigmoid => sigmoid
# sub => sub
# Graph fragment:
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%arg0_1,), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sigmoid, %arg1_1), kwargs = {})
# %abs_1 : [num_users=1] = call_function[target=torch.ops.aten.abs.default](args = (%sub,), kwargs = {})
triton_poi_fused_abs_sigmoid_sub_2 = async_compile.triton('triton_poi_fused_abs_sigmoid_sub_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_abs_sigmoid_sub_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_abs_sigmoid_sub_2(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp2 = tl.load(in_ptr1 + (x0), xmask)
tmp1 = tl.sigmoid(tmp0)
tmp3 = tmp1 - tmp2
tmp4 = tl_math.abs(tmp3)
tl.store(out_ptr0 + (x0), tmp4, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
buf1 = empty_strided_cuda((), (), torch.float32)
# Topologically Sorted Source Nodes: [valid, float_3, sum_1], Original ATen: [aten.gt, aten._to_copy, aten.sum]
stream0 = get_raw_stream(0)
triton_per_fused__to_copy_gt_sum_0.run(arg2_1, buf0, buf1, 1, 256, grid=grid(1), stream=stream0)
del arg2_1
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [weights], Original ATen: [aten.zeros_like]
triton_poi_fused_zeros_like_1.run(buf2, 256, grid=grid(256), stream=stream0)
buf3 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [sigmoid, sub, g], Original ATen: [aten.sigmoid, aten.sub, aten.abs]
triton_poi_fused_abs_sigmoid_sub_2.run(arg0_1, arg1_1, buf3, 256, grid=grid(256), stream=stream0)
del arg0_1
return (buf1, arg1_1, buf2, buf3, buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg2_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1, arg2_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
def _expand_onehot_labels(labels, label_weights, label_channels):
bin_labels = labels.new_full((labels.size(0), label_channels), 0)
inds = torch.nonzero((labels >= 0) & (labels < label_channels),
as_tuple=False).squeeze()
if inds.numel() > 0:
bin_labels[inds, labels[inds]] = 1
bin_label_weights = label_weights.view(-1, 1).expand(label_weights.size
(0), label_channels)
return bin_labels, bin_label_weights
class GHMC(nn.Module):
"""GHM Classification Loss.
Details of the theorem can be viewed in the paper
"Gradient Harmonized Single-stage Detector".
https://arxiv.org/abs/1811.05181
Args:
bins (int): Number of the unit regions for distribution calculation.
momentum (float): The parameter for moving average.
use_sigmoid (bool): Can only be true for BCE based loss now.
loss_weight (float): The weight of the total GHM-C loss.
"""
def __init__(self, bins=10, momentum=0, use_sigmoid=True, loss_weight=1.0):
super(GHMC, self).__init__()
self.bins = bins
self.momentum = momentum
edges = torch.arange(bins + 1).float() / bins
self.register_buffer('edges', edges)
self.edges[-1] += 1e-06
if momentum > 0:
acc_sum = torch.zeros(bins)
self.register_buffer('acc_sum', acc_sum)
self.use_sigmoid = use_sigmoid
if not self.use_sigmoid:
raise NotImplementedError
self.loss_weight = loss_weight
def forward(self, pred, target, label_weight, *args, **kwargs):
"""Calculate the GHM-C loss.
Args:
pred (float tensor of size [batch_num, class_num]):
The direct prediction of classification fc layer.
target (float tensor of size [batch_num, class_num]):
Binary class target for each sample.
label_weight (float tensor of size [batch_num, class_num]):
the value is 1 if the sample is valid and 0 if ignored.
Returns:
The gradient harmonized loss.
"""
if pred.dim() != target.dim():
target, label_weight = _expand_onehot_labels(target,
label_weight, pred.size(-1))
target, label_weight = target.float(), label_weight.float()
edges = self.edges
mmt = self.momentum
weights = torch.zeros_like(pred)
g = torch.abs(pred.sigmoid().detach() - target)
valid = label_weight > 0
tot = max(valid.float().sum().item(), 1.0)
n = 0
for i in range(self.bins):
inds = (g >= edges[i]) & (g < edges[i + 1]) & valid
num_in_bin = inds.sum().item()
if num_in_bin > 0:
if mmt > 0:
self.acc_sum[i] = mmt * self.acc_sum[i] + (1 - mmt
) * num_in_bin
weights[inds] = tot / self.acc_sum[i]
else:
weights[inds] = tot / num_in_bin
n += 1
if n > 0:
weights = weights / n
loss = F.binary_cross_entropy_with_logits(pred, target, weights,
reduction='sum') / tot
return loss * self.loss_weight
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4]), torch.rand(
[4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused__to_copy_gt_sum_0(in_ptr0, out_ptr0, out_ptr1, xnumel,
rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = 0.0
tmp2 = tmp0 > tmp1
tmp3 = tmp2.to(tl.float32)
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tl.store(out_ptr0 + tl.broadcast_to(r0, [RBLOCK]), tmp2, None)
tl.store(out_ptr1 + tl.full([1], 0, tl.int32), tmp6, None)
@triton.jit
def triton_poi_fused_zeros_like_1(out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = 0.0
tl.store(out_ptr0 + x0, tmp0, xmask)
@triton.jit
def triton_poi_fused_abs_sigmoid_sub_2(in_ptr0, in_ptr1, out_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp2 = tl.load(in_ptr1 + x0, xmask)
tmp1 = tl.sigmoid(tmp0)
tmp3 = tmp1 - tmp2
tmp4 = tl_math.abs(tmp3)
tl.store(out_ptr0 + x0, tmp4, xmask)
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
buf1 = empty_strided_cuda((), (), torch.float32)
get_raw_stream(0)
triton_per_fused__to_copy_gt_sum_0[grid(1)](arg2_1, buf0, buf1, 1,
256, num_warps=2, num_stages=1)
del arg2_1
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_zeros_like_1[grid(256)](buf2, 256, XBLOCK=128,
num_warps=4, num_stages=1)
buf3 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_abs_sigmoid_sub_2[grid(256)](arg0_1, arg1_1, buf3,
256, XBLOCK=128, num_warps=4, num_stages=1)
del arg0_1
return buf1, arg1_1, buf2, buf3, buf0
def _expand_onehot_labels(labels, label_weights, label_channels):
bin_labels = labels.new_full((labels.size(0), label_channels), 0)
inds = torch.nonzero((labels >= 0) & (labels < label_channels),
as_tuple=False).squeeze()
if inds.numel() > 0:
bin_labels[inds, labels[inds]] = 1
bin_label_weights = label_weights.view(-1, 1).expand(label_weights.size
(0), label_channels)
return bin_labels, bin_label_weights
class GHMCNew(nn.Module):
"""GHM Classification Loss.
Details of the theorem can be viewed in the paper
"Gradient Harmonized Single-stage Detector".
https://arxiv.org/abs/1811.05181
Args:
bins (int): Number of the unit regions for distribution calculation.
momentum (float): The parameter for moving average.
use_sigmoid (bool): Can only be true for BCE based loss now.
loss_weight (float): The weight of the total GHM-C loss.
"""
def __init__(self, bins=10, momentum=0, use_sigmoid=True, loss_weight=1.0):
super(GHMCNew, self).__init__()
self.bins = bins
self.momentum = momentum
edges = torch.arange(bins + 1).float() / bins
self.register_buffer('edges', edges)
self.edges[-1] += 1e-06
if momentum > 0:
acc_sum = torch.zeros(bins)
self.register_buffer('acc_sum', acc_sum)
self.use_sigmoid = use_sigmoid
if not self.use_sigmoid:
raise NotImplementedError
self.loss_weight = loss_weight
def forward(self, input_0, input_1, input_2):
arg0_1 = input_0
arg1_1 = input_1
arg2_1 = input_2
output = call([arg0_1, arg1_1, arg2_1])
return output[0]
|
CK-er/mmdet
|
GHMC
| false | 2,072 |
[
"Apache-2.0"
] | 0 |
9bea4068efbcf7bf739dbe41917a68d525c29868
|
https://github.com/CK-er/mmdet/tree/9bea4068efbcf7bf739dbe41917a68d525c29868
|
BalancedL1Loss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/u6/cu6ipcdjut3ad56lbzon6ze3sumzrsa4berzrqmooidtonkrrxbp.py
# Topologically Sorted Source Nodes: [sub, diff, lt, mul, add, mul_1, mul_2, truediv, add_1, log, mul_3, mul_4, sub_1, mul_5, add_2, sub_2, loss, loss_1, loss_bbox], Original ATen: [aten.sub, aten.abs, aten.lt, aten.mul, aten.add, aten.div, aten.log, aten.where, aten.mean]
# Source node to ATen node mapping:
# add => add
# add_1 => add_1
# add_2 => add_2
# diff => abs_1
# log => log
# loss => where
# loss_1 => mean
# loss_bbox => mul_6
# lt => lt
# mul => mul
# mul_1 => mul_1
# mul_2 => mul_2
# mul_3 => mul_3
# mul_4 => mul_4
# mul_5 => mul_5
# sub => sub
# sub_1 => sub_1
# sub_2 => sub_2
# truediv => div
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %abs_1 : [num_users=5] = call_function[target=torch.ops.aten.abs.default](args = (%sub,), kwargs = {})
# %lt : [num_users=1] = call_function[target=torch.ops.aten.lt.Scalar](args = (%abs_1, 1.0), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%abs_1, 19.085536923187664), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, 1), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%add, 0.02619784824562798), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%abs_1, 19.085536923187664), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%mul_2, 1.0), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%div, 1), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%add_1,), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_1, %log), kwargs = {})
# %mul_4 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%abs_1, 0.5), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%mul_3, %mul_4), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%abs_1, 1.5), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_5, 0.07859354473688394), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%add_2, 0.5), kwargs = {})
# %where : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%lt, %sub_1, %sub_2), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%where,), kwargs = {})
# %mul_6 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 1.0), kwargs = {})
triton_per_fused_abs_add_div_log_lt_mean_mul_sub_where_0 = async_compile.triton('triton_per_fused_abs_add_div_log_lt_mean_mul_sub_where_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_abs_add_div_log_lt_mean_mul_sub_where_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_abs_add_div_log_lt_mean_mul_sub_where_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.load(in_ptr1 + (r0), None)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = 1.0
tmp5 = tmp3 < tmp4
tmp6 = 19.085536923187664
tmp7 = tmp3 * tmp6
tmp8 = tmp7 + tmp4
tmp9 = 0.02619784824562798
tmp10 = tmp8 * tmp9
tmp11 = tmp7 * tmp4
tmp12 = tmp11 + tmp4
tmp13 = tl_math.log(tmp12)
tmp14 = tmp10 * tmp13
tmp15 = 0.5
tmp16 = tmp3 * tmp15
tmp17 = tmp14 - tmp16
tmp18 = 1.5
tmp19 = tmp3 * tmp18
tmp20 = 0.07859354473688394
tmp21 = tmp19 + tmp20
tmp22 = tmp21 - tmp15
tmp23 = tl.where(tmp5, tmp17, tmp22)
tmp24 = tl.broadcast_to(tmp23, [RBLOCK])
tmp26 = triton_helpers.promote_to_tensor(tl.sum(tmp24, 0))
tmp27 = 256.0
tmp28 = tmp26 / tmp27
tmp29 = tmp28 * tmp4
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp29, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [sub, diff, lt, mul, add, mul_1, mul_2, truediv, add_1, log, mul_3, mul_4, sub_1, mul_5, add_2, sub_2, loss, loss_1, loss_bbox], Original ATen: [aten.sub, aten.abs, aten.lt, aten.mul, aten.add, aten.div, aten.log, aten.where, aten.mean]
stream0 = get_raw_stream(0)
triton_per_fused_abs_add_div_log_lt_mean_mul_sub_where_0.run(buf1, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import functools
import torch
import numpy as np
import torch.nn as nn
import torch.nn.functional as F
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def balanced_l1_loss(pred, target, beta=1.0, alpha=0.5, gamma=1.5,
reduction='mean'):
assert beta > 0
assert pred.size() == target.size() and target.numel() > 0
diff = torch.abs(pred - target)
b = np.e ** (gamma / alpha) - 1
loss = torch.where(diff < beta, alpha / b * (b * diff + 1) * torch.log(
b * diff / beta + 1) - alpha * diff, gamma * diff + gamma / b -
alpha * beta)
return loss
class BalancedL1Loss(nn.Module):
"""Balanced L1 Loss
arXiv: https://arxiv.org/pdf/1904.02701.pdf (CVPR 2019)
"""
def __init__(self, alpha=0.5, gamma=1.5, beta=1.0, reduction='mean',
loss_weight=1.0):
super(BalancedL1Loss, self).__init__()
self.alpha = alpha
self.gamma = gamma
self.beta = beta
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, pred, target, weight=None, avg_factor=None,
reduction_override=None, **kwargs):
assert reduction_override in (None, 'none', 'mean', 'sum')
reduction = (reduction_override if reduction_override else self.
reduction)
loss_bbox = self.loss_weight * balanced_l1_loss(pred, target,
weight, alpha=self.alpha, gamma=self.gamma, beta=self.beta,
reduction=reduction, avg_factor=avg_factor, **kwargs)
return loss_bbox
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import functools
import numpy as np
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_abs_add_div_log_lt_mean_mul_sub_where_0(in_out_ptr0,
in_ptr0, in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.load(in_ptr1 + r0, None)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.abs(tmp2)
tmp4 = 1.0
tmp5 = tmp3 < tmp4
tmp6 = 19.085536923187664
tmp7 = tmp3 * tmp6
tmp8 = tmp7 + tmp4
tmp9 = 0.02619784824562798
tmp10 = tmp8 * tmp9
tmp11 = tmp7 * tmp4
tmp12 = tmp11 + tmp4
tmp13 = tl_math.log(tmp12)
tmp14 = tmp10 * tmp13
tmp15 = 0.5
tmp16 = tmp3 * tmp15
tmp17 = tmp14 - tmp16
tmp18 = 1.5
tmp19 = tmp3 * tmp18
tmp20 = 0.07859354473688394
tmp21 = tmp19 + tmp20
tmp22 = tmp21 - tmp15
tmp23 = tl.where(tmp5, tmp17, tmp22)
tmp24 = tl.broadcast_to(tmp23, [RBLOCK])
tmp26 = triton_helpers.promote_to_tensor(tl.sum(tmp24, 0))
tmp27 = 256.0
tmp28 = tmp26 / tmp27
tmp29 = tmp28 * tmp4
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp29, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_abs_add_div_log_lt_mean_mul_sub_where_0[grid(1)](buf1,
arg0_1, arg1_1, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
def reduce_loss(loss, reduction):
"""Reduce loss as specified.
Args:
loss (Tensor): Elementwise loss tensor.
reduction (str): Options are "none", "mean" and "sum".
Return:
Tensor: Reduced loss tensor.
"""
reduction_enum = F._Reduction.get_enum(reduction)
if reduction_enum == 0:
return loss
elif reduction_enum == 1:
return loss.mean()
elif reduction_enum == 2:
return loss.sum()
def weight_reduce_loss(loss, weight=None, reduction='mean', avg_factor=None):
"""Apply element-wise weight and reduce loss.
Args:
loss (Tensor): Element-wise loss.
weight (Tensor): Element-wise weights.
reduction (str): Same as built-in losses of PyTorch.
avg_factor (float): Avarage factor when computing the mean of losses.
Returns:
Tensor: Processed loss values.
"""
if weight is not None:
loss = loss * weight
if avg_factor is None:
loss = reduce_loss(loss, reduction)
elif reduction == 'mean':
loss = loss.sum() / avg_factor
elif reduction != 'none':
raise ValueError('avg_factor can not be used with reduction="sum"')
return loss
def weighted_loss(loss_func):
"""Create a weighted version of a given loss function.
To use this decorator, the loss function must have the signature like
`loss_func(pred, target, **kwargs)`. The function only needs to compute
element-wise loss without any reduction. This decorator will add weight
and reduction arguments to the function. The decorated function will have
the signature like `loss_func(pred, target, weight=None, reduction='mean',
avg_factor=None, **kwargs)`.
:Example:
>>> import torch
>>> @weighted_loss
>>> def l1_loss(pred, target):
>>> return (pred - target).abs()
>>> pred = torch.Tensor([0, 2, 3])
>>> target = torch.Tensor([1, 1, 1])
>>> weight = torch.Tensor([1, 0, 1])
>>> l1_loss(pred, target)
tensor(1.3333)
>>> l1_loss(pred, target, weight)
tensor(1.)
>>> l1_loss(pred, target, reduction='none')
tensor([1., 1., 2.])
>>> l1_loss(pred, target, weight, avg_factor=2)
tensor(1.5000)
"""
@functools.wraps(loss_func)
def wrapper(pred, target, weight=None, reduction='mean', avg_factor=
None, **kwargs):
loss = loss_func(pred, target, **kwargs)
loss = weight_reduce_loss(loss, weight, reduction, avg_factor)
return loss
return wrapper
@weighted_loss
def balanced_l1_loss(pred, target, beta=1.0, alpha=0.5, gamma=1.5,
reduction='mean'):
assert beta > 0
assert pred.size() == target.size() and target.numel() > 0
diff = torch.abs(pred - target)
b = np.e ** (gamma / alpha) - 1
loss = torch.where(diff < beta, alpha / b * (b * diff + 1) * torch.log(
b * diff / beta + 1) - alpha * diff, gamma * diff + gamma / b -
alpha * beta)
return loss
class BalancedL1LossNew(nn.Module):
"""Balanced L1 Loss
arXiv: https://arxiv.org/pdf/1904.02701.pdf (CVPR 2019)
"""
def __init__(self, alpha=0.5, gamma=1.5, beta=1.0, reduction='mean',
loss_weight=1.0):
super(BalancedL1LossNew, self).__init__()
self.alpha = alpha
self.gamma = gamma
self.beta = beta
self.reduction = reduction
self.loss_weight = loss_weight
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
CK-er/mmdet
|
BalancedL1Loss
| false | 2,073 |
[
"Apache-2.0"
] | 0 |
9bea4068efbcf7bf739dbe41917a68d525c29868
|
https://github.com/CK-er/mmdet/tree/9bea4068efbcf7bf739dbe41917a68d525c29868
|
GMP
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/6e/c6eujplkdmgoanbwrnlvpa2dq2cwdfnps7shcftx2nbyinknnsn4.py
# Topologically Sorted Source Nodes: [max_1], Original ATen: [aten.max]
# Source node to ATen node mapping:
# max_1 => getitem
# Graph fragment:
# %getitem : [num_users=1] = call_function[target=operator.getitem](args = (%max_1, 0), kwargs = {})
triton_poi_fused_max_0 = async_compile.triton('triton_poi_fused_max_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_max_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_max_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (4*x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp2 = triton_helpers.maximum(tmp0, tmp1)
tmp4 = triton_helpers.maximum(tmp2, tmp3)
tmp6 = triton_helpers.maximum(tmp4, tmp5)
tl.store(out_ptr0 + (x0), tmp6, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4, 4), (256, 64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [max_1], Original ATen: [aten.max]
stream0 = get_raw_stream(0)
triton_poi_fused_max_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4, 4), (256, 64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
class GMP(torch.nn.Module):
"""A global max pooling module.
Args:
dim (int): The dimension at which to compute the maximum.
"""
def __init__(self, dim: 'int'):
super().__init__()
self.dim = dim
def forward(self, x):
return x.max(dim=self.dim)[0]
def get_inputs():
return [torch.rand([4, 4, 4, 4, 4])]
def get_init_inputs():
return [[], {'dim': 4}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_max_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + 4 * x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + 4 * x0), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (2 + 4 * x0), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (3 + 4 * x0), xmask, eviction_policy='evict_last')
tmp2 = triton_helpers.maximum(tmp0, tmp1)
tmp4 = triton_helpers.maximum(tmp2, tmp3)
tmp6 = triton_helpers.maximum(tmp4, tmp5)
tl.store(out_ptr0 + x0, tmp6, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4, 4), (256, 64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_max_0[grid(256)](arg0_1, buf0, 256, XBLOCK=128,
num_warps=4, num_stages=1)
del arg0_1
return buf0,
class GMPNew(torch.nn.Module):
"""A global max pooling module.
Args:
dim (int): The dimension at which to compute the maximum.
"""
def __init__(self, dim: 'int'):
super().__init__()
self.dim = dim
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
CLARITI-REPHRAIN/mumin-trawl
|
GMP
| false | 2,074 |
[
"MIT"
] | 0 |
8a7eda49d8740e927332cd3972750d0b54c23eb1
|
https://github.com/CLARITI-REPHRAIN/mumin-trawl/tree/8a7eda49d8740e927332cd3972750d0b54c23eb1
|
CombinedTargetMSELoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/3f/c3fha6hwigp5qdkirvgzpdtvtztnza4ys4zevam5i2owamrhkdzx.py
# Topologically Sorted Source Nodes: [heatmap_pred_1, heatmap_gt_1, mse_loss, mul_2, loss, mul_3, mul_4, mse_loss_1, mul_5, loss_1, mul_6, mul_7, mse_loss_2, mul_8, loss_2, truediv, mul_9], Original ATen: [aten.mul, aten.mse_loss, aten.add, aten.div]
# Source node to ATen node mapping:
# heatmap_gt_1 => mul_1
# heatmap_pred_1 => mul
# loss => add
# loss_1 => add_1
# loss_2 => add_2
# mse_loss => mean, pow_1, sub
# mse_loss_1 => mean_1, pow_2, sub_1
# mse_loss_2 => mean_2, pow_3, sub_2
# mul_2 => mul_2
# mul_3 => mul_3
# mul_4 => mul_4
# mul_5 => mul_5
# mul_6 => mul_6
# mul_7 => mul_7
# mul_8 => mul_8
# mul_9 => mul_9
# truediv => div
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze, %select), kwargs = {})
# %mul_1 : [num_users=5] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_1, %select_1), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%mul, %mul_1), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub, 2), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%pow_1,), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 0.5), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_2, 0.0), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_1, %squeeze_2), kwargs = {})
# %mul_4 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_1, %squeeze_3), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%mul_3, %mul_4), kwargs = {})
# %pow_2 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub_1, 2), kwargs = {})
# %mean_1 : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%pow_2,), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean_1, 0.5), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%add, %mul_5), kwargs = {})
# %mul_6 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_1, %squeeze_4), kwargs = {})
# %mul_7 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_1, %squeeze_5), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%mul_6, %mul_7), kwargs = {})
# %pow_3 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub_2, 2), kwargs = {})
# %mean_2 : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%pow_3,), kwargs = {})
# %mul_8 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean_2, 0.5), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%add_1, %mul_8), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%add_2, 1), kwargs = {})
# %mul_9 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%div, 1.0), kwargs = {})
triton_per_fused_add_div_mse_loss_mul_0 = async_compile.triton('triton_per_fused_add_div_mse_loss_mul_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 4],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {4: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=(4,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_div_mse_loss_mul_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 7, 'num_reduction': 3, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_div_mse_loss_mul_0(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 1
rnumel = 4
RBLOCK: tl.constexpr = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (4*r0), None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (4*r0), None, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (4*r0), None, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr0 + (1 + (4*r0)), None, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr2 + (1 + (4*r0)), None, eviction_policy='evict_last')
tmp19 = tl.load(in_ptr0 + (2 + (4*r0)), None, eviction_policy='evict_last')
tmp21 = tl.load(in_ptr2 + (2 + (4*r0)), None, eviction_policy='evict_last')
tmp2 = tmp0 * tmp1
tmp4 = tmp3 * tmp1
tmp5 = tmp2 - tmp4
tmp6 = tmp5 * tmp5
tmp7 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp9 = tl.sum(tmp7, 1)[:, None]
tmp11 = tmp4 * tmp10
tmp13 = tmp4 * tmp12
tmp14 = tmp11 - tmp13
tmp15 = tmp14 * tmp14
tmp16 = tl.broadcast_to(tmp15, [XBLOCK, RBLOCK])
tmp18 = tl.sum(tmp16, 1)[:, None]
tmp20 = tmp4 * tmp19
tmp22 = tmp4 * tmp21
tmp23 = tmp20 - tmp22
tmp24 = tmp23 * tmp23
tmp25 = tl.broadcast_to(tmp24, [XBLOCK, RBLOCK])
tmp27 = tl.sum(tmp25, 1)[:, None]
tmp28 = 4.0
tmp29 = tmp9 / tmp28
tmp30 = 0.5
tmp31 = tmp29 * tmp30
tmp32 = 0.0
tmp33 = tmp31 + tmp32
tmp34 = tmp18 / tmp28
tmp35 = tmp34 * tmp30
tmp36 = tmp33 + tmp35
tmp37 = tmp27 / tmp28
tmp38 = tmp37 * tmp30
tmp39 = tmp36 + tmp38
tmp40 = 1.0
tmp41 = tmp39 * tmp40
tmp42 = tmp41 * tmp40
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([XBLOCK, 1], 0, tl.int32)), tmp42, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4), (4, 1))
assert_size_stride(arg1_1, (4, 4), (4, 1))
assert_size_stride(arg2_1, (4, 4), (4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf3 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [heatmap_pred_1, heatmap_gt_1, mse_loss, mul_2, loss, mul_3, mul_4, mse_loss_1, mul_5, loss_1, mul_6, mul_7, mse_loss_2, mul_8, loss_2, truediv, mul_9], Original ATen: [aten.mul, aten.mse_loss, aten.add, aten.div]
stream0 = get_raw_stream(0)
triton_per_fused_add_div_mse_loss_mul_0.run(buf3, arg0_1, arg2_1, arg1_1, 1, 4, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
del arg2_1
return (buf3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
arg2_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1, arg2_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class CombinedTargetMSELoss(nn.Module):
"""MSE loss for combined target.
CombinedTarget: The combination of classification target
(response map) and regression target (offset map).
Paper ref: Huang et al. The Devil is in the Details: Delving into
Unbiased Data Processing for Human Pose Estimation (CVPR 2020).
Args:
use_target_weight (bool): Option to use weighted MSE loss.
Different joint types may have different target weights.
loss_weight (float): Weight of the loss. Default: 1.0.
"""
def __init__(self, use_target_weight, loss_weight=1.0):
super().__init__()
self.criterion = nn.MSELoss(reduction='mean')
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
def forward(self, output, target, target_weight):
batch_size = output.size(0)
num_channels = output.size(1)
heatmaps_pred = output.reshape((batch_size, num_channels, -1)).split(
1, 1)
heatmaps_gt = target.reshape((batch_size, num_channels, -1)).split(1, 1
)
loss = 0.0
num_joints = num_channels // 3
for idx in range(num_joints):
heatmap_pred = heatmaps_pred[idx * 3].squeeze()
heatmap_gt = heatmaps_gt[idx * 3].squeeze()
offset_x_pred = heatmaps_pred[idx * 3 + 1].squeeze()
offset_x_gt = heatmaps_gt[idx * 3 + 1].squeeze()
offset_y_pred = heatmaps_pred[idx * 3 + 2].squeeze()
offset_y_gt = heatmaps_gt[idx * 3 + 2].squeeze()
if self.use_target_weight:
heatmap_pred = heatmap_pred * target_weight[:, idx]
heatmap_gt = heatmap_gt * target_weight[:, idx]
loss += 0.5 * self.criterion(heatmap_pred, heatmap_gt)
loss += 0.5 * self.criterion(heatmap_gt * offset_x_pred,
heatmap_gt * offset_x_gt)
loss += 0.5 * self.criterion(heatmap_gt * offset_y_pred,
heatmap_gt * offset_y_gt)
return loss / num_joints * self.loss_weight
def get_inputs():
return [torch.rand([4, 4]), torch.rand([4, 4]), torch.rand([4, 4])]
def get_init_inputs():
return [[], {'use_target_weight': 4}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_div_mse_loss_mul_0(in_out_ptr0, in_ptr0, in_ptr1,
in_ptr2, xnumel, rnumel, XBLOCK: tl.constexpr):
RBLOCK: tl.constexpr = 4
xoffset = tl.program_id(0) * XBLOCK
xoffset + tl.arange(0, XBLOCK)[:, None]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + 4 * r0, None, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + 4 * r0, None, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + 4 * r0, None, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr0 + (1 + 4 * r0), None, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr2 + (1 + 4 * r0), None, eviction_policy='evict_last')
tmp19 = tl.load(in_ptr0 + (2 + 4 * r0), None, eviction_policy='evict_last')
tmp21 = tl.load(in_ptr2 + (2 + 4 * r0), None, eviction_policy='evict_last')
tmp2 = tmp0 * tmp1
tmp4 = tmp3 * tmp1
tmp5 = tmp2 - tmp4
tmp6 = tmp5 * tmp5
tmp7 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp9 = tl.sum(tmp7, 1)[:, None]
tmp11 = tmp4 * tmp10
tmp13 = tmp4 * tmp12
tmp14 = tmp11 - tmp13
tmp15 = tmp14 * tmp14
tmp16 = tl.broadcast_to(tmp15, [XBLOCK, RBLOCK])
tmp18 = tl.sum(tmp16, 1)[:, None]
tmp20 = tmp4 * tmp19
tmp22 = tmp4 * tmp21
tmp23 = tmp20 - tmp22
tmp24 = tmp23 * tmp23
tmp25 = tl.broadcast_to(tmp24, [XBLOCK, RBLOCK])
tmp27 = tl.sum(tmp25, 1)[:, None]
tmp28 = 4.0
tmp29 = tmp9 / tmp28
tmp30 = 0.5
tmp31 = tmp29 * tmp30
tmp32 = 0.0
tmp33 = tmp31 + tmp32
tmp34 = tmp18 / tmp28
tmp35 = tmp34 * tmp30
tmp36 = tmp33 + tmp35
tmp37 = tmp27 / tmp28
tmp38 = tmp37 * tmp30
tmp39 = tmp36 + tmp38
tmp40 = 1.0
tmp41 = tmp39 * tmp40
tmp42 = tmp41 * tmp40
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([XBLOCK, 1], 0, tl.int32), tmp42, None)
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4), (4, 1))
assert_size_stride(arg1_1, (4, 4), (4, 1))
assert_size_stride(arg2_1, (4, 4), (4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf3 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_add_div_mse_loss_mul_0[grid(1)](buf3, arg0_1,
arg2_1, arg1_1, 1, 4, XBLOCK=1, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
del arg2_1
return buf3,
class CombinedTargetMSELossNew(nn.Module):
"""MSE loss for combined target.
CombinedTarget: The combination of classification target
(response map) and regression target (offset map).
Paper ref: Huang et al. The Devil is in the Details: Delving into
Unbiased Data Processing for Human Pose Estimation (CVPR 2020).
Args:
use_target_weight (bool): Option to use weighted MSE loss.
Different joint types may have different target weights.
loss_weight (float): Weight of the loss. Default: 1.0.
"""
def __init__(self, use_target_weight, loss_weight=1.0):
super().__init__()
self.criterion = nn.MSELoss(reduction='mean')
self.use_target_weight = use_target_weight
self.loss_weight = loss_weight
def forward(self, input_0, input_1, input_2):
arg0_1 = input_0
arg1_1 = input_1
arg2_1 = input_2
output = call([arg0_1, arg1_1, arg2_1])
return output[0]
|
ALISCIFP/mmpose
|
CombinedTargetMSELoss
| false | 2,075 |
[
"Apache-2.0"
] | 0 |
2433e3dbcc44baa2253e2a7c748ba0216937933e
|
https://github.com/ALISCIFP/mmpose/tree/2433e3dbcc44baa2253e2a7c748ba0216937933e
|
Embedding
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/nc/cncwsucylpsg2zmlivjfxu6vbd64ztxjndlsix2ysjtby3xohgk4.py
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten.tanh]
# Source node to ATen node mapping:
# x_1 => tanh
# Graph fragment:
# %tanh : [num_users=1] = call_function[target=torch.ops.aten.tanh.default](args = (%view_1,), kwargs = {})
triton_poi_fused_tanh_0 = async_compile.triton('triton_poi_fused_tanh_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_tanh_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_tanh_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = libdevice.tanh(tmp2)
tl.store(in_out_ptr0 + (x2), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf0 # reuse
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten.tanh]
stream0 = get_raw_stream(0)
triton_poi_fused_tanh_0.run(buf1, primals_2, 256, grid=grid(256), stream=stream0)
del primals_2
return (buf1, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
class Embedding(nn.Module):
def __init__(self, in_dim, out_dim):
super(Embedding, self).__init__()
self.linear = nn.Linear(in_dim, out_dim)
self.tanh = nn.Tanh()
def forward(self, x):
x = self.linear(x)
x = self.tanh(x)
return x
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'in_dim': 4, 'out_dim': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_tanh_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = libdevice.tanh(tmp2)
tl.store(in_out_ptr0 + x2, tmp3, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf0
get_raw_stream(0)
triton_poi_fused_tanh_0[grid(256)](buf1, primals_2, 256, XBLOCK=256,
num_warps=4, num_stages=1)
del primals_2
return buf1, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), buf1
class EmbeddingNew(nn.Module):
def __init__(self, in_dim, out_dim):
super(EmbeddingNew, self).__init__()
self.linear = nn.Linear(in_dim, out_dim)
self.tanh = nn.Tanh()
def forward(self, input_0):
primals_1 = self.linear.weight
primals_2 = self.linear.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
CFM-MSG/Code_TFUN
|
Embedding
| false | 2,076 |
[
"MIT"
] | 0 |
39aebd748a0191e532eb81144386741e98a58e73
|
https://github.com/CFM-MSG/Code_TFUN/tree/39aebd748a0191e532eb81144386741e98a58e73
|
Norm
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/df/cdfcie57v6pcdd6oeaz4mvlgksxgyuxzmlv5bklwemyulqhtcxta.py
# Topologically Sorted Source Nodes: [mean, sub, mul, std, add, truediv, norm], Original ATen: [aten.mean, aten.sub, aten.mul, aten.std, aten.add, aten.div]
# Source node to ATen node mapping:
# add => add
# mean => mean
# mul => mul
# norm => add_1
# std => sqrt, var
# sub => sub
# truediv => div
# Graph fragment:
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%primals_2, [-1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%primals_2, %mean), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_1, %sub), kwargs = {})
# %var : [num_users=1] = call_function[target=torch.ops.aten.var.correction](args = (%primals_2, [-1]), kwargs = {correction: 1.0, keepdim: True})
# %sqrt : [num_users=1] = call_function[target=torch.ops.aten.sqrt.default](args = (%var,), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sqrt, 1e-06), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%mul, %add), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%div, %primals_3), kwargs = {})
triton_poi_fused_add_div_mean_mul_std_sub_0 = async_compile.triton('triton_poi_fused_add_div_mean_mul_std_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_div_mean_mul_std_sub_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 7, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_div_mean_mul_std_sub_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask)
tmp2 = tl.load(in_ptr1 + (4*x1), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr1 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr1 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + (x0), xmask, eviction_policy='evict_last')
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp8 = tmp6 + tmp7
tmp9 = 4.0
tmp10 = tmp8 / tmp9
tmp11 = tmp1 - tmp10
tmp12 = tmp0 * tmp11
tmp13 = tmp2 - tmp10
tmp14 = tmp13 * tmp13
tmp15 = tmp3 - tmp10
tmp16 = tmp15 * tmp15
tmp17 = tmp14 + tmp16
tmp18 = tmp5 - tmp10
tmp19 = tmp18 * tmp18
tmp20 = tmp17 + tmp19
tmp21 = tmp7 - tmp10
tmp22 = tmp21 * tmp21
tmp23 = tmp20 + tmp22
tmp24 = 3.0
tmp25 = tmp23 / tmp24
tmp26 = libdevice.sqrt(tmp25)
tmp27 = 1e-06
tmp28 = tmp26 + tmp27
tmp29 = tmp12 / tmp28
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + (x2), tmp31, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, ), (1, ))
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_3, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [mean, sub, mul, std, add, truediv, norm], Original ATen: [aten.mean, aten.sub, aten.mul, aten.std, aten.add, aten.div]
stream0 = get_raw_stream(0)
triton_poi_fused_add_div_mean_mul_std_sub_0.run(primals_1, primals_2, primals_3, buf0, 256, grid=grid(256), stream=stream0)
del primals_1
del primals_3
return (buf0, primals_2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class Norm(nn.Module):
def __init__(self, d_model, eps=1e-06):
super().__init__()
self.size = d_model
self.alpha = nn.Parameter(torch.ones(self.size))
self.bias = nn.Parameter(torch.zeros(self.size))
self.eps = eps
def forward(self, x):
norm = self.alpha * (x - x.mean(dim=-1, keepdim=True)) / (x.std(dim
=-1, keepdim=True) + self.eps) + self.bias
return norm
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'d_model': 4}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_add_div_mean_mul_std_sub_0(in_ptr0, in_ptr1, in_ptr2,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask)
tmp2 = tl.load(in_ptr1 + 4 * x1, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr1 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr1 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + x0, xmask, eviction_policy='evict_last')
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp8 = tmp6 + tmp7
tmp9 = 4.0
tmp10 = tmp8 / tmp9
tmp11 = tmp1 - tmp10
tmp12 = tmp0 * tmp11
tmp13 = tmp2 - tmp10
tmp14 = tmp13 * tmp13
tmp15 = tmp3 - tmp10
tmp16 = tmp15 * tmp15
tmp17 = tmp14 + tmp16
tmp18 = tmp5 - tmp10
tmp19 = tmp18 * tmp18
tmp20 = tmp17 + tmp19
tmp21 = tmp7 - tmp10
tmp22 = tmp21 * tmp21
tmp23 = tmp20 + tmp22
tmp24 = 3.0
tmp25 = tmp23 / tmp24
tmp26 = libdevice.sqrt(tmp25)
tmp27 = 1e-06
tmp28 = tmp26 + tmp27
tmp29 = tmp12 / tmp28
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + x2, tmp31, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4,), (1,))
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_3, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_add_div_mean_mul_std_sub_0[grid(256)](primals_1,
primals_2, primals_3, buf0, 256, XBLOCK=128, num_warps=4,
num_stages=1)
del primals_1
del primals_3
return buf0, primals_2
class NormNew(nn.Module):
def __init__(self, d_model, eps=1e-06):
super().__init__()
self.size = d_model
self.alpha = nn.Parameter(torch.ones(self.size))
self.bias = nn.Parameter(torch.zeros(self.size))
self.eps = eps
def forward(self, input_0):
primals_1 = self.alpha
primals_3 = self.bias
primals_2 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
CS-savvy/Transformer-for-Parkinsons-disease
|
Norm
| false | 2,077 |
[
"MIT"
] | 0 |
42ef54071092f4aab74c8b9ec82c52e944806a5b
|
https://github.com/CS-savvy/Transformer-for-Parkinsons-disease/tree/42ef54071092f4aab74c8b9ec82c52e944806a5b
|
MemoryEfficientSwish
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/6b/c6bpxckx47becppkk5ixcba2hybdk775hnag55qn2o7x3tn3gaks.py
# Topologically Sorted Source Nodes: [sigmoid, result], Original ATen: [aten.sigmoid, aten.mul]
# Source node to ATen node mapping:
# result => mul
# sigmoid => sigmoid
# Graph fragment:
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%arg0_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg0_1, %sigmoid), kwargs = {})
triton_poi_fused_mul_sigmoid_0 = async_compile.triton('triton_poi_fused_mul_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mul_sigmoid_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mul_sigmoid_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = tl.sigmoid(tmp0)
tmp2 = tmp0 * tmp1
tl.store(out_ptr0 + (x0), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [sigmoid, result], Original ATen: [aten.sigmoid, aten.mul]
stream0 = get_raw_stream(0)
triton_poi_fused_mul_sigmoid_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class SwishImplementation(torch.autograd.Function):
@staticmethod
def forward(ctx, i):
result = i * torch.sigmoid(i)
ctx.save_for_backward(i)
return result
@staticmethod
def backward(ctx, grad_output):
i = ctx.saved_variables[0]
sigmoid_i = torch.sigmoid(i)
return grad_output * (sigmoid_i * (1 + i * (1 - sigmoid_i)))
class MemoryEfficientSwish(nn.Module):
def forward(self, x):
return SwishImplementation.apply(x)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_mul_sigmoid_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = tl.sigmoid(tmp0)
tmp2 = tmp0 * tmp1
tl.store(out_ptr0 + x0, tmp2, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_mul_sigmoid_0[grid(256)](arg0_1, buf0, 256, XBLOCK
=256, num_warps=4, num_stages=1)
del arg0_1
return buf0,
class SwishImplementation(torch.autograd.Function):
@staticmethod
def forward(ctx, i):
result = i * torch.sigmoid(i)
ctx.save_for_backward(i)
return result
@staticmethod
def backward(ctx, grad_output):
i = ctx.saved_variables[0]
sigmoid_i = torch.sigmoid(i)
return grad_output * (sigmoid_i * (1 + i * (1 - sigmoid_i)))
class MemoryEfficientSwishNew(nn.Module):
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
BradleyBrown19/CustomObjectDetector
|
MemoryEfficientSwish
| false | 2,078 |
[
"Apache-2.0"
] | 0 |
11c14ec6127c553ac365703c768b75dde33d9a4d
|
https://github.com/BradleyBrown19/CustomObjectDetector/tree/11c14ec6127c553ac365703c768b75dde33d9a4d
|
NormImageUint8ToFloat
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/hf/chftyiuffpb2v7bher7vsxlyw3iwfioyrkg6ecbktbverh2vqo4n.py
# Topologically Sorted Source Nodes: [truediv, sub, mul], Original ATen: [aten.div, aten.sub, aten.mul]
# Source node to ATen node mapping:
# mul => mul
# sub => sub
# truediv => div
# Graph fragment:
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%arg0_1, 255.0), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%div, 0.5), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, 2.0), kwargs = {})
triton_poi_fused_div_mul_sub_0 = async_compile.triton('triton_poi_fused_div_mul_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_div_mul_sub_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_div_mul_sub_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = 0.00392156862745098
tmp2 = tmp0 * tmp1
tmp3 = 0.5
tmp4 = tmp2 - tmp3
tmp5 = 2.0
tmp6 = tmp4 * tmp5
tl.store(out_ptr0 + (x0), tmp6, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [truediv, sub, mul], Original ATen: [aten.div, aten.sub, aten.mul]
stream0 = get_raw_stream(0)
triton_poi_fused_div_mul_sub_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
from torch.nn import Module
import torch
class NormImageUint8ToFloat(Module):
def forward(self, im):
return 2.0 * (im / 255.0 - 0.5)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch.nn import Module
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_div_mul_sub_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = 0.00392156862745098
tmp2 = tmp0 * tmp1
tmp3 = 0.5
tmp4 = tmp2 - tmp3
tmp5 = 2.0
tmp6 = tmp4 * tmp5
tl.store(out_ptr0 + x0, tmp6, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_div_mul_sub_0[grid(256)](arg0_1, buf0, 256, XBLOCK
=256, num_warps=4, num_stages=1)
del arg0_1
return buf0,
class NormImageUint8ToFloatNew(Module):
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
CeadeS/PyTorchH5Dataset
|
NormImageUint8ToFloat
| false | 2,079 |
[
"BSD-3-Clause"
] | 0 |
9ee6e49f2a780345abd708abf2e0c47bb5475e0a
|
https://github.com/CeadeS/PyTorchH5Dataset/tree/9ee6e49f2a780345abd708abf2e0c47bb5475e0a
|
KLDLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/zr/czrva32bkzh7gc4m4iq6o3uf3s3wjxedhrlykq5h5eie22ufcb2x.py
# Topologically Sorted Source Nodes: [add, pow_1, sub, exp, sub_1, sum_1, kld_loss, kld_loss_1], Original ATen: [aten.add, aten.pow, aten.sub, aten.exp, aten.sum, aten.mul]
# Source node to ATen node mapping:
# add => add
# exp => exp
# kld_loss => mul
# kld_loss_1 => sum_2
# pow_1 => pow_1
# sub => sub
# sub_1 => sub_1
# sum_1 => sum_1
# Graph fragment:
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%arg0_1, 1), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%arg1_1, 2), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%add, %pow_1), kwargs = {})
# %exp : [num_users=1] = call_function[target=torch.ops.aten.exp.default](args = (%arg0_1,), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sub, %exp), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%sub_1, [1]), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sum_1, -0.5), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%mul,), kwargs = {})
triton_per_fused_add_exp_mul_pow_sub_sum_0 = async_compile.triton('triton_per_fused_add_exp_mul_pow_sub_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_exp_mul_pow_sub_sum_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_exp_mul_pow_sub_sum_0(in_ptr0, in_ptr1, out_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 1
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex % 16
r1 = (rindex // 16)
r2 = rindex
tmp0 = tl.load(in_ptr0 + (r0 + (64*r1)), None)
tmp3 = tl.load(in_ptr1 + (r0 + (64*r1)), None)
tmp8 = tl.load(in_ptr0 + (16 + r0 + (64*r1)), None)
tmp10 = tl.load(in_ptr1 + (16 + r0 + (64*r1)), None)
tmp16 = tl.load(in_ptr0 + (32 + r0 + (64*r1)), None)
tmp18 = tl.load(in_ptr1 + (32 + r0 + (64*r1)), None)
tmp24 = tl.load(in_ptr0 + (48 + r0 + (64*r1)), None)
tmp26 = tl.load(in_ptr1 + (48 + r0 + (64*r1)), None)
tmp1 = 1.0
tmp2 = tmp0 + tmp1
tmp4 = tmp3 * tmp3
tmp5 = tmp2 - tmp4
tmp6 = tl_math.exp(tmp0)
tmp7 = tmp5 - tmp6
tmp9 = tmp8 + tmp1
tmp11 = tmp10 * tmp10
tmp12 = tmp9 - tmp11
tmp13 = tl_math.exp(tmp8)
tmp14 = tmp12 - tmp13
tmp15 = tmp7 + tmp14
tmp17 = tmp16 + tmp1
tmp19 = tmp18 * tmp18
tmp20 = tmp17 - tmp19
tmp21 = tl_math.exp(tmp16)
tmp22 = tmp20 - tmp21
tmp23 = tmp15 + tmp22
tmp25 = tmp24 + tmp1
tmp27 = tmp26 * tmp26
tmp28 = tmp25 - tmp27
tmp29 = tl_math.exp(tmp24)
tmp30 = tmp28 - tmp29
tmp31 = tmp23 + tmp30
tmp32 = -0.5
tmp33 = tmp31 * tmp32
tmp34 = tl.broadcast_to(tmp33, [XBLOCK, RBLOCK])
tmp36 = tl.sum(tmp34, 1)[:, None]
tl.store(out_ptr1 + (tl.full([XBLOCK, 1], 0, tl.int32)), tmp36, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((), (), torch.float32)
# Topologically Sorted Source Nodes: [add, pow_1, sub, exp, sub_1, sum_1, kld_loss, kld_loss_1], Original ATen: [aten.add, aten.pow, aten.sub, aten.exp, aten.sum, aten.mul]
stream0 = get_raw_stream(0)
triton_per_fused_add_exp_mul_pow_sub_sum_0.run(arg0_1, arg1_1, buf1, 1, 64, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
class KLDLoss(nn.Module):
def __init__(self, reduction='sum'):
super(KLDLoss, self).__init__()
self.reduction = reduction
def forward(self, mean, logvar):
kld_loss = -0.5 * torch.sum(1 + logvar - mean.pow(2) - logvar.exp(), 1)
if self.reduction == 'mean':
kld_loss = torch.mean(kld_loss)
elif self.reduction == 'sum':
kld_loss = torch.sum(kld_loss)
return kld_loss
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import math as tl_math
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_exp_mul_pow_sub_sum_0(in_ptr0, in_ptr1, out_ptr1,
xnumel, rnumel, XBLOCK: tl.constexpr):
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xoffset + tl.arange(0, XBLOCK)[:, None]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex % 16
r1 = rindex // 16
tmp0 = tl.load(in_ptr0 + (r0 + 64 * r1), None)
tmp3 = tl.load(in_ptr1 + (r0 + 64 * r1), None)
tmp8 = tl.load(in_ptr0 + (16 + r0 + 64 * r1), None)
tmp10 = tl.load(in_ptr1 + (16 + r0 + 64 * r1), None)
tmp16 = tl.load(in_ptr0 + (32 + r0 + 64 * r1), None)
tmp18 = tl.load(in_ptr1 + (32 + r0 + 64 * r1), None)
tmp24 = tl.load(in_ptr0 + (48 + r0 + 64 * r1), None)
tmp26 = tl.load(in_ptr1 + (48 + r0 + 64 * r1), None)
tmp1 = 1.0
tmp2 = tmp0 + tmp1
tmp4 = tmp3 * tmp3
tmp5 = tmp2 - tmp4
tmp6 = tl_math.exp(tmp0)
tmp7 = tmp5 - tmp6
tmp9 = tmp8 + tmp1
tmp11 = tmp10 * tmp10
tmp12 = tmp9 - tmp11
tmp13 = tl_math.exp(tmp8)
tmp14 = tmp12 - tmp13
tmp15 = tmp7 + tmp14
tmp17 = tmp16 + tmp1
tmp19 = tmp18 * tmp18
tmp20 = tmp17 - tmp19
tmp21 = tl_math.exp(tmp16)
tmp22 = tmp20 - tmp21
tmp23 = tmp15 + tmp22
tmp25 = tmp24 + tmp1
tmp27 = tmp26 * tmp26
tmp28 = tmp25 - tmp27
tmp29 = tl_math.exp(tmp24)
tmp30 = tmp28 - tmp29
tmp31 = tmp23 + tmp30
tmp32 = -0.5
tmp33 = tmp31 * tmp32
tmp34 = tl.broadcast_to(tmp33, [XBLOCK, RBLOCK])
tmp36 = tl.sum(tmp34, 1)[:, None]
tl.store(out_ptr1 + tl.full([XBLOCK, 1], 0, tl.int32), tmp36, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((), (), torch.float32)
get_raw_stream(0)
triton_per_fused_add_exp_mul_pow_sub_sum_0[grid(1)](arg0_1, arg1_1,
buf1, 1, 64, XBLOCK=1, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
class KLDLossNew(nn.Module):
def __init__(self, reduction='sum'):
super(KLDLossNew, self).__init__()
self.reduction = reduction
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
Cc618/Feature-Changer
|
KLDLoss
| false | 2,080 |
[
"MIT"
] | 0 |
7ab82f525c4b5142afec1819732b0fb5f3983152
|
https://github.com/Cc618/Feature-Changer/tree/7ab82f525c4b5142afec1819732b0fb5f3983152
|
Normalize
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/dz/cdzlfn35yag6jtz5ni2o3wxs6zz4qa5ljfjpsrkhqfmlbh3qhae3.py
# Topologically Sorted Source Nodes: [pow_1, sum_1, norm, out], Original ATen: [aten.pow, aten.sum, aten.div]
# Source node to ATen node mapping:
# norm => pow_2
# out => div
# pow_1 => pow_1
# sum_1 => sum_1
# Graph fragment:
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%arg0_1, 2), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%pow_1, [1], True), kwargs = {})
# %pow_2 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sum_1, 0.5), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%arg0_1, %pow_2), kwargs = {})
triton_poi_fused_div_pow_sum_0 = async_compile.triton('triton_poi_fused_div_pow_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_div_pow_sum_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_div_pow_sum_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tmp1 * tmp1
tmp4 = tmp3 * tmp3
tmp5 = tmp2 + tmp4
tmp7 = tmp6 * tmp6
tmp8 = tmp5 + tmp7
tmp10 = tmp9 * tmp9
tmp11 = tmp8 + tmp10
tmp12 = libdevice.sqrt(tmp11)
tmp13 = tmp0 / tmp12
tl.store(out_ptr0 + (x3), tmp13, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [pow_1, sum_1, norm, out], Original ATen: [aten.pow, aten.sum, aten.div]
stream0 = get_raw_stream(0)
triton_poi_fused_div_pow_sum_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class Normalize(nn.Module):
def __init__(self, power=2):
super(Normalize, self).__init__()
self.power = power
def forward(self, x):
norm = x.pow(self.power).sum(1, keepdim=True).pow(1.0 / self.power)
out = x.div(norm)
return out
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_div_pow_sum_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp9 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tmp1 * tmp1
tmp4 = tmp3 * tmp3
tmp5 = tmp2 + tmp4
tmp7 = tmp6 * tmp6
tmp8 = tmp5 + tmp7
tmp10 = tmp9 * tmp9
tmp11 = tmp8 + tmp10
tmp12 = libdevice.sqrt(tmp11)
tmp13 = tmp0 / tmp12
tl.store(out_ptr0 + x3, tmp13, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_div_pow_sum_0[grid(256)](arg0_1, buf0, 256, XBLOCK
=256, num_warps=4, num_stages=1)
del arg0_1
return buf0,
class NormalizeNew(nn.Module):
def __init__(self, power=2):
super(NormalizeNew, self).__init__()
self.power = power
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
Alice1820/CMC
|
Normalize
| false | 2,081 |
[
"BSD-2-Clause"
] | 0 |
4f4354b3a33ec9c0784baefd7d1d9798e191ead5
|
https://github.com/Alice1820/CMC/tree/4f4354b3a33ec9c0784baefd7d1d9798e191ead5
|
Policy
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/md/cmd3ewacyhu5w5hausgbjbmtnt5rr66cgczh4ibdypq7dz6p4v7g.py
# Topologically Sorted Source Nodes: [x_2], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# x_2 => relu
# Graph fragment:
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_1,), kwargs = {})
# %le : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_0 = async_compile.triton('triton_poi_fused_relu_threshold_backward_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[8192],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 8192
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 128
tmp0 = tl.load(in_out_ptr0 + (x2), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, None)
tl.store(out_ptr0 + (x2), tmp6, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/o4/co4ltgolfty6xbtjs454crc7imkotqguqwb6zvbpz2luzl3qkzin.py
# Topologically Sorted Source Nodes: [softmax], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# softmax => amax, exp, sub
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%view_3, [1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_3, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
triton_poi_fused__softmax_1 = async_compile.triton('triton_poi_fused__softmax_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[128],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 8
x2 = (xindex // 32)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (32*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (8 + x0 + (32*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (16 + x0 + (32*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (24 + x0 + (32*x2)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + (x3), tmp9, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/2e/c2ei25xypczil2scpap6sg6cxhom5wssmh3azqrbkeq7nevkrhj7.py
# Topologically Sorted Source Nodes: [softmax], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# softmax => div, sum_1
# Graph fragment:
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [1], True), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
triton_poi_fused__softmax_2 = async_compile.triton('triton_poi_fused__softmax_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[128],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_2(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 8
x2 = (xindex // 32)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (32*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (8 + x0 + (32*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (16 + x0 + (32*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (24 + x0 + (32*x2)), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + (x3), tmp8, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (128, 4), (4, 1))
assert_size_stride(primals_2, (128, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (2, 128), (128, 1))
assert_size_stride(primals_5, (2, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 128), (128, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 128), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 128), (2048, 512, 128, 1), 0); del buf0 # reuse
buf5 = empty_strided_cuda((4, 4, 4, 128), (2048, 512, 128, 1), torch.bool)
# Topologically Sorted Source Nodes: [x_2], Original ATen: [aten.relu, aten.threshold_backward]
stream0 = get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0.run(buf1, primals_2, buf5, 8192, grid=grid(8192), stream=stream0)
del primals_2
buf2 = empty_strided_cuda((64, 2), (2, 1), torch.float32)
# Topologically Sorted Source Nodes: [action_scores], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_5, reinterpret_tensor(buf1, (64, 128), (128, 1), 0), reinterpret_tensor(primals_4, (128, 2), (1, 128), 0), alpha=1, beta=1, out=buf2)
del primals_5
buf3 = empty_strided_cuda((4, 4, 4, 2), (32, 8, 2, 1), torch.float32)
# Topologically Sorted Source Nodes: [softmax], Original ATen: [aten._softmax]
triton_poi_fused__softmax_1.run(buf2, buf3, 128, grid=grid(128), stream=stream0)
buf4 = reinterpret_tensor(buf2, (4, 4, 4, 2), (32, 8, 2, 1), 0); del buf2 # reuse
# Topologically Sorted Source Nodes: [softmax], Original ATen: [aten._softmax]
triton_poi_fused__softmax_2.run(buf3, buf4, 128, grid=grid(128), stream=stream0)
del buf3
return (buf4, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(buf1, (64, 128), (128, 1), 0), buf4, primals_4, buf5, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((128, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((2, 128), (128, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((2, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
from functools import *
class Policy(nn.Module):
def __init__(self):
super(Policy, self).__init__()
self.affine1 = nn.Linear(4, 128)
self.dropout = nn.Dropout(p=0.6)
self.affine2 = nn.Linear(128, 2)
self.saved_log_probs = []
self.rewards = []
def forward(self, x):
x = self.affine1(x)
x = self.dropout(x)
x = F.relu(x)
action_scores = self.affine2(x)
return F.softmax(action_scores, dim=1)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
from functools import *
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 128
tmp0 = tl.load(in_out_ptr0 + x2, None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, None)
tl.store(out_ptr0 + x2, tmp6, None)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 8
x2 = xindex // 32
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 32 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (8 + x0 + 32 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (16 + x0 + 32 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (24 + x0 + 32 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + x3, tmp9, xmask)
@triton.jit
def triton_poi_fused__softmax_2(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 8
x2 = xindex // 32
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 32 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (8 + x0 + 32 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (16 + x0 + 32 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (24 + x0 + 32 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + x3, tmp8, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (128, 4), (4, 1))
assert_size_stride(primals_2, (128,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (2, 128), (128, 1))
assert_size_stride(primals_5, (2,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 128), (128, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 128), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 128), (2048, 512, 128, 1), 0)
del buf0
buf5 = empty_strided_cuda((4, 4, 4, 128), (2048, 512, 128, 1),
torch.bool)
get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0[grid(8192)](buf1,
primals_2, buf5, 8192, XBLOCK=256, num_warps=4, num_stages=1)
del primals_2
buf2 = empty_strided_cuda((64, 2), (2, 1), torch.float32)
extern_kernels.addmm(primals_5, reinterpret_tensor(buf1, (64, 128),
(128, 1), 0), reinterpret_tensor(primals_4, (128, 2), (1, 128),
0), alpha=1, beta=1, out=buf2)
del primals_5
buf3 = empty_strided_cuda((4, 4, 4, 2), (32, 8, 2, 1), torch.float32)
triton_poi_fused__softmax_1[grid(128)](buf2, buf3, 128, XBLOCK=128,
num_warps=4, num_stages=1)
buf4 = reinterpret_tensor(buf2, (4, 4, 4, 2), (32, 8, 2, 1), 0)
del buf2
triton_poi_fused__softmax_2[grid(128)](buf3, buf4, 128, XBLOCK=128,
num_warps=4, num_stages=1)
del buf3
return buf4, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0
), reinterpret_tensor(buf1, (64, 128), (128, 1), 0
), buf4, primals_4, buf5
class PolicyNew(nn.Module):
def __init__(self):
super(PolicyNew, self).__init__()
self.affine1 = nn.Linear(4, 128)
self.dropout = nn.Dropout(p=0.6)
self.affine2 = nn.Linear(128, 2)
self.saved_log_probs = []
self.rewards = []
def forward(self, input_0):
primals_1 = self.affine1.weight
primals_2 = self.affine1.bias
primals_4 = self.affine2.weight
primals_5 = self.affine2.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
AJSVB/GPBT
|
Policy
| false | 2,082 |
[
"MIT"
] | 0 |
746c11d06ecc4c3b62fc0a3290d672d336cbb11e
|
https://github.com/AJSVB/GPBT/tree/746c11d06ecc4c3b62fc0a3290d672d336cbb11e
|
Conv2d
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/yj/cyjqxrdr34zdlpnaqepj4py4tvwh2ebdslxkfeu7skxqjn4syiak.py
# Topologically Sorted Source Nodes: [mean, mean_1], Original ATen: [aten.mean]
# Source node to ATen node mapping:
# mean => mean
# mean_1 => mean_1
# Graph fragment:
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%primals_1, [1], True), kwargs = {})
# %mean_1 : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%mean, [2], True), kwargs = {})
triton_poi_fused_mean_0 = async_compile.triton('triton_poi_fused_mean_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mean_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 16, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mean_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = (xindex // 4)
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (64*x1)), xmask)
tmp1 = tl.load(in_ptr0 + (16 + x0 + (64*x1)), xmask)
tmp3 = tl.load(in_ptr0 + (32 + x0 + (64*x1)), xmask)
tmp5 = tl.load(in_ptr0 + (48 + x0 + (64*x1)), xmask)
tmp9 = tl.load(in_ptr0 + (4 + x0 + (64*x1)), xmask)
tmp10 = tl.load(in_ptr0 + (20 + x0 + (64*x1)), xmask)
tmp12 = tl.load(in_ptr0 + (36 + x0 + (64*x1)), xmask)
tmp14 = tl.load(in_ptr0 + (52 + x0 + (64*x1)), xmask)
tmp18 = tl.load(in_ptr0 + (8 + x0 + (64*x1)), xmask)
tmp19 = tl.load(in_ptr0 + (24 + x0 + (64*x1)), xmask)
tmp21 = tl.load(in_ptr0 + (40 + x0 + (64*x1)), xmask)
tmp23 = tl.load(in_ptr0 + (56 + x0 + (64*x1)), xmask)
tmp27 = tl.load(in_ptr0 + (12 + x0 + (64*x1)), xmask)
tmp28 = tl.load(in_ptr0 + (28 + x0 + (64*x1)), xmask)
tmp30 = tl.load(in_ptr0 + (44 + x0 + (64*x1)), xmask)
tmp32 = tl.load(in_ptr0 + (60 + x0 + (64*x1)), xmask)
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 4.0
tmp8 = tmp6 / tmp7
tmp11 = tmp9 + tmp10
tmp13 = tmp11 + tmp12
tmp15 = tmp13 + tmp14
tmp16 = tmp15 / tmp7
tmp17 = tmp8 + tmp16
tmp20 = tmp18 + tmp19
tmp22 = tmp20 + tmp21
tmp24 = tmp22 + tmp23
tmp25 = tmp24 / tmp7
tmp26 = tmp17 + tmp25
tmp29 = tmp27 + tmp28
tmp31 = tmp29 + tmp30
tmp33 = tmp31 + tmp32
tmp34 = tmp33 / tmp7
tmp35 = tmp26 + tmp34
tmp36 = tmp35 / tmp7
tl.store(out_ptr0 + (x2), tmp36, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/nn/cnnlxy27st37ghyasby2wfzvdhe7fuiziq2zan6tepfxf2oe5jld.py
# Topologically Sorted Source Nodes: [weight_mean, weight, std, weight_1], Original ATen: [aten.mean, aten.sub, aten.std, aten.div]
# Source node to ATen node mapping:
# std => sqrt, var
# weight => sub
# weight_1 => div
# weight_mean => mean_2
# Graph fragment:
# %mean_2 : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%mean_1, [3], True), kwargs = {})
# %sub : [num_users=2] = call_function[target=torch.ops.aten.sub.Tensor](args = (%primals_1, %mean_2), kwargs = {})
# %var : [num_users=1] = call_function[target=torch.ops.aten.var.correction](args = (%view, [1]), kwargs = {correction: 1.0})
# %sqrt : [num_users=2] = call_function[target=torch.ops.aten.sqrt.default](args = (%var,), kwargs = {})
# %div : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%sub, %expand), kwargs = {})
triton_per_fused_div_mean_std_sub_1 = async_compile.triton('triton_per_fused_div_mean_std_sub_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[4, 64],
reduction_hint=ReductionHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32', 6: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 6), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_div_mean_std_sub_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 3, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_div_mean_std_sub_1(in_out_ptr0, in_ptr0, in_ptr1, out_ptr0, out_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 4
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + (64*x0)), xmask, other=0.0)
tmp1 = tl.load(in_ptr1 + (4*x0), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr1 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr1 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = 4.0
tmp9 = tmp7 / tmp8
tmp10 = tmp0 - tmp9
tmp11 = tl.broadcast_to(tmp10, [XBLOCK, RBLOCK])
tmp13 = tl.where(xmask, tmp11, 0)
tmp14 = tl.broadcast_to(tmp11, [XBLOCK, RBLOCK])
tmp16 = tl.where(xmask, tmp14, 0)
tmp17 = tl.sum(tmp16, 1)[:, None]
tmp18 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp19 = tmp18.to(tl.float32)
tmp20 = tmp17 / tmp19
tmp21 = tmp11 - tmp20
tmp22 = tmp21 * tmp21
tmp23 = tl.broadcast_to(tmp22, [XBLOCK, RBLOCK])
tmp25 = tl.where(xmask, tmp23, 0)
tmp26 = tl.sum(tmp25, 1)[:, None]
tmp27 = 63.0
tmp28 = tmp26 / tmp27
tmp29 = libdevice.sqrt(tmp28)
tmp30 = 1e-05
tmp31 = tmp29 + tmp30
tmp32 = tmp10 / tmp31
tl.store(out_ptr0 + (r1 + (64*x0)), tmp10, xmask)
tl.debug_barrier()
tl.store(in_out_ptr0 + (x0), tmp29, xmask)
tl.store(out_ptr1 + (r1 + (64*x0)), tmp32, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/k2/ck2mamkqpmuzem4n3p4ij6fmfpy2bcbblg6sx6wwslgqwuqq5ifh.py
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv2d => convolution
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %div, %primals_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_2 = async_compile.triton('triton_poi_fused_convolution_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_2', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_2(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x2), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 1, 1, 4), (4, 16, 16, 1), torch.float32)
# Topologically Sorted Source Nodes: [mean, mean_1], Original ATen: [aten.mean]
stream0 = get_raw_stream(0)
triton_poi_fused_mean_0.run(primals_1, buf0, 16, grid=grid(16), stream=stream0)
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf3 = empty_strided_cuda((4, ), (1, ), torch.float32)
buf5 = buf3; del buf3 # reuse
buf6 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [weight_mean, weight, std, weight_1], Original ATen: [aten.mean, aten.sub, aten.std, aten.div]
triton_per_fused_div_mean_std_sub_1.run(buf5, primals_1, buf0, buf1, buf6, 4, 64, grid=grid(4), stream=stream0)
del buf0
del buf1
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
buf7 = extern_kernels.convolution(primals_3, buf6, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf7, (4, 4, 1, 1), (4, 1, 1, 1))
buf8 = buf7; del buf7 # reuse
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
triton_poi_fused_convolution_2.run(buf8, primals_2, 16, grid=grid(16), stream=stream0)
del primals_2
return (buf8, primals_1, primals_3, buf5, buf6, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
from torch.nn import functional as F
class Conv2d(nn.Conv2d):
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
padding=0, dilation=1, groups=1, bias=True):
super(Conv2d, self).__init__(in_channels, out_channels, kernel_size,
stride, padding, dilation, groups, bias)
def forward(self, x):
weight = self.weight
weight_mean = weight.mean(dim=1, keepdim=True).mean(dim=2, keepdim=True
).mean(dim=3, keepdim=True)
weight = weight - weight_mean
std = weight.view(weight.size(0), -1).std(dim=1).view(-1, 1, 1, 1
) + 1e-05
weight = weight / std.expand_as(weight)
return F.conv2d(x, weight, self.bias, self.stride, self.padding,
self.dilation, self.groups)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'in_channels': 4, 'out_channels': 4, 'kernel_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_mean_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = xindex // 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 64 * x1), xmask)
tmp1 = tl.load(in_ptr0 + (16 + x0 + 64 * x1), xmask)
tmp3 = tl.load(in_ptr0 + (32 + x0 + 64 * x1), xmask)
tmp5 = tl.load(in_ptr0 + (48 + x0 + 64 * x1), xmask)
tmp9 = tl.load(in_ptr0 + (4 + x0 + 64 * x1), xmask)
tmp10 = tl.load(in_ptr0 + (20 + x0 + 64 * x1), xmask)
tmp12 = tl.load(in_ptr0 + (36 + x0 + 64 * x1), xmask)
tmp14 = tl.load(in_ptr0 + (52 + x0 + 64 * x1), xmask)
tmp18 = tl.load(in_ptr0 + (8 + x0 + 64 * x1), xmask)
tmp19 = tl.load(in_ptr0 + (24 + x0 + 64 * x1), xmask)
tmp21 = tl.load(in_ptr0 + (40 + x0 + 64 * x1), xmask)
tmp23 = tl.load(in_ptr0 + (56 + x0 + 64 * x1), xmask)
tmp27 = tl.load(in_ptr0 + (12 + x0 + 64 * x1), xmask)
tmp28 = tl.load(in_ptr0 + (28 + x0 + 64 * x1), xmask)
tmp30 = tl.load(in_ptr0 + (44 + x0 + 64 * x1), xmask)
tmp32 = tl.load(in_ptr0 + (60 + x0 + 64 * x1), xmask)
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 4.0
tmp8 = tmp6 / tmp7
tmp11 = tmp9 + tmp10
tmp13 = tmp11 + tmp12
tmp15 = tmp13 + tmp14
tmp16 = tmp15 / tmp7
tmp17 = tmp8 + tmp16
tmp20 = tmp18 + tmp19
tmp22 = tmp20 + tmp21
tmp24 = tmp22 + tmp23
tmp25 = tmp24 / tmp7
tmp26 = tmp17 + tmp25
tmp29 = tmp27 + tmp28
tmp31 = tmp29 + tmp30
tmp33 = tmp31 + tmp32
tmp34 = tmp33 / tmp7
tmp35 = tmp26 + tmp34
tmp36 = tmp35 / tmp7
tl.store(out_ptr0 + x2, tmp36, xmask)
@triton.jit
def triton_per_fused_div_mean_std_sub_1(in_out_ptr0, in_ptr0, in_ptr1,
out_ptr0, out_ptr1, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 4
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + 64 * x0), xmask, other=0.0)
tmp1 = tl.load(in_ptr1 + 4 * x0, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr1 + (1 + 4 * x0), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (2 + 4 * x0), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr1 + (3 + 4 * x0), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = 4.0
tmp9 = tmp7 / tmp8
tmp10 = tmp0 - tmp9
tmp11 = tl.broadcast_to(tmp10, [XBLOCK, RBLOCK])
tl.where(xmask, tmp11, 0)
tmp14 = tl.broadcast_to(tmp11, [XBLOCK, RBLOCK])
tmp16 = tl.where(xmask, tmp14, 0)
tmp17 = tl.sum(tmp16, 1)[:, None]
tmp18 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp19 = tmp18.to(tl.float32)
tmp20 = tmp17 / tmp19
tmp21 = tmp11 - tmp20
tmp22 = tmp21 * tmp21
tmp23 = tl.broadcast_to(tmp22, [XBLOCK, RBLOCK])
tmp25 = tl.where(xmask, tmp23, 0)
tmp26 = tl.sum(tmp25, 1)[:, None]
tmp27 = 63.0
tmp28 = tmp26 / tmp27
tmp29 = libdevice.sqrt(tmp28)
tmp30 = 1e-05
tmp31 = tmp29 + tmp30
tmp32 = tmp10 / tmp31
tl.store(out_ptr0 + (r1 + 64 * x0), tmp10, xmask)
tl.debug_barrier()
tl.store(in_out_ptr0 + x0, tmp29, xmask)
tl.store(out_ptr1 + (r1 + 64 * x0), tmp32, xmask)
@triton.jit
def triton_poi_fused_convolution_2(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x2, tmp2, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 1, 1, 4), (4, 16, 16, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_mean_0[grid(16)](primals_1, buf0, 16, XBLOCK=16,
num_warps=1, num_stages=1)
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf3 = empty_strided_cuda((4,), (1,), torch.float32)
buf5 = buf3
del buf3
buf6 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_per_fused_div_mean_std_sub_1[grid(4)](buf5, primals_1, buf0,
buf1, buf6, 4, 64, XBLOCK=1, num_warps=2, num_stages=1)
del buf0
del buf1
buf7 = extern_kernels.convolution(primals_3, buf6, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf7, (4, 4, 1, 1), (4, 1, 1, 1))
buf8 = buf7
del buf7
triton_poi_fused_convolution_2[grid(16)](buf8, primals_2, 16,
XBLOCK=16, num_warps=1, num_stages=1)
del primals_2
return buf8, primals_1, primals_3, buf5, buf6
class Conv2dNew(nn.Conv2d):
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
padding=0, dilation=1, groups=1, bias=True):
super(Conv2dNew, self).__init__(in_channels, out_channels,
kernel_size, stride, padding, dilation, groups, bias)
def forward(self, input_0):
primals_1 = self.weight
primals_2 = self.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
CarlosFora/DeepLabv3.pytorch
|
Conv2d
| false | 2,083 |
[
"BSD-3-Clause"
] | 0 |
f590f8f93c0c2e72b71f60c78450d92f93db2511
|
https://github.com/CarlosFora/DeepLabv3.pytorch/tree/f590f8f93c0c2e72b71f60c78450d92f93db2511
|
GlobalAvgPool2d
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/l3/cl35tzbhrd24dhunkbb6gjs54aklpyr46oikqhoylcgmkcmhujil.py
# Topologically Sorted Source Nodes: [mean], Original ATen: [aten.mean]
# Source node to ATen node mapping:
# mean => mean
# Graph fragment:
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%view, [2]), kwargs = {})
triton_per_fused_mean_0 = async_compile.triton('triton_per_fused_mean_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 16],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_mean_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_mean_0(in_out_ptr0, in_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + (16*x0)), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, 0)
tmp4 = tl.sum(tmp3, 1)[:, None]
tmp5 = 16.0
tmp6 = tmp4 / tmp5
tl.debug_barrier()
tl.store(in_out_ptr0 + (x0), tmp6, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [mean], Original ATen: [aten.mean]
stream0 = get_raw_stream(0)
triton_per_fused_mean_0.run(buf1, arg0_1, 16, 16, grid=grid(16), stream=stream0)
del arg0_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class GlobalAvgPool2d(nn.Module):
def __init__(self):
"""Global average pooling over the input's spatial dimensions"""
super(GlobalAvgPool2d, self).__init__()
def forward(self, inputs):
in_size = inputs.size()
return inputs.view((in_size[0], in_size[1], -1)).mean(dim=2)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_mean_0(in_out_ptr0, in_ptr0, xnumel, rnumel, XBLOCK:
tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + 16 * x0), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, 0)
tmp4 = tl.sum(tmp3, 1)[:, None]
tmp5 = 16.0
tmp6 = tmp4 / tmp5
tl.debug_barrier()
tl.store(in_out_ptr0 + x0, tmp6, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_mean_0[grid(16)](buf1, arg0_1, 16, 16, XBLOCK=1,
num_warps=2, num_stages=1)
del arg0_1
return buf1,
class GlobalAvgPool2dNew(nn.Module):
def __init__(self):
"""Global average pooling over the input's spatial dimensions"""
super(GlobalAvgPool2dNew, self).__init__()
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
ChenyangWang1/face_parsing
|
GlobalAvgPool2d
| false | 2,084 |
[
"MIT"
] | 0 |
506e74eb8a2094920c03f2fe0774656b1043e8a6
|
https://github.com/ChenyangWang1/face_parsing/tree/506e74eb8a2094920c03f2fe0774656b1043e8a6
|
CLOSS
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/bf/cbf42rbkejvgizdugq6ods536ffhv4uw5izmgqya34eqsheplnaz.py
# Topologically Sorted Source Nodes: [zeros_like, sigmoid, sigmoid_1, sub, basic_loss, max_1, loss], Original ATen: [aten.zeros_like, aten.sigmoid, aten.sub, aten.add, aten.maximum, aten.mean]
# Source node to ATen node mapping:
# basic_loss => add
# loss => mean
# max_1 => maximum
# sigmoid => sigmoid
# sigmoid_1 => sigmoid_1
# sub => sub
# zeros_like => full_default
# Graph fragment:
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([4, 4, 4, 4], 0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%arg0_1,), kwargs = {})
# %sigmoid_1 : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%arg1_1,), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sigmoid, %sigmoid_1), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sub, 1.0), kwargs = {})
# %maximum : [num_users=1] = call_function[target=torch.ops.aten.maximum.default](args = (%full_default, %add), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%maximum,), kwargs = {})
triton_per_fused_add_maximum_mean_sigmoid_sub_zeros_like_0 = async_compile.triton('triton_per_fused_add_maximum_mean_sigmoid_sub_zeros_like_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_maximum_mean_sigmoid_sub_zeros_like_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_maximum_mean_sigmoid_sub_zeros_like_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp2 = tl.load(in_ptr1 + (r0), None)
tmp1 = tl.sigmoid(tmp0)
tmp3 = tl.sigmoid(tmp2)
tmp4 = tmp1 - tmp3
tmp5 = 1.0
tmp6 = tmp4 + tmp5
tmp7 = 0.0
tmp8 = triton_helpers.maximum(tmp7, tmp6)
tmp9 = tl.broadcast_to(tmp8, [RBLOCK])
tmp11 = triton_helpers.promote_to_tensor(tl.sum(tmp9, 0))
tmp12 = 256.0
tmp13 = tmp11 / tmp12
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp13, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [zeros_like, sigmoid, sigmoid_1, sub, basic_loss, max_1, loss], Original ATen: [aten.zeros_like, aten.sigmoid, aten.sub, aten.add, aten.maximum, aten.mean]
stream0 = get_raw_stream(0)
triton_per_fused_add_maximum_mean_sigmoid_sub_zeros_like_0.run(buf1, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class CLOSS(nn.Module):
def __init__(self, m=1.0):
super().__init__()
self.m = m
def forward(self, pp_pair, pn_pair):
basic_loss = F.sigmoid(pp_pair) - F.sigmoid(pn_pair) + self.m
loss = torch.max(torch.zeros_like(basic_loss), basic_loss).mean()
return loss
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_maximum_mean_sigmoid_sub_zeros_like_0(in_out_ptr0,
in_ptr0, in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp2 = tl.load(in_ptr1 + r0, None)
tmp1 = tl.sigmoid(tmp0)
tmp3 = tl.sigmoid(tmp2)
tmp4 = tmp1 - tmp3
tmp5 = 1.0
tmp6 = tmp4 + tmp5
tmp7 = 0.0
tmp8 = triton_helpers.maximum(tmp7, tmp6)
tmp9 = tl.broadcast_to(tmp8, [RBLOCK])
tmp11 = triton_helpers.promote_to_tensor(tl.sum(tmp9, 0))
tmp12 = 256.0
tmp13 = tmp11 / tmp12
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp13, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_add_maximum_mean_sigmoid_sub_zeros_like_0[grid(1)](
buf1, arg0_1, arg1_1, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
class CLOSSNew(nn.Module):
def __init__(self, m=1.0):
super().__init__()
self.m = m
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
CharonWangg/Turtle_Soup_Generator
|
CLOSS
| false | 2,085 |
[
"MIT"
] | 0 |
18ab621f8a8e3998b7fcf8c8eb678af7335abf87
|
https://github.com/CharonWangg/Turtle_Soup_Generator/tree/18ab621f8a8e3998b7fcf8c8eb678af7335abf87
|
SigmoidFocalClassificationLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/im/cimhsmxnr5lb52voaq5gfprkmd2ka6dmuo2vzbpkws3s2qq6noaa.py
# Topologically Sorted Source Nodes: [mul, sub, mul_1, alpha_weight, pred_sigmoid, sub_1, mul_2, sub_2, mul_3, pt, pow_1, focal_weight, clamp, mul_5, sub_3, abs_1, neg, exp, log1p, loss, loss_1, mul_7], Original ATen: [aten.mul, aten.rsub, aten.add, aten.sigmoid, aten.pow, aten.clamp, aten.sub, aten.abs, aten.neg, aten.exp, aten.log1p]
# Source node to ATen node mapping:
# abs_1 => abs_1
# alpha_weight => add
# clamp => clamp_min
# exp => exp
# focal_weight => mul_4
# log1p => log1p
# loss => add_2
# loss_1 => mul_6
# mul => mul
# mul_1 => mul_1
# mul_2 => mul_2
# mul_3 => mul_3
# mul_5 => mul_5
# mul_7 => mul_7
# neg => neg
# pow_1 => pow_1
# pred_sigmoid => sigmoid
# pt => add_1
# sub => sub
# sub_1 => sub_1
# sub_2 => sub_2
# sub_3 => sub_3
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg1_1, 0.25), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg1_1), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, 0.75), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, %mul_1), kwargs = {})
# %sigmoid : [num_users=2] = call_function[target=torch.ops.aten.sigmoid.default](args = (%arg0_1,), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1.0, %sigmoid), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg1_1, %sub_1), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1.0, %arg1_1), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub_2, %sigmoid), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_2, %mul_3), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%add_1, 2.0), kwargs = {})
# %mul_4 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%add, %pow_1), kwargs = {})
# %clamp_min : [num_users=1] = call_function[target=torch.ops.aten.clamp_min.default](args = (%arg0_1, 0), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %sub_3 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%clamp_min, %mul_5), kwargs = {})
# %abs_1 : [num_users=1] = call_function[target=torch.ops.aten.abs.default](args = (%arg0_1,), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%abs_1,), kwargs = {})
# %exp : [num_users=1] = call_function[target=torch.ops.aten.exp.default](args = (%neg,), kwargs = {})
# %log1p : [num_users=1] = call_function[target=torch.ops.aten.log1p.default](args = (%exp,), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sub_3, %log1p), kwargs = {})
# %mul_6 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_4, %add_2), kwargs = {})
# %mul_7 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_6, %arg2_1), kwargs = {})
triton_poi_fused_abs_add_clamp_exp_log1p_mul_neg_pow_rsub_sigmoid_sub_0 = async_compile.triton('triton_poi_fused_abs_add_clamp_exp_log1p_mul_neg_pow_rsub_sigmoid_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_abs_add_clamp_exp_log1p_mul_neg_pow_rsub_sigmoid_sub_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_abs_add_clamp_exp_log1p_mul_neg_pow_rsub_sigmoid_sub_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp8 = tl.load(in_ptr1 + (x0), xmask)
tmp26 = tl.load(in_ptr2 + (x0), xmask)
tmp1 = 0.25
tmp2 = tmp0 * tmp1
tmp3 = 1.0
tmp4 = tmp3 - tmp0
tmp5 = 0.75
tmp6 = tmp4 * tmp5
tmp7 = tmp2 + tmp6
tmp9 = tl.sigmoid(tmp8)
tmp10 = tmp3 - tmp9
tmp11 = tmp0 * tmp10
tmp12 = tmp4 * tmp9
tmp13 = tmp11 + tmp12
tmp14 = tmp13 * tmp13
tmp15 = tmp7 * tmp14
tmp16 = 0.0
tmp17 = triton_helpers.maximum(tmp8, tmp16)
tmp18 = tmp8 * tmp0
tmp19 = tmp17 - tmp18
tmp20 = tl_math.abs(tmp8)
tmp21 = -tmp20
tmp22 = tl_math.exp(tmp21)
tmp23 = libdevice.log1p(tmp22)
tmp24 = tmp19 + tmp23
tmp25 = tmp15 * tmp24
tmp27 = tmp25 * tmp26
tl.store(out_ptr0 + (x0), tmp27, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [mul, sub, mul_1, alpha_weight, pred_sigmoid, sub_1, mul_2, sub_2, mul_3, pt, pow_1, focal_weight, clamp, mul_5, sub_3, abs_1, neg, exp, log1p, loss, loss_1, mul_7], Original ATen: [aten.mul, aten.rsub, aten.add, aten.sigmoid, aten.pow, aten.clamp, aten.sub, aten.abs, aten.neg, aten.exp, aten.log1p]
stream0 = get_raw_stream(0)
triton_poi_fused_abs_add_clamp_exp_log1p_mul_neg_pow_rsub_sigmoid_sub_0.run(arg1_1, arg0_1, arg2_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
del arg1_1
del arg2_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg2_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1, arg2_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class SigmoidFocalClassificationLoss(nn.Module):
"""
Sigmoid focal cross entropy loss.
"""
def __init__(self, gamma: 'float'=2.0, alpha: 'float'=0.25):
"""
Args:
gamma: Weighting parameter to balance loss for hard and easy examples.
alpha: Weighting parameter to balance loss for positive and negative examples.
"""
super(SigmoidFocalClassificationLoss, self).__init__()
self.alpha = alpha
self.gamma = gamma
@staticmethod
def sigmoid_cross_entropy_with_logits(input: 'torch.Tensor', target:
'torch.Tensor'):
""" PyTorch Implementation for tf.nn.sigmoid_cross_entropy_with_logits:
max(x, 0) - x * z + log(1 + exp(-abs(x))) in
https://www.tensorflow.org/api_docs/python/tf/nn/sigmoid_cross_entropy_with_logits
Args:
input: (B, #anchors, #classes) float tensor.
Predicted logits for each class
target: (B, #anchors, #classes) float tensor.
One-hot encoded classification targets
Returns:
loss: (B, #anchors, #classes) float tensor.
Sigmoid cross entropy loss without reduction
"""
loss = torch.clamp(input, min=0) - input * target + torch.log1p(torch
.exp(-torch.abs(input)))
return loss
def forward(self, input: 'torch.Tensor', target: 'torch.Tensor',
weights: 'torch.Tensor'):
"""
Args:
input: (B, #anchors, #classes) float tensor.
Predicted logits for each class
target: (B, #anchors, #classes) float tensor.
One-hot encoded classification targets
weights: (B, #anchors) float tensor.
Anchor-wise weights.
Returns:
weighted_loss: (B, #anchors, #classes) float tensor after weighting.
"""
pred_sigmoid = torch.sigmoid(input)
alpha_weight = target * self.alpha + (1 - target) * (1 - self.alpha)
pt = target * (1.0 - pred_sigmoid) + (1.0 - target) * pred_sigmoid
focal_weight = alpha_weight * torch.pow(pt, self.gamma)
bce_loss = self.sigmoid_cross_entropy_with_logits(input, target)
loss = focal_weight * bce_loss
if weights.shape.__len__() == 2 or weights.shape.__len__(
) == 1 and target.shape.__len__() == 2:
weights = weights.unsqueeze(-1)
assert weights.shape.__len__() == loss.shape.__len__()
return loss * weights
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4]), torch.rand(
[4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_abs_add_clamp_exp_log1p_mul_neg_pow_rsub_sigmoid_sub_0(
in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp8 = tl.load(in_ptr1 + x0, xmask)
tmp26 = tl.load(in_ptr2 + x0, xmask)
tmp1 = 0.25
tmp2 = tmp0 * tmp1
tmp3 = 1.0
tmp4 = tmp3 - tmp0
tmp5 = 0.75
tmp6 = tmp4 * tmp5
tmp7 = tmp2 + tmp6
tmp9 = tl.sigmoid(tmp8)
tmp10 = tmp3 - tmp9
tmp11 = tmp0 * tmp10
tmp12 = tmp4 * tmp9
tmp13 = tmp11 + tmp12
tmp14 = tmp13 * tmp13
tmp15 = tmp7 * tmp14
tmp16 = 0.0
tmp17 = triton_helpers.maximum(tmp8, tmp16)
tmp18 = tmp8 * tmp0
tmp19 = tmp17 - tmp18
tmp20 = tl_math.abs(tmp8)
tmp21 = -tmp20
tmp22 = tl_math.exp(tmp21)
tmp23 = libdevice.log1p(tmp22)
tmp24 = tmp19 + tmp23
tmp25 = tmp15 * tmp24
tmp27 = tmp25 * tmp26
tl.store(out_ptr0 + x0, tmp27, xmask)
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_abs_add_clamp_exp_log1p_mul_neg_pow_rsub_sigmoid_sub_0[
grid(256)](arg1_1, arg0_1, arg2_1, buf0, 256, XBLOCK=128,
num_warps=4, num_stages=1)
del arg0_1
del arg1_1
del arg2_1
return buf0,
class SigmoidFocalClassificationLossNew(nn.Module):
"""
Sigmoid focal cross entropy loss.
"""
def __init__(self, gamma: 'float'=2.0, alpha: 'float'=0.25):
"""
Args:
gamma: Weighting parameter to balance loss for hard and easy examples.
alpha: Weighting parameter to balance loss for positive and negative examples.
"""
super(SigmoidFocalClassificationLossNew, self).__init__()
self.alpha = alpha
self.gamma = gamma
@staticmethod
def sigmoid_cross_entropy_with_logits(input: 'torch.Tensor', target:
'torch.Tensor'):
""" PyTorch Implementation for tf.nn.sigmoid_cross_entropy_with_logits:
max(x, 0) - x * z + log(1 + exp(-abs(x))) in
https://www.tensorflow.org/api_docs/python/tf/nn/sigmoid_cross_entropy_with_logits
Args:
input: (B, #anchors, #classes) float tensor.
Predicted logits for each class
target: (B, #anchors, #classes) float tensor.
One-hot encoded classification targets
Returns:
loss: (B, #anchors, #classes) float tensor.
Sigmoid cross entropy loss without reduction
"""
loss = torch.clamp(input, min=0) - input * target + torch.log1p(torch
.exp(-torch.abs(input)))
return loss
def forward(self, input_0, input_1, input_2):
arg0_1 = input_0
arg1_1 = input_1
arg2_1 = input_2
output = call([arg0_1, arg1_1, arg2_1])
return output[0]
|
CSL-KU/OpenPCDet
|
SigmoidFocalClassificationLoss
| false | 2,086 |
[
"Apache-2.0"
] | 0 |
2c5fca0da1521add4b40e6cdfe75d02d4285b83f
|
https://github.com/CSL-KU/OpenPCDet/tree/2c5fca0da1521add4b40e6cdfe75d02d4285b83f
|
ExampleBackbone
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ft/cftqaeqt35oge5l3bbpv3uhleqvp2lsejqwbjdklod7sy6k66dz2.py
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv2d => convolution
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_0 = async_compile.triton('triton_poi_fused_convolution_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[65536],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 46128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 3844) % 3
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (3, 3, 3, 3), (27, 9, 3, 1))
assert_size_stride(primals_2, (3, ), (1, ))
assert_size_stride(primals_3, (4, 3, 64, 64), (12288, 4096, 64, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 3, 62, 62), (11532, 3844, 62, 1))
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_0.run(buf1, primals_2, 46128, grid=grid(46128), stream=stream0)
del primals_2
return (buf1, primals_1, primals_3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((3, 3, 3, 3), (27, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((3, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 3, 64, 64), (12288, 4096, 64, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class ExampleBackbone(nn.Module):
def __init__(self):
super(ExampleBackbone, self).__init__()
self.conv = nn.Conv2d(3, 3, 3)
def init_weights(self, pretrained=None):
pass
def forward(self, x):
return [self.conv(x)]
def get_inputs():
return [torch.rand([4, 3, 64, 64])]
def get_init_inputs():
return [[], {}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
@triton.jit
def triton_poi_fused_convolution_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 46128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 3844 % 3
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (3, 3, 3, 3), (27, 9, 3, 1))
assert_size_stride(primals_2, (3,), (1,))
assert_size_stride(primals_3, (4, 3, 64, 64), (12288, 4096, 64, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 3, 62, 62), (11532, 3844, 62, 1))
buf1 = buf0
del buf0
get_raw_stream(0)
triton_poi_fused_convolution_0[grid(46128)](buf1, primals_2, 46128,
XBLOCK=512, num_warps=4, num_stages=1)
del primals_2
return buf1, primals_1, primals_3
class ExampleBackboneNew(nn.Module):
def __init__(self):
super(ExampleBackboneNew, self).__init__()
self.conv = nn.Conv2d(3, 3, 3)
def init_weights(self, pretrained=None):
pass
def forward(self, input_0):
primals_1 = self.conv.weight
primals_2 = self.conv.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
ChenDirk/mmrazor
|
ExampleBackbone
| false | 2,087 |
[
"Apache-2.0"
] | 0 |
6f262ecd777c15efd4ee2d191cdc567071615421
|
https://github.com/ChenDirk/mmrazor/tree/6f262ecd777c15efd4ee2d191cdc567071615421
|
KLDivergence
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/l3/cl3mqwaki56dc4zcxfjjgkbopnejxzhksqm6egdinynmjrsrw2qw.py
# Topologically Sorted Source Nodes: [softmax_pred_T], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# softmax_pred_T => exp
# Graph fragment:
# %mul_tensor_1 : [num_users=2] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg0_1, 1), kwargs = {})
# %amax_default_1 : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%mul_tensor_1, [1], True), kwargs = {})
# %sub_tensor_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%mul_tensor_1, %amax_default_1), kwargs = {})
# %div_tensor_1 : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%sub_tensor_1, 1.0), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%div_tensor_1,), kwargs = {})
triton_poi_fused__softmax_0 = async_compile.triton('triton_poi_fused__softmax_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp3 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp1 = 1.0
tmp2 = tmp0 * tmp1
tmp4 = tmp3 * tmp1
tmp6 = tmp5 * tmp1
tmp7 = triton_helpers.maximum(tmp4, tmp6)
tmp9 = tmp8 * tmp1
tmp10 = triton_helpers.maximum(tmp7, tmp9)
tmp12 = tmp11 * tmp1
tmp13 = triton_helpers.maximum(tmp10, tmp12)
tmp14 = tmp2 - tmp13
tmp15 = tmp14 * tmp1
tmp16 = tl_math.exp(tmp15)
tl.store(out_ptr0 + (x3), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/pf/cpfkvifhrhobwuxls65xhwdpkryeblqmmtghouii4lp3rhe3crx4.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %mul_tensor : [num_users=2] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg1_1, 1), kwargs = {})
# %amax_default : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%mul_tensor, [1], True), kwargs = {})
# %sub_tensor : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%mul_tensor, %amax_default), kwargs = {})
# %div_tensor : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%sub_tensor, 1.0), kwargs = {})
triton_poi_fused_1 = async_compile.triton('triton_poi_fused_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp3 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp1 = 1.0
tmp2 = tmp0 * tmp1
tmp4 = tmp3 * tmp1
tmp6 = tmp5 * tmp1
tmp7 = triton_helpers.maximum(tmp4, tmp6)
tmp9 = tmp8 * tmp1
tmp10 = triton_helpers.maximum(tmp7, tmp9)
tmp12 = tmp11 * tmp1
tmp13 = triton_helpers.maximum(tmp10, tmp12)
tmp14 = tmp2 - tmp13
tmp15 = tmp14 * tmp1
tl.store(out_ptr0 + (x3), tmp15, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/ok/coksz22dwsopzs7jetcacq4yroe2grtbrqsuwv4lkfiah6q7srhn.py
# Topologically Sorted Source Nodes: [softmax_pred_T, kl_div, logsoftmax_preds_S, loss, mul_1], Original ATen: [aten._softmax, aten.xlogy, aten._log_softmax, aten.mul, aten.sub, aten.sum, aten.div]
# Source node to ATen node mapping:
# kl_div => div_3, eq, full_default, full_default_1, isnan, log_1, mul, mul_1, sub_3, sum_3, where, where_1
# logsoftmax_preds_S => exp_1, log, sub_2, sum_2
# loss => mul_2
# mul_1 => mul_3
# softmax_pred_T => div_1, sum_1
# Graph fragment:
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [1], True), kwargs = {})
# %div_1 : [num_users=5] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
# %isnan : [num_users=1] = call_function[target=torch.ops.aten.isnan.default](args = (%div_1,), kwargs = {})
# %full_default_1 : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], nan), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %eq : [num_users=1] = call_function[target=torch.ops.aten.eq.Scalar](args = (%div_1, 0), kwargs = {})
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], 0.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %log_1 : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%div_1,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%div_1, %log_1), kwargs = {})
# %where : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%eq, %full_default, %mul_1), kwargs = {})
# %where_1 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%isnan, %full_default_1, %where), kwargs = {})
# %exp_1 : [num_users=1] = call_function[target=torch.ops.aten.exp.default](args = (%div_tensor,), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp_1, [1], True), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%sum_2,), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%div_tensor, %log), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%div_1, %sub_2), kwargs = {})
# %sub_3 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_1, %mul), kwargs = {})
# %sum_3 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%sub_3,), kwargs = {})
# %div_3 : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%sum_3, 4), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%div_3, 1.0), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_2, 1.0), kwargs = {})
triton_per_fused__log_softmax__softmax_div_mul_sub_sum_xlogy_2 = async_compile.triton('triton_per_fused__log_softmax__softmax_div_mul_sub_sum_xlogy_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__log_softmax__softmax_div_mul_sub_sum_xlogy_2', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 10, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__log_softmax__softmax_div_mul_sub_sum_xlogy_2(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r3 = rindex
r0 = rindex % 16
r2 = (rindex // 64)
tmp0 = tl.load(in_ptr0 + (r3), None)
tmp1 = tl.load(in_ptr0 + (r0 + (64*r2)), None, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (16 + r0 + (64*r2)), None, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (32 + r0 + (64*r2)), None, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (48 + r0 + (64*r2)), None, eviction_policy='evict_last')
tmp17 = tl.load(in_ptr1 + (r3), None)
tmp18 = tl.load(in_ptr1 + (r0 + (64*r2)), None, eviction_policy='evict_last')
tmp20 = tl.load(in_ptr1 + (16 + r0 + (64*r2)), None, eviction_policy='evict_last')
tmp23 = tl.load(in_ptr1 + (32 + r0 + (64*r2)), None, eviction_policy='evict_last')
tmp26 = tl.load(in_ptr1 + (48 + r0 + (64*r2)), None, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tmp9 = libdevice.isnan(tmp8).to(tl.int1)
tmp10 = 0.0
tmp11 = tmp8 == tmp10
tmp12 = tl_math.log(tmp8)
tmp13 = tmp8 * tmp12
tmp14 = tl.where(tmp11, tmp10, tmp13)
tmp15 = float("nan")
tmp16 = tl.where(tmp9, tmp15, tmp14)
tmp19 = tl_math.exp(tmp18)
tmp21 = tl_math.exp(tmp20)
tmp22 = tmp19 + tmp21
tmp24 = tl_math.exp(tmp23)
tmp25 = tmp22 + tmp24
tmp27 = tl_math.exp(tmp26)
tmp28 = tmp25 + tmp27
tmp29 = tl_math.log(tmp28)
tmp30 = tmp17 - tmp29
tmp31 = tmp8 * tmp30
tmp32 = tmp16 - tmp31
tmp33 = tl.broadcast_to(tmp32, [RBLOCK])
tmp35 = triton_helpers.promote_to_tensor(tl.sum(tmp33, 0))
tmp36 = 0.25
tmp37 = tmp35 * tmp36
tmp38 = 1.0
tmp39 = tmp37 * tmp38
tmp40 = tmp39 * tmp38
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp40, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [softmax_pred_T], Original ATen: [aten._softmax]
stream0 = get_raw_stream(0)
triton_poi_fused__softmax_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_1.run(arg1_1, buf2, 256, grid=grid(256), stream=stream0)
del arg1_1
buf3 = empty_strided_cuda((), (), torch.float32)
buf4 = buf3; del buf3 # reuse
# Topologically Sorted Source Nodes: [softmax_pred_T, kl_div, logsoftmax_preds_S, loss, mul_1], Original ATen: [aten._softmax, aten.xlogy, aten._log_softmax, aten.mul, aten.sub, aten.sum, aten.div]
triton_per_fused__log_softmax__softmax_div_mul_sub_sum_xlogy_2.run(buf4, buf0, buf2, 1, 256, grid=grid(1), stream=stream0)
del buf0
del buf2
return (buf4, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class KLDivergence(nn.Module):
"""A measure of how one probability distribution Q is different from a
second, reference probability distribution P.
Args:
tau (float): Temperature coefficient. Defaults to 1.0.
reduction (str): Specifies the reduction to apply to the loss:
``'none'`` | ``'batchmean'`` | ``'sum'`` | ``'mean'``.
``'none'``: no reduction will be applied,
``'batchmean'``: the sum of the output will be divided by
the batchsize,
``'sum'``: the output will be summed,
``'mean'``: the output will be divided by the number of
elements in the output.
Default: ``'batchmean'``
loss_weight (float): Weight of loss. Defaults to 1.0.
"""
def __init__(self, tau=1.0, reduction='batchmean', loss_weight=1.0):
super(KLDivergence, self).__init__()
self.tau = tau
self.loss_weight = loss_weight
accept_reduction = {'none', 'batchmean', 'sum', 'mean'}
assert reduction in accept_reduction, f'KLDivergence supports reduction {accept_reduction}, but gets {reduction}.'
self.reduction = reduction
def forward(self, preds_S, preds_T):
"""Forward computation.
Args:
preds_S (torch.Tensor): The student model prediction with
shape (N, C, H, W) or shape (N, C).
preds_T (torch.Tensor): The teacher model prediction with
shape (N, C, H, W) or shape (N, C).
Return:
torch.Tensor: The calculated loss value.
"""
preds_T = preds_T.detach()
softmax_pred_T = F.softmax(preds_T / self.tau, dim=1)
logsoftmax_preds_S = F.log_softmax(preds_S / self.tau, dim=1)
loss = self.tau ** 2 * F.kl_div(logsoftmax_preds_S, softmax_pred_T,
reduction=self.reduction)
return self.loss_weight * loss
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused__softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp3 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp5 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp8 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp11 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp1 = 1.0
tmp2 = tmp0 * tmp1
tmp4 = tmp3 * tmp1
tmp6 = tmp5 * tmp1
tmp7 = triton_helpers.maximum(tmp4, tmp6)
tmp9 = tmp8 * tmp1
tmp10 = triton_helpers.maximum(tmp7, tmp9)
tmp12 = tmp11 * tmp1
tmp13 = triton_helpers.maximum(tmp10, tmp12)
tmp14 = tmp2 - tmp13
tmp15 = tmp14 * tmp1
tmp16 = tl_math.exp(tmp15)
tl.store(out_ptr0 + x3, tmp16, xmask)
@triton.jit
def triton_poi_fused_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp3 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp5 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp8 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp11 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp1 = 1.0
tmp2 = tmp0 * tmp1
tmp4 = tmp3 * tmp1
tmp6 = tmp5 * tmp1
tmp7 = triton_helpers.maximum(tmp4, tmp6)
tmp9 = tmp8 * tmp1
tmp10 = triton_helpers.maximum(tmp7, tmp9)
tmp12 = tmp11 * tmp1
tmp13 = triton_helpers.maximum(tmp10, tmp12)
tmp14 = tmp2 - tmp13
tmp15 = tmp14 * tmp1
tl.store(out_ptr0 + x3, tmp15, xmask)
@triton.jit
def triton_per_fused__log_softmax__softmax_div_mul_sub_sum_xlogy_2(in_out_ptr0,
in_ptr0, in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r3 = rindex
r0 = rindex % 16
r2 = rindex // 64
tmp0 = tl.load(in_ptr0 + r3, None)
tmp1 = tl.load(in_ptr0 + (r0 + 64 * r2), None, eviction_policy='evict_last'
)
tmp2 = tl.load(in_ptr0 + (16 + r0 + 64 * r2), None, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (32 + r0 + 64 * r2), None, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (48 + r0 + 64 * r2), None, eviction_policy=
'evict_last')
tmp17 = tl.load(in_ptr1 + r3, None)
tmp18 = tl.load(in_ptr1 + (r0 + 64 * r2), None, eviction_policy=
'evict_last')
tmp20 = tl.load(in_ptr1 + (16 + r0 + 64 * r2), None, eviction_policy=
'evict_last')
tmp23 = tl.load(in_ptr1 + (32 + r0 + 64 * r2), None, eviction_policy=
'evict_last')
tmp26 = tl.load(in_ptr1 + (48 + r0 + 64 * r2), None, eviction_policy=
'evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tmp9 = libdevice.isnan(tmp8).to(tl.int1)
tmp10 = 0.0
tmp11 = tmp8 == tmp10
tmp12 = tl_math.log(tmp8)
tmp13 = tmp8 * tmp12
tmp14 = tl.where(tmp11, tmp10, tmp13)
tmp15 = float('nan')
tmp16 = tl.where(tmp9, tmp15, tmp14)
tmp19 = tl_math.exp(tmp18)
tmp21 = tl_math.exp(tmp20)
tmp22 = tmp19 + tmp21
tmp24 = tl_math.exp(tmp23)
tmp25 = tmp22 + tmp24
tmp27 = tl_math.exp(tmp26)
tmp28 = tmp25 + tmp27
tmp29 = tl_math.log(tmp28)
tmp30 = tmp17 - tmp29
tmp31 = tmp8 * tmp30
tmp32 = tmp16 - tmp31
tmp33 = tl.broadcast_to(tmp32, [RBLOCK])
tmp35 = triton_helpers.promote_to_tensor(tl.sum(tmp33, 0))
tmp36 = 0.25
tmp37 = tmp35 * tmp36
tmp38 = 1.0
tmp39 = tmp37 * tmp38
tmp40 = tmp39 * tmp38
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp40, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused__softmax_0[grid(256)](arg0_1, buf0, 256, XBLOCK=
256, num_warps=4, num_stages=1)
del arg0_1
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_1[grid(256)](arg1_1, buf2, 256, XBLOCK=256,
num_warps=4, num_stages=1)
del arg1_1
buf3 = empty_strided_cuda((), (), torch.float32)
buf4 = buf3
del buf3
triton_per_fused__log_softmax__softmax_div_mul_sub_sum_xlogy_2[grid(1)
](buf4, buf0, buf2, 1, 256, num_warps=2, num_stages=1)
del buf0
del buf2
return buf4,
class KLDivergenceNew(nn.Module):
"""A measure of how one probability distribution Q is different from a
second, reference probability distribution P.
Args:
tau (float): Temperature coefficient. Defaults to 1.0.
reduction (str): Specifies the reduction to apply to the loss:
``'none'`` | ``'batchmean'`` | ``'sum'`` | ``'mean'``.
``'none'``: no reduction will be applied,
``'batchmean'``: the sum of the output will be divided by
the batchsize,
``'sum'``: the output will be summed,
``'mean'``: the output will be divided by the number of
elements in the output.
Default: ``'batchmean'``
loss_weight (float): Weight of loss. Defaults to 1.0.
"""
def __init__(self, tau=1.0, reduction='batchmean', loss_weight=1.0):
super(KLDivergenceNew, self).__init__()
self.tau = tau
self.loss_weight = loss_weight
accept_reduction = {'none', 'batchmean', 'sum', 'mean'}
assert reduction in accept_reduction, f'KLDivergence supports reduction {accept_reduction}, but gets {reduction}.'
self.reduction = reduction
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ChenDirk/mmrazor
|
KLDivergence
| false | 2,088 |
[
"Apache-2.0"
] | 0 |
6f262ecd777c15efd4ee2d191cdc567071615421
|
https://github.com/ChenDirk/mmrazor/tree/6f262ecd777c15efd4ee2d191cdc567071615421
|
PositionwiseFeedForward
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/iu/ciuxern2omgit5ovksuiwlddxkww6e3pkid4q2h3sauzn5rbd35z.py
# Topologically Sorted Source Nodes: [conv1d], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv1d => convolution
# Graph fragment:
# %convolution : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%permute, %primals_2, %primals_3, [1], [0], [1], False, [0], 1), kwargs = {})
triton_poi_fused_convolution_0 = async_compile.triton('triton_poi_fused_convolution_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 4], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = (yindex // 4)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (4*x2) + (16*y1)), xmask & ymask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + (4*y3)), tmp0, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/au/cau4pihcaptiev5y2ewn2o2nvrwhk7hogc72cofmmtbyv4rxc2oy.py
# Topologically Sorted Source Nodes: [conv1d], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv1d => convolution
# Graph fragment:
# %convolution : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%permute, %primals_2, %primals_3, [1], [0], [1], False, [0], 1), kwargs = {})
triton_poi_fused_convolution_1 = async_compile.triton('triton_poi_fused_convolution_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 4) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/4i/c4iwtbv5keih7s2oatw2f3dukhuz52ckgrbz2gykf6xkzvjwskm3.py
# Topologically Sorted Source Nodes: [layer_norm], Original ATen: [aten.native_layer_norm]
# Source node to ATen node mapping:
# layer_norm => add, clone, rsqrt, var_mean
# Graph fragment:
# %clone : [num_users=2] = call_function[target=torch.ops.aten.clone.default](args = (%permute_1,), kwargs = {memory_format: torch.contiguous_format})
# %var_mean : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%clone, [2]), kwargs = {correction: 0, keepdim: True})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem, 1e-05), kwargs = {})
# %rsqrt : [num_users=1] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add,), kwargs = {})
triton_poi_fused_native_layer_norm_2 = async_compile.triton('triton_poi_fused_native_layer_norm_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_native_layer_norm_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_native_layer_norm_2(in_ptr0, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = (xindex // 4)
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (16*x1)), xmask)
tmp1 = tl.load(in_ptr0 + (4 + x0 + (16*x1)), xmask)
tmp3 = tl.load(in_ptr0 + (8 + x0 + (16*x1)), xmask)
tmp5 = tl.load(in_ptr0 + (12 + x0 + (16*x1)), xmask)
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 4.0
tmp8 = tmp6 / tmp7
tmp9 = tmp0 - tmp8
tmp10 = tmp9 * tmp9
tmp11 = tmp1 - tmp8
tmp12 = tmp11 * tmp11
tmp13 = tmp10 + tmp12
tmp14 = tmp3 - tmp8
tmp15 = tmp14 * tmp14
tmp16 = tmp13 + tmp15
tmp17 = tmp5 - tmp8
tmp18 = tmp17 * tmp17
tmp19 = tmp16 + tmp18
tmp20 = tmp19 / tmp7
tmp21 = 1e-05
tmp22 = tmp20 + tmp21
tmp23 = libdevice.rsqrt(tmp22)
tl.store(out_ptr0 + (x2), tmp8, xmask)
tl.store(out_ptr1 + (x2), tmp23, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/cj/ccjrqflxs5ljkqp63xcu7g7u7v6qgqod4mwcgpp6fta637jlucyf.py
# Topologically Sorted Source Nodes: [layer_norm, output_1, transpose_2, conv1d_1], Original ATen: [aten.native_layer_norm, aten.relu, aten.transpose, aten.convolution]
# Source node to ATen node mapping:
# conv1d_1 => convolution_1
# layer_norm => add, add_1, clone, mul, mul_1, rsqrt, sub, var_mean
# output_1 => relu
# transpose_2 => permute_2
# Graph fragment:
# %clone : [num_users=2] = call_function[target=torch.ops.aten.clone.default](args = (%permute_1,), kwargs = {memory_format: torch.contiguous_format})
# %var_mean : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%clone, [2]), kwargs = {correction: 0, keepdim: True})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem, 1e-05), kwargs = {})
# %rsqrt : [num_users=1] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add,), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%clone, %getitem_1), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, %rsqrt), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul, %primals_4), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, %primals_5), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%add_1,), kwargs = {})
# %permute_2 : [num_users=2] = call_function[target=torch.ops.aten.permute.default](args = (%relu, [0, 2, 1]), kwargs = {})
# %convolution_1 : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%permute_2, %primals_6, %primals_7, [1], [0], [1], False, [0], 1), kwargs = {})
triton_poi_fused_convolution_native_layer_norm_relu_transpose_3 = async_compile.triton('triton_poi_fused_convolution_native_layer_norm_relu_transpose_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 4], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: 'i32', 9: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_native_layer_norm_relu_transpose_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_native_layer_norm_relu_transpose_3(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, out_ptr0, out_ptr1, out_ptr2, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y1 = (yindex // 4)
y0 = yindex % 4
tmp0 = tl.load(in_ptr0 + (x2 + (4*y3)), xmask & ymask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2 + (4*y1)), xmask & ymask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (x2 + (4*y1)), xmask & ymask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr3 + (y0), ymask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + (y0), ymask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1, 1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + (x2 + (4*y3)), tmp10, xmask & ymask)
tl.store(out_ptr1 + (y0 + (4*x2) + (16*y1)), tmp10, xmask & ymask)
tl.store(out_ptr2 + (x2 + (4*y3)), tmp10, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/on/coneam5affzlpb3r7gvvr6g32bbcqyouz2sgh36qrwrewlkqkeiz.py
# Topologically Sorted Source Nodes: [], Original ATen: [aten.threshold_backward]
# Source node to ATen node mapping:
# Graph fragment:
# %le : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_threshold_backward_4 = async_compile.triton('triton_poi_fused_threshold_backward_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 4], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*i1', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_threshold_backward_4', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_threshold_backward_4(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = (yindex // 4)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (4*x2) + (16*y1)), xmask & ymask, eviction_policy='evict_last')
tmp1 = 0.0
tmp2 = tmp0 <= tmp1
tl.store(out_ptr0 + (x2 + (4*y3)), tmp2, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4, 1), (4, 1, 1))
assert_size_stride(primals_3, (4, ), (1, ))
assert_size_stride(primals_4, (4, ), (1, ))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 4, 1), (4, 1, 1))
assert_size_stride(primals_7, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [conv1d], Original ATen: [aten.convolution]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_0.run(primals_1, buf0, 16, 4, grid=grid(16, 4), stream=stream0)
# Topologically Sorted Source Nodes: [conv1d], Original ATen: [aten.convolution]
buf1 = extern_kernels.convolution(buf0, primals_2, stride=(1,), padding=(0,), dilation=(1,), transposed=False, output_padding=(0,), groups=1, bias=None)
assert_size_stride(buf1, (4, 4, 4), (16, 4, 1))
buf2 = buf1; del buf1 # reuse
# Topologically Sorted Source Nodes: [conv1d], Original ATen: [aten.convolution]
triton_poi_fused_convolution_1.run(buf2, primals_3, 64, grid=grid(64), stream=stream0)
del primals_3
buf3 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
buf4 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
# Topologically Sorted Source Nodes: [layer_norm], Original ATen: [aten.native_layer_norm]
triton_poi_fused_native_layer_norm_2.run(buf2, buf3, buf4, 16, grid=grid(16), stream=stream0)
buf5 = reinterpret_tensor(buf0, (4, 4, 4), (16, 1, 4), 0); del buf0 # reuse
buf6 = empty_strided_cuda((4, 4, 4), (16, 1, 4), torch.float32)
buf7 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [layer_norm, output_1, transpose_2, conv1d_1], Original ATen: [aten.native_layer_norm, aten.relu, aten.transpose, aten.convolution]
triton_poi_fused_convolution_native_layer_norm_relu_transpose_3.run(buf2, buf3, buf4, primals_4, primals_5, buf5, buf6, buf7, 16, 4, grid=grid(16, 4), stream=stream0)
del buf3
del buf4
del primals_5
# Topologically Sorted Source Nodes: [conv1d_1], Original ATen: [aten.convolution]
buf8 = extern_kernels.convolution(buf7, primals_6, stride=(1,), padding=(0,), dilation=(1,), transposed=False, output_padding=(0,), groups=1, bias=None)
assert_size_stride(buf8, (4, 4, 4), (16, 4, 1))
del buf7
buf9 = buf8; del buf8 # reuse
# Topologically Sorted Source Nodes: [conv1d_1], Original ATen: [aten.convolution]
triton_poi_fused_convolution_1.run(buf9, primals_7, 64, grid=grid(64), stream=stream0)
del primals_7
buf10 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.bool)
# Topologically Sorted Source Nodes: [], Original ATen: [aten.threshold_backward]
triton_poi_fused_threshold_backward_4.run(buf5, buf10, 16, 4, grid=grid(16, 4), stream=stream0)
del buf5
return (reinterpret_tensor(buf9, (4, 4, 4), (16, 1, 4), 0), primals_2, primals_4, primals_6, reinterpret_tensor(primals_1, (4, 4, 4), (16, 1, 4), 0), buf2, buf6, buf10, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 1), (4, 1, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 4, 1), (4, 1, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
import torch.utils.data
import torch.multiprocessing
class PositionwiseFeedForward(nn.Module):
""" A two-feed-forward-layer module """
def __init__(self, d_in, d_hid, dropout=0.1):
super(PositionwiseFeedForward, self).__init__()
self.w_1 = nn.Conv1d(d_in, d_hid, 1)
self.w_2 = nn.Conv1d(d_hid, d_in, 1)
self.layer_norm = nn.LayerNorm(d_hid)
def forward(self, x):
output = self.w_1(x.transpose(1, 2)).transpose(1, 2)
output = F.relu(self.layer_norm(output))
output = self.w_2(output.transpose(1, 2)).transpose(1, 2)
return output
def get_inputs():
return [torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'d_in': 4, 'd_hid': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
import torch.utils.data
import torch.multiprocessing
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_convolution_0(in_ptr0, out_ptr0, ynumel, xnumel,
YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = yindex // 4
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 4 * x2 + 16 * y1), xmask & ymask,
eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + 4 * y3), tmp0, xmask & ymask)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 4 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, xmask)
@triton.jit
def triton_poi_fused_native_layer_norm_2(in_ptr0, out_ptr0, out_ptr1,
xnumel, XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = xindex // 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 16 * x1), xmask)
tmp1 = tl.load(in_ptr0 + (4 + x0 + 16 * x1), xmask)
tmp3 = tl.load(in_ptr0 + (8 + x0 + 16 * x1), xmask)
tmp5 = tl.load(in_ptr0 + (12 + x0 + 16 * x1), xmask)
tmp2 = tmp0 + tmp1
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp7 = 4.0
tmp8 = tmp6 / tmp7
tmp9 = tmp0 - tmp8
tmp10 = tmp9 * tmp9
tmp11 = tmp1 - tmp8
tmp12 = tmp11 * tmp11
tmp13 = tmp10 + tmp12
tmp14 = tmp3 - tmp8
tmp15 = tmp14 * tmp14
tmp16 = tmp13 + tmp15
tmp17 = tmp5 - tmp8
tmp18 = tmp17 * tmp17
tmp19 = tmp16 + tmp18
tmp20 = tmp19 / tmp7
tmp21 = 1e-05
tmp22 = tmp20 + tmp21
tmp23 = libdevice.rsqrt(tmp22)
tl.store(out_ptr0 + x2, tmp8, xmask)
tl.store(out_ptr1 + x2, tmp23, xmask)
@triton.jit
def triton_poi_fused_convolution_native_layer_norm_relu_transpose_3(in_ptr0,
in_ptr1, in_ptr2, in_ptr3, in_ptr4, out_ptr0, out_ptr1, out_ptr2,
ynumel, xnumel, YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y1 = yindex // 4
y0 = yindex % 4
tmp0 = tl.load(in_ptr0 + (x2 + 4 * y3), xmask & ymask, eviction_policy=
'evict_last')
tmp1 = tl.load(in_ptr1 + (x2 + 4 * y1), xmask & ymask, eviction_policy=
'evict_last')
tmp3 = tl.load(in_ptr2 + (x2 + 4 * y1), xmask & ymask, eviction_policy=
'evict_last')
tmp5 = tl.load(in_ptr3 + y0, ymask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + y0, ymask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp8 = tmp6 + tmp7
tmp9 = tl.full([1, 1], 0, tl.int32)
tmp10 = triton_helpers.maximum(tmp9, tmp8)
tl.store(out_ptr0 + (x2 + 4 * y3), tmp10, xmask & ymask)
tl.store(out_ptr1 + (y0 + 4 * x2 + 16 * y1), tmp10, xmask & ymask)
tl.store(out_ptr2 + (x2 + 4 * y3), tmp10, xmask & ymask)
@triton.jit
def triton_poi_fused_threshold_backward_4(in_ptr0, out_ptr0, ynumel, xnumel,
YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = yindex // 4
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 4 * x2 + 16 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp1 = 0.0
tmp2 = tmp0 <= tmp1
tl.store(out_ptr0 + (x2 + 4 * y3), tmp2, xmask & ymask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4, 1), (4, 1, 1))
assert_size_stride(primals_3, (4,), (1,))
assert_size_stride(primals_4, (4,), (1,))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 4, 1), (4, 1, 1))
assert_size_stride(primals_7, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_convolution_0[grid(16, 4)](primals_1, buf0, 16, 4,
XBLOCK=4, YBLOCK=16, num_warps=1, num_stages=1)
buf1 = extern_kernels.convolution(buf0, primals_2, stride=(1,),
padding=(0,), dilation=(1,), transposed=False, output_padding=(
0,), groups=1, bias=None)
assert_size_stride(buf1, (4, 4, 4), (16, 4, 1))
buf2 = buf1
del buf1
triton_poi_fused_convolution_1[grid(64)](buf2, primals_3, 64,
XBLOCK=64, num_warps=1, num_stages=1)
del primals_3
buf3 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
buf4 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
triton_poi_fused_native_layer_norm_2[grid(16)](buf2, buf3, buf4, 16,
XBLOCK=16, num_warps=1, num_stages=1)
buf5 = reinterpret_tensor(buf0, (4, 4, 4), (16, 1, 4), 0)
del buf0
buf6 = empty_strided_cuda((4, 4, 4), (16, 1, 4), torch.float32)
buf7 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
triton_poi_fused_convolution_native_layer_norm_relu_transpose_3[grid
(16, 4)](buf2, buf3, buf4, primals_4, primals_5, buf5, buf6,
buf7, 16, 4, XBLOCK=2, YBLOCK=16, num_warps=1, num_stages=1)
del buf3
del buf4
del primals_5
buf8 = extern_kernels.convolution(buf7, primals_6, stride=(1,),
padding=(0,), dilation=(1,), transposed=False, output_padding=(
0,), groups=1, bias=None)
assert_size_stride(buf8, (4, 4, 4), (16, 4, 1))
del buf7
buf9 = buf8
del buf8
triton_poi_fused_convolution_1[grid(64)](buf9, primals_7, 64,
XBLOCK=64, num_warps=1, num_stages=1)
del primals_7
buf10 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.bool)
triton_poi_fused_threshold_backward_4[grid(16, 4)](buf5, buf10, 16,
4, XBLOCK=4, YBLOCK=16, num_warps=1, num_stages=1)
del buf5
return reinterpret_tensor(buf9, (4, 4, 4), (16, 1, 4), 0
), primals_2, primals_4, primals_6, reinterpret_tensor(primals_1, (
4, 4, 4), (16, 1, 4), 0), buf2, buf6, buf10
class PositionwiseFeedForwardNew(nn.Module):
""" A two-feed-forward-layer module """
def __init__(self, d_in, d_hid, dropout=0.1):
super(PositionwiseFeedForwardNew, self).__init__()
self.w_1 = nn.Conv1d(d_in, d_hid, 1)
self.w_2 = nn.Conv1d(d_hid, d_in, 1)
self.layer_norm = nn.LayerNorm(d_hid)
def forward(self, input_0):
primals_2 = self.w_1.weight
primals_3 = self.w_1.bias
primals_6 = self.w_2.weight
primals_4 = self.w_2.bias
primals_5 = self.layer_norm.weight
primals_7 = self.layer_norm.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7])
return output[0]
|
Caiyuan-Zheng/Consistency_Regularization_STR
|
PositionwiseFeedForward
| false | 2,089 |
[
"MIT"
] | 0 |
7c7ce69390c429974cb2d1969b0d9d6707e6723f
|
https://github.com/Caiyuan-Zheng/Consistency_Regularization_STR/tree/7c7ce69390c429974cb2d1969b0d9d6707e6723f
|
ConvWS2d
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ww/cwww2apcubf5chosrvnjwezswzhrp5km6tznagvysldlndvyv5qa.py
# Topologically Sorted Source Nodes: [mean, std, sub, add, weight], Original ATen: [aten.mean, aten.std, aten.sub, aten.add, aten.div]
# Source node to ATen node mapping:
# add => add
# mean => mean
# std => sqrt, var
# sub => sub
# weight => div
# Graph fragment:
# %mean : [num_users=2] = call_function[target=torch.ops.aten.mean.dim](args = (%view, [1], True), kwargs = {})
# %var : [num_users=1] = call_function[target=torch.ops.aten.var.correction](args = (%view, [1]), kwargs = {correction: 1.0, keepdim: True})
# %sqrt : [num_users=2] = call_function[target=torch.ops.aten.sqrt.default](args = (%var,), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%primals_1, %view_1), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_2, 1e-05), kwargs = {})
# %div : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%sub, %add), kwargs = {})
triton_per_fused_add_div_mean_std_sub_0 = async_compile.triton('triton_per_fused_add_div_mean_std_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[4, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_div_mean_std_sub_0', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1'], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_div_mean_std_sub_0(in_out_ptr0, in_out_ptr1, in_ptr0, out_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 4
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + (64*x0)), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, 0)
tmp4 = tl.sum(tmp3, 1)[:, None]
tmp6 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp8 = tl.where(xmask, tmp6, 0)
tmp9 = tl.sum(tmp8, 1)[:, None]
tmp10 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp11 = tmp10.to(tl.float32)
tmp12 = tmp9 / tmp11
tmp13 = tmp1 - tmp12
tmp14 = tmp13 * tmp13
tmp15 = tl.broadcast_to(tmp14, [XBLOCK, RBLOCK])
tmp17 = tl.where(xmask, tmp15, 0)
tmp18 = tl.sum(tmp17, 1)[:, None]
tmp19 = 64.0
tmp20 = tmp4 / tmp19
tmp21 = 63.0
tmp22 = tmp18 / tmp21
tmp23 = libdevice.sqrt(tmp22)
tmp24 = tmp0 - tmp20
tmp25 = 1e-05
tmp26 = tmp23 + tmp25
tmp27 = tmp24 / tmp26
tl.debug_barrier()
tl.store(in_out_ptr0 + (x0), tmp20, xmask)
tl.debug_barrier()
tl.store(in_out_ptr1 + (x0), tmp23, xmask)
tl.store(out_ptr0 + (r1 + (64*x0)), tmp27, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/tc/ctcagp37ljugm52zu6ckorigrppqo67voefe2f2odg5r6hyllhyu.py
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv2d => convolution
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %div, %primals_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_1 = async_compile.triton('triton_poi_fused_convolution_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x2), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf3 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf1 = reinterpret_tensor(buf0, (4, 1), (1, 1), 0); del buf0 # reuse
buf5 = reinterpret_tensor(buf3, (4, 1), (1, 1), 0); del buf3 # reuse
buf6 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [mean, std, sub, add, weight], Original ATen: [aten.mean, aten.std, aten.sub, aten.add, aten.div]
stream0 = get_raw_stream(0)
triton_per_fused_add_div_mean_std_sub_0.run(buf1, buf5, primals_1, buf6, 4, 64, grid=grid(4), stream=stream0)
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
buf7 = extern_kernels.convolution(primals_3, buf6, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf7, (4, 4, 1, 1), (4, 1, 1, 1))
buf8 = buf7; del buf7 # reuse
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
triton_poi_fused_convolution_1.run(buf8, primals_2, 16, grid=grid(16), stream=stream0)
del primals_2
return (buf8, primals_1, primals_3, buf1, buf5, buf6, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
def conv_ws_2d(input, weight, bias=None, stride=1, padding=0, dilation=1,
groups=1, eps=1e-05):
c_in = weight.size(0)
weight_flat = weight.view(c_in, -1)
mean = weight_flat.mean(dim=1, keepdim=True).view(c_in, 1, 1, 1)
std = weight_flat.std(dim=1, keepdim=True).view(c_in, 1, 1, 1)
weight = (weight - mean) / (std + eps)
return F.conv2d(input, weight, bias, stride, padding, dilation, groups)
class ConvWS2d(nn.Conv2d):
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
padding=0, dilation=1, groups=1, bias=True, eps=1e-05):
super(ConvWS2d, self).__init__(in_channels, out_channels,
kernel_size, stride=stride, padding=padding, dilation=dilation,
groups=groups, bias=bias)
self.eps = eps
def forward(self, x):
return conv_ws_2d(x, self.weight, self.bias, self.stride, self.
padding, self.dilation, self.groups, self.eps)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'in_channels': 4, 'out_channels': 4, 'kernel_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
import torch.nn.functional as F
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_per_fused_add_div_mean_std_sub_0(in_out_ptr0, in_out_ptr1,
in_ptr0, out_ptr0, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 4
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + 64 * x0), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, 0)
tmp4 = tl.sum(tmp3, 1)[:, None]
tmp6 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp8 = tl.where(xmask, tmp6, 0)
tmp9 = tl.sum(tmp8, 1)[:, None]
tmp10 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp11 = tmp10.to(tl.float32)
tmp12 = tmp9 / tmp11
tmp13 = tmp1 - tmp12
tmp14 = tmp13 * tmp13
tmp15 = tl.broadcast_to(tmp14, [XBLOCK, RBLOCK])
tmp17 = tl.where(xmask, tmp15, 0)
tmp18 = tl.sum(tmp17, 1)[:, None]
tmp19 = 64.0
tmp20 = tmp4 / tmp19
tmp21 = 63.0
tmp22 = tmp18 / tmp21
tmp23 = libdevice.sqrt(tmp22)
tmp24 = tmp0 - tmp20
tmp25 = 1e-05
tmp26 = tmp23 + tmp25
tmp27 = tmp24 / tmp26
tl.debug_barrier()
tl.store(in_out_ptr0 + x0, tmp20, xmask)
tl.debug_barrier()
tl.store(in_out_ptr1 + x0, tmp23, xmask)
tl.store(out_ptr0 + (r1 + 64 * x0), tmp27, xmask)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x2, tmp2, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf3 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf1 = reinterpret_tensor(buf0, (4, 1), (1, 1), 0)
del buf0
buf5 = reinterpret_tensor(buf3, (4, 1), (1, 1), 0)
del buf3
buf6 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_per_fused_add_div_mean_std_sub_0[grid(4)](buf1, buf5,
primals_1, buf6, 4, 64, XBLOCK=1, num_warps=2, num_stages=1)
buf7 = extern_kernels.convolution(primals_3, buf6, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf7, (4, 4, 1, 1), (4, 1, 1, 1))
buf8 = buf7
del buf7
triton_poi_fused_convolution_1[grid(16)](buf8, primals_2, 16,
XBLOCK=16, num_warps=1, num_stages=1)
del primals_2
return buf8, primals_1, primals_3, buf1, buf5, buf6
def conv_ws_2d(input, weight, bias=None, stride=1, padding=0, dilation=1,
groups=1, eps=1e-05):
c_in = weight.size(0)
weight_flat = weight.view(c_in, -1)
mean = weight_flat.mean(dim=1, keepdim=True).view(c_in, 1, 1, 1)
std = weight_flat.std(dim=1, keepdim=True).view(c_in, 1, 1, 1)
weight = (weight - mean) / (std + eps)
return F.conv2d(input, weight, bias, stride, padding, dilation, groups)
class ConvWS2dNew(nn.Conv2d):
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
padding=0, dilation=1, groups=1, bias=True, eps=1e-05):
super(ConvWS2dNew, self).__init__(in_channels, out_channels,
kernel_size, stride=stride, padding=padding, dilation=dilation,
groups=groups, bias=bias)
self.eps = eps
def forward(self, input_0):
primals_1 = self.weight
primals_2 = self.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
BradleyBrown19/CustomObjectDetector
|
ConvWS2d
| false | 2,090 |
[
"Apache-2.0"
] | 0 |
11c14ec6127c553ac365703c768b75dde33d9a4d
|
https://github.com/BradleyBrown19/CustomObjectDetector/tree/11c14ec6127c553ac365703c768b75dde33d9a4d
|
MultiHeadAttention
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/x7/cx727joiftultx46mv2v4nj3wq4ckralwwhfk6nlqptb654rmnit.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %mul_scalar : [num_users=1] = call_function[target=torch.ops.aten.mul.Scalar](args = (%permute_default, 1.0), kwargs = {})
# %clone_default : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%expand_default,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_0 = async_compile.triton('triton_poi_fused_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 16], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_0(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = (yindex // 4)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (4*x2) + (64*y1)), xmask & ymask)
tmp1 = tl.load(in_ptr1 + (y0), ymask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = 1.0
tmp4 = tmp2 * tmp3
tl.store(out_ptr0 + (x2 + (16*y3)), tmp4, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/sj/csjx772qtehbicvkv5vtkhqu3yqj65tbhzk7oih4tz37sax3j6wq.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %amax_default : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%view_default_2, [-1], True), kwargs = {})
# %sub_tensor : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_default_2, %amax_default), kwargs = {})
# %exp_default : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_tensor,), kwargs = {})
# %sum_dim_int_list : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp_default, [-1], True), kwargs = {})
# %div_tensor : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp_default, %sum_dim_int_list), kwargs = {})
# %eq_scalar : [num_users=1] = call_function[target=torch.ops.aten.eq.Scalar](args = (%view_default_2, -inf), kwargs = {})
# %logical_not_default : [num_users=1] = call_function[target=torch.ops.aten.logical_not.default](args = (%eq_scalar,), kwargs = {})
# %any_dim : [num_users=1] = call_function[target=torch.ops.aten.any.dim](args = (%logical_not_default, -1, True), kwargs = {})
# %logical_not_default_1 : [num_users=1] = call_function[target=torch.ops.aten.logical_not.default](args = (%any_dim,), kwargs = {})
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([4, 4, 16, 16], 0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %where_self : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%logical_not_default_1, %full_default, %div_tensor), kwargs = {})
triton_per_fused_1 = async_compile.triton('triton_per_fused_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[256, 16],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 3, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_1(in_ptr0, out_ptr3, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 256
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + (16*x0)), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, float("-inf"))
tmp4 = triton_helpers.max2(tmp3, 1)[:, None]
tmp5 = tmp0 - tmp4
tmp6 = tl_math.exp(tmp5)
tmp7 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp9 = tl.where(xmask, tmp7, 0)
tmp10 = tl.sum(tmp9, 1)[:, None]
tmp11 = float("-inf")
tmp12 = tmp0 == tmp11
tmp13 = tmp12 == 0
tmp14 = tmp13.to(tl.int64)
tmp15 = (tmp14 != 0)
tmp16 = tl.broadcast_to(tmp15, [XBLOCK, RBLOCK])
tmp18 = tl.where(xmask, tmp16, 0)
tmp19 = triton_helpers.any(tmp18, 1)[:, None]
tmp20 = tmp19 == 0
tmp21 = tmp6 / tmp10
tmp22 = 0.0
tmp23 = tl.where(tmp20, tmp22, tmp21)
tl.store(out_ptr3 + (r1 + (16*x0)), tmp23, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/fs/cfsktp6ekva62tzoyn5kreys7zax64otksvrzq3eopzdnvtsux4l.py
# Topologically Sorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
# Graph fragment:
# %clone_default_2 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%expand_default_3,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_2 = async_compile.triton('triton_poi_fused_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 16], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_2(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = (yindex // 4)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (4*x2) + (64*y1)), xmask & ymask)
tmp1 = tl.load(in_ptr1 + (y0), ymask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(out_ptr0 + (x2 + (16*y3)), tmp2, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/2s/c2s3zo6qtbodb6bdwv46ozxj4nxxymp76igm7emvdafvrj3673sn.py
# Topologically Sorted Source Nodes: [contiguous], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# contiguous => clone_4
# Graph fragment:
# %clone_4 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute_7,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_3 = async_compile.triton('triton_poi_fused_clone_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64, 4], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_3(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 64
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 16
y1 = (yindex // 16)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (16*x2) + (64*y1)), xmask & ymask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + (4*y3)), tmp0, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4, ), (1, ))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_5, (4, 4), (4, 1))
assert_size_stride(primals_6, (4, ), (1, ))
assert_size_stride(primals_7, (4, 4), (4, 1))
assert_size_stride(primals_8, (4, ), (1, ))
assert_size_stride(primals_9, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_10, (4, 4), (4, 1))
assert_size_stride(primals_11, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_4, (64, 4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), out=buf0)
del primals_2
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_1, (64, 4), (4, 1), 0), reinterpret_tensor(primals_5, (4, 4), (1, 4), 0), out=buf1)
del primals_5
buf2 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_9, (64, 4), (4, 1), 0), reinterpret_tensor(primals_7, (4, 4), (1, 4), 0), out=buf2)
del primals_7
buf3 = empty_strided_cuda((4, 4, 16, 1), (64, 16, 1, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
stream0 = get_raw_stream(0)
triton_poi_fused_0.run(buf1, primals_6, buf3, 16, 16, grid=grid(16, 16), stream=stream0)
del primals_6
buf4 = reinterpret_tensor(buf1, (4, 4, 1, 16), (64, 16, 16, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_0.run(buf0, primals_3, buf4, 16, 16, grid=grid(16, 16), stream=stream0)
del primals_3
buf5 = empty_strided_cuda((16, 16, 16), (256, 16, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.bmm(reinterpret_tensor(buf3, (16, 16, 1), (16, 1, 0), 0), reinterpret_tensor(buf4, (16, 1, 16), (16, 0, 1), 0), out=buf5)
buf9 = empty_strided_cuda((4, 4, 16, 16), (1024, 256, 16, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_per_fused_1.run(buf5, buf9, 256, 16, grid=grid(256), stream=stream0)
del buf5
buf10 = reinterpret_tensor(buf0, (4, 4, 16, 1), (64, 16, 1, 1), 0); del buf0 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
triton_poi_fused_2.run(buf2, primals_8, buf10, 16, 16, grid=grid(16, 16), stream=stream0)
del primals_8
buf11 = reinterpret_tensor(buf2, (16, 16, 1), (16, 1, 1), 0); del buf2 # reuse
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.bmm(reinterpret_tensor(buf9, (16, 16, 16), (256, 16, 1), 0), reinterpret_tensor(buf10, (16, 16, 1), (16, 1, 0), 0), out=buf11)
buf12 = empty_strided_cuda((4, 16, 4, 1), (64, 4, 1, 1), torch.float32)
# Topologically Sorted Source Nodes: [contiguous], Original ATen: [aten.clone]
triton_poi_fused_clone_3.run(buf11, buf12, 64, 4, grid=grid(64, 4), stream=stream0)
buf13 = reinterpret_tensor(buf11, (64, 4), (4, 1), 0); del buf11 # reuse
# Topologically Sorted Source Nodes: [output_1], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_11, reinterpret_tensor(buf12, (64, 4), (4, 1), 0), reinterpret_tensor(primals_10, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf13)
del primals_11
return (reinterpret_tensor(buf13, (4, 16, 4), (64, 4, 1), 0), reinterpret_tensor(primals_4, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (64, 4), (4, 1), 0), reinterpret_tensor(primals_9, (64, 4), (4, 1), 0), buf9, reinterpret_tensor(buf10, (16, 1, 16), (16, 1, 1), 0), reinterpret_tensor(buf3, (16, 1, 16), (16, 1, 1), 0), reinterpret_tensor(buf4, (16, 16, 1), (16, 1, 16), 0), reinterpret_tensor(buf12, (64, 4), (4, 1), 0), primals_10, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import math
import torch
import torch.nn as nn
import torch.nn.functional as F
class MultiHeadAttention(nn.Module):
def __init__(self, heads, d_model, dropout=0.1):
super().__init__()
self.d_model = d_model
self.d_k = d_model // heads
self.h = heads
self.q_linear = nn.Linear(d_model, d_model)
self.v_linear = nn.Linear(d_model, d_model)
self.k_linear = nn.Linear(d_model, d_model)
self.dropout = nn.Dropout(dropout)
self.out = nn.Linear(d_model, d_model)
def _attention(self, q, k, v, d_k, mask=None, dropout=None):
scores = torch.matmul(q, k.transpose(-2, -1)) / math.sqrt(d_k)
if mask is not None:
mask = mask.unsqueeze(1)
scores = scores.masked_fill(mask == 0, -1000000000.0)
scores = F.softmax(scores, dim=-1)
if dropout is not None:
scores = dropout(scores)
output = torch.matmul(scores, v)
return output
def forward(self, q, k, v, mask=None):
bs = q.size(0)
k = self.k_linear(k).view(bs, -1, self.h, self.d_k)
q = self.q_linear(q).view(bs, -1, self.h, self.d_k)
v = self.v_linear(v).view(bs, -1, self.h, self.d_k)
k = k.transpose(1, 2)
q = q.transpose(1, 2)
v = v.transpose(1, 2)
scores = self._attention(q, k, v, self.d_k, mask, self.dropout)
concat = scores.transpose(1, 2).contiguous().view(bs, -1, self.d_model)
output = self.out(concat)
return output
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4]), torch.rand(
[4, 4, 4, 4])]
def get_init_inputs():
return [[], {'heads': 4, 'd_model': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import math
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_0(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel, YBLOCK:
tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = yindex // 4
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 4 * x2 + 64 * y1), xmask & ymask)
tmp1 = tl.load(in_ptr1 + y0, ymask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = 1.0
tmp4 = tmp2 * tmp3
tl.store(out_ptr0 + (x2 + 16 * y3), tmp4, xmask & ymask)
@triton.jit
def triton_per_fused_1(in_ptr0, out_ptr3, xnumel, rnumel, XBLOCK: tl.constexpr
):
xnumel = 256
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + 16 * x0), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, float('-inf'))
tmp4 = triton_helpers.max2(tmp3, 1)[:, None]
tmp5 = tmp0 - tmp4
tmp6 = tl_math.exp(tmp5)
tmp7 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp9 = tl.where(xmask, tmp7, 0)
tmp10 = tl.sum(tmp9, 1)[:, None]
tmp11 = float('-inf')
tmp12 = tmp0 == tmp11
tmp13 = tmp12 == 0
tmp14 = tmp13.to(tl.int64)
tmp15 = tmp14 != 0
tmp16 = tl.broadcast_to(tmp15, [XBLOCK, RBLOCK])
tmp18 = tl.where(xmask, tmp16, 0)
tmp19 = triton_helpers.any(tmp18, 1)[:, None]
tmp20 = tmp19 == 0
tmp21 = tmp6 / tmp10
tmp22 = 0.0
tmp23 = tl.where(tmp20, tmp22, tmp21)
tl.store(out_ptr3 + (r1 + 16 * x0), tmp23, xmask)
@triton.jit
def triton_poi_fused_2(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel, YBLOCK:
tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = yindex // 4
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 4 * x2 + 64 * y1), xmask & ymask)
tmp1 = tl.load(in_ptr1 + y0, ymask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(out_ptr0 + (x2 + 16 * y3), tmp2, xmask & ymask)
@triton.jit
def triton_poi_fused_clone_3(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
ynumel = 64
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 16
y1 = yindex // 16
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 16 * x2 + 64 * y1), xmask & ymask,
eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + 4 * y3), tmp0, xmask & ymask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4,), (1,))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_5, (4, 4), (4, 1))
assert_size_stride(primals_6, (4,), (1,))
assert_size_stride(primals_7, (4, 4), (4, 1))
assert_size_stride(primals_8, (4,), (1,))
assert_size_stride(primals_9, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_10, (4, 4), (4, 1))
assert_size_stride(primals_11, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_4, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), out=buf0)
del primals_2
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_1, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_5, (4, 4), (1, 4), 0), out=buf1)
del primals_5
buf2 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_9, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_7, (4, 4), (1, 4), 0), out=buf2)
del primals_7
buf3 = empty_strided_cuda((4, 4, 16, 1), (64, 16, 1, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_0[grid(16, 16)](buf1, primals_6, buf3, 16, 16,
XBLOCK=16, YBLOCK=16, num_warps=4, num_stages=1)
del primals_6
buf4 = reinterpret_tensor(buf1, (4, 4, 1, 16), (64, 16, 16, 1), 0)
del buf1
triton_poi_fused_0[grid(16, 16)](buf0, primals_3, buf4, 16, 16,
XBLOCK=16, YBLOCK=16, num_warps=4, num_stages=1)
del primals_3
buf5 = empty_strided_cuda((16, 16, 16), (256, 16, 1), torch.float32)
extern_kernels.bmm(reinterpret_tensor(buf3, (16, 16, 1), (16, 1, 0),
0), reinterpret_tensor(buf4, (16, 1, 16), (16, 0, 1), 0), out=buf5)
buf9 = empty_strided_cuda((4, 4, 16, 16), (1024, 256, 16, 1), torch
.float32)
triton_per_fused_1[grid(256)](buf5, buf9, 256, 16, XBLOCK=8,
num_warps=2, num_stages=1)
del buf5
buf10 = reinterpret_tensor(buf0, (4, 4, 16, 1), (64, 16, 1, 1), 0)
del buf0
triton_poi_fused_2[grid(16, 16)](buf2, primals_8, buf10, 16, 16,
XBLOCK=16, YBLOCK=16, num_warps=4, num_stages=1)
del primals_8
buf11 = reinterpret_tensor(buf2, (16, 16, 1), (16, 1, 1), 0)
del buf2
extern_kernels.bmm(reinterpret_tensor(buf9, (16, 16, 16), (256, 16,
1), 0), reinterpret_tensor(buf10, (16, 16, 1), (16, 1, 0), 0),
out=buf11)
buf12 = empty_strided_cuda((4, 16, 4, 1), (64, 4, 1, 1), torch.float32)
triton_poi_fused_clone_3[grid(64, 4)](buf11, buf12, 64, 4, XBLOCK=4,
YBLOCK=32, num_warps=4, num_stages=1)
buf13 = reinterpret_tensor(buf11, (64, 4), (4, 1), 0)
del buf11
extern_kernels.addmm(primals_11, reinterpret_tensor(buf12, (64, 4),
(4, 1), 0), reinterpret_tensor(primals_10, (4, 4), (1, 4), 0),
alpha=1, beta=1, out=buf13)
del primals_11
return reinterpret_tensor(buf13, (4, 16, 4), (64, 4, 1), 0
), reinterpret_tensor(primals_4, (64, 4), (4, 1), 0
), reinterpret_tensor(primals_1, (64, 4), (4, 1), 0
), reinterpret_tensor(primals_9, (64, 4), (4, 1), 0
), buf9, reinterpret_tensor(buf10, (16, 1, 16), (16, 1, 1), 0
), reinterpret_tensor(buf3, (16, 1, 16), (16, 1, 1), 0
), reinterpret_tensor(buf4, (16, 16, 1), (16, 1, 16), 0
), reinterpret_tensor(buf12, (64, 4), (4, 1), 0), primals_10
class MultiHeadAttentionNew(nn.Module):
def __init__(self, heads, d_model, dropout=0.1):
super().__init__()
self.d_model = d_model
self.d_k = d_model // heads
self.h = heads
self.q_linear = nn.Linear(d_model, d_model)
self.v_linear = nn.Linear(d_model, d_model)
self.k_linear = nn.Linear(d_model, d_model)
self.dropout = nn.Dropout(dropout)
self.out = nn.Linear(d_model, d_model)
def _attention(self, q, k, v, d_k, mask=None, dropout=None):
scores = torch.matmul(q, k.transpose(-2, -1)) / math.sqrt(d_k)
if mask is not None:
mask = mask.unsqueeze(1)
scores = scores.masked_fill(mask == 0, -1000000000.0)
scores = F.softmax(scores, dim=-1)
if dropout is not None:
scores = dropout(scores)
output = torch.matmul(scores, v)
return output
def forward(self, input_0, input_1, input_2):
primals_2 = self.q_linear.weight
primals_3 = self.q_linear.bias
primals_5 = self.v_linear.weight
primals_6 = self.v_linear.bias
primals_7 = self.k_linear.weight
primals_8 = self.k_linear.bias
primals_10 = self.out.weight
primals_11 = self.out.bias
primals_1 = input_0
primals_4 = input_1
primals_9 = input_2
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11])
return output[0]
|
CS-savvy/Transformer-for-Parkinsons-disease
|
MultiHeadAttention
| false | 2,091 |
[
"MIT"
] | 0 |
42ef54071092f4aab74c8b9ec82c52e944806a5b
|
https://github.com/CS-savvy/Transformer-for-Parkinsons-disease/tree/42ef54071092f4aab74c8b9ec82c52e944806a5b
|
Conv2dDynamicSamePadding
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/xs/cxs2a7zwcw5yxvn445xldhvii7772mtsthpxnfawxoahvyf3vtaj.py
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.constant_pad_nd]
# Source node to ATen node mapping:
# x => constant_pad_nd
# Graph fragment:
# %constant_pad_nd : [num_users=2] = call_function[target=torch.ops.aten.constant_pad_nd.default](args = (%primals_1, [1, 2, 1, 2], 0.0), kwargs = {})
triton_poi_fused_constant_pad_nd_0 = async_compile.triton('triton_poi_fused_constant_pad_nd_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_constant_pad_nd_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_constant_pad_nd_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 784
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 7) % 7
x0 = xindex % 7
x2 = (xindex // 49)
x4 = xindex
tmp0 = (-1) + x1
tmp1 = tl.full([1], 0, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = (-1) + x0
tmp6 = tmp5 >= tmp1
tmp7 = tmp5 < tmp3
tmp8 = tmp2 & tmp4
tmp9 = tmp8 & tmp6
tmp10 = tmp9 & tmp7
tmp11 = tl.load(in_ptr0 + ((-5) + x0 + (4*x1) + (16*x2)), tmp10 & xmask, other=0.0)
tl.store(out_ptr0 + (x4), tmp11, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/32/c32v7egt4mupqssam3gmac2qgv3ujprjybthsgweflmot256qqw7.py
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv2d => convolution
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%constant_pad_nd, %primals_2, %primals_3, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_1 = async_compile.triton('triton_poi_fused_convolution_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_3, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 7, 7), (196, 49, 7, 1), torch.float32)
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.constant_pad_nd]
stream0 = get_raw_stream(0)
triton_poi_fused_constant_pad_nd_0.run(primals_1, buf0, 784, grid=grid(784), stream=stream0)
del primals_1
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
buf1 = extern_kernels.convolution(buf0, primals_2, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf1, (4, 4, 4, 4), (64, 16, 4, 1))
buf2 = buf1; del buf1 # reuse
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
triton_poi_fused_convolution_1.run(buf2, primals_3, 256, grid=grid(256), stream=stream0)
del primals_3
return (buf2, primals_2, buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import math
import torch
import torch.nn as nn
import torch.nn.functional as F
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class Conv2dDynamicSamePadding(nn.Conv2d):
""" 2D Convolutions like TensorFlow, for a dynamic image size """
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
dilation=1, groups=1, bias=True):
super().__init__(in_channels, out_channels, kernel_size, stride, 0,
dilation, groups, bias)
self.stride = self.stride if len(self.stride) == 2 else [self.stride[0]
] * 2
def forward(self, x):
ih, iw = x.size()[-2:]
kh, kw = self.weight.size()[-2:]
sh, sw = self.stride
oh, ow = math.ceil(ih / sh), math.ceil(iw / sw)
pad_h = max((oh - 1) * self.stride[0] + (kh - 1) * self.dilation[0] +
1 - ih, 0)
pad_w = max((ow - 1) * self.stride[1] + (kw - 1) * self.dilation[1] +
1 - iw, 0)
if pad_h > 0 or pad_w > 0:
x = F.pad(x, [pad_w // 2, pad_w - pad_w // 2, pad_h // 2, pad_h -
pad_h // 2])
return F.conv2d(x, self.weight, self.bias, self.stride, self.
padding, self.dilation, self.groups)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'in_channels': 4, 'out_channels': 4, 'kernel_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_constant_pad_nd_0(in_ptr0, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 784
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 7 % 7
x0 = xindex % 7
x2 = xindex // 49
x4 = xindex
tmp0 = -1 + x1
tmp1 = tl.full([1], 0, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = -1 + x0
tmp6 = tmp5 >= tmp1
tmp7 = tmp5 < tmp3
tmp8 = tmp2 & tmp4
tmp9 = tmp8 & tmp6
tmp10 = tmp9 & tmp7
tmp11 = tl.load(in_ptr0 + (-5 + x0 + 4 * x1 + 16 * x2), tmp10 & xmask,
other=0.0)
tl.store(out_ptr0 + x4, tmp11, xmask)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 16 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_3, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 7, 7), (196, 49, 7, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_constant_pad_nd_0[grid(784)](primals_1, buf0, 784,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_1
buf1 = extern_kernels.convolution(buf0, primals_2, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf1, (4, 4, 4, 4), (64, 16, 4, 1))
buf2 = buf1
del buf1
triton_poi_fused_convolution_1[grid(256)](buf2, primals_3, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_3
return buf2, primals_2, buf0
class Conv2dDynamicSamePaddingNew(nn.Conv2d):
""" 2D Convolutions like TensorFlow, for a dynamic image size """
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
dilation=1, groups=1, bias=True):
super().__init__(in_channels, out_channels, kernel_size, stride, 0,
dilation, groups, bias)
self.stride = self.stride if len(self.stride) == 2 else [self.stride[0]
] * 2
def forward(self, input_0):
primals_1 = self.weight
primals_3 = self.bias
primals_2 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
BradleyBrown19/CustomObjectDetector
|
Conv2dDynamicSamePadding
| false | 2,092 |
[
"Apache-2.0"
] | 0 |
11c14ec6127c553ac365703c768b75dde33d9a4d
|
https://github.com/BradleyBrown19/CustomObjectDetector/tree/11c14ec6127c553ac365703c768b75dde33d9a4d
|
WeightedCrossEntropyLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/65/c65frvogjvzvcjnoj7n72ziopkhhgusygsvovz7h4ukukiilkzeo.py
# Topologically Sorted Source Nodes: [cross_entropy], Original ATen: [aten._log_softmax]
# Source node to ATen node mapping:
# cross_entropy => amax, clone, sub
# Graph fragment:
# %clone : [num_users=2] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%clone, [1], True), kwargs = {})
# %sub : [num_users=2] = call_function[target=torch.ops.aten.sub.Tensor](args = (%clone, %amax), kwargs = {})
triton_poi_fused__log_softmax_0 = async_compile.triton('triton_poi_fused__log_softmax_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__log_softmax_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__log_softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tl.store(out_ptr0 + (x2), tmp8, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/l2/cl24dwpctzxyshc65i5qx5duwxgffhtumdb5hgvztlemyrmqb7ae.py
# Topologically Sorted Source Nodes: [target, cross_entropy], Original ATen: [aten.argmax, aten.nll_loss2d_forward]
# Source node to ATen node mapping:
# cross_entropy => full_default_1, ne_1, neg, where_1
# target => argmax
# Graph fragment:
# %argmax : [num_users=1] = call_function[target=torch.ops.aten.argmax.default](args = (%arg1_1, -1), kwargs = {})
# %ne_1 : [num_users=1] = call_function[target=torch.ops.aten.ne.Scalar](args = (%view_1, -100), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%squeeze,), kwargs = {})
# %full_default_1 : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], 0.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %where_1 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%ne_1, %neg, %full_default_1), kwargs = {})
triton_poi_fused_argmax_nll_loss2d_forward_1 = async_compile.triton('triton_poi_fused_argmax_nll_loss2d_forward_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_argmax_nll_loss2d_forward_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_argmax_nll_loss2d_forward_1(in_ptr0, in_ptr1, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (4*x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp17 = tl.load(in_ptr0 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp32 = tl.load(in_ptr0 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp56 = tl.load(in_ptr1 + (4*x0), xmask, eviction_policy='evict_last')
tmp58 = tl.load(in_ptr1 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp61 = tl.load(in_ptr1 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp64 = tl.load(in_ptr1 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp2 = tmp0 > tmp1
tmp3 = tmp0 == tmp1
tmp4 = tmp0 != tmp0
tmp5 = tmp1 != tmp1
tmp6 = tmp4 > tmp5
tmp7 = tmp2 | tmp6
tmp8 = tmp4 & tmp5
tmp9 = tmp3 | tmp8
tmp10 = tl.full([1], 0, tl.int64)
tmp11 = tl.full([1], 1, tl.int64)
tmp12 = tmp10 < tmp11
tmp13 = tmp9 & tmp12
tmp14 = tmp7 | tmp13
tmp15 = tl.where(tmp14, tmp0, tmp1)
tmp16 = tl.where(tmp14, tmp10, tmp11)
tmp18 = tmp15 > tmp17
tmp19 = tmp15 == tmp17
tmp20 = tmp15 != tmp15
tmp21 = tmp17 != tmp17
tmp22 = tmp20 > tmp21
tmp23 = tmp18 | tmp22
tmp24 = tmp20 & tmp21
tmp25 = tmp19 | tmp24
tmp26 = tl.full([1], 2, tl.int64)
tmp27 = tmp16 < tmp26
tmp28 = tmp25 & tmp27
tmp29 = tmp23 | tmp28
tmp30 = tl.where(tmp29, tmp15, tmp17)
tmp31 = tl.where(tmp29, tmp16, tmp26)
tmp33 = tmp30 > tmp32
tmp34 = tmp30 == tmp32
tmp35 = tmp30 != tmp30
tmp36 = tmp32 != tmp32
tmp37 = tmp35 > tmp36
tmp38 = tmp33 | tmp37
tmp39 = tmp35 & tmp36
tmp40 = tmp34 | tmp39
tmp41 = tl.full([1], 3, tl.int64)
tmp42 = tmp31 < tmp41
tmp43 = tmp40 & tmp42
tmp44 = tmp38 | tmp43
tmp45 = tl.where(tmp44, tmp30, tmp32)
tmp46 = tl.where(tmp44, tmp31, tmp41)
tmp47 = tl.full([1], -100, tl.int64)
tmp48 = tmp46 != tmp47
tmp49 = tl.where(tmp48, tmp46, tmp10)
tmp50 = tl.full([XBLOCK], 4, tl.int32)
tmp51 = tmp49 + tmp50
tmp52 = tmp49 < 0
tmp53 = tl.where(tmp52, tmp51, tmp49)
tl.device_assert(((0 <= tmp53) & (tmp53 < 4)) | ~(xmask), "index out of bounds: 0 <= tmp53 < 4")
tmp55 = tl.load(in_ptr1 + (tmp53 + (4*x0)), xmask, eviction_policy='evict_last')
tmp57 = tl_math.exp(tmp56)
tmp59 = tl_math.exp(tmp58)
tmp60 = tmp57 + tmp59
tmp62 = tl_math.exp(tmp61)
tmp63 = tmp60 + tmp62
tmp65 = tl_math.exp(tmp64)
tmp66 = tmp63 + tmp65
tmp67 = tl_math.log(tmp66)
tmp68 = tmp55 - tmp67
tmp69 = -tmp68
tmp70 = 0.0
tmp71 = tl.where(tmp48, tmp69, tmp70)
tl.store(out_ptr1 + (x0), tmp71, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/52/c52q66vnsccjyukv3szniebgvzu6ojke7mshatei6zil5yksivzo.py
# Topologically Sorted Source Nodes: [loss], Original ATen: [aten.mul]
# Source node to ATen node mapping:
# loss => mul
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_2, %arg2_1), kwargs = {})
triton_poi_fused_mul_2 = async_compile.triton('triton_poi_fused_mul_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mul_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mul_2(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 16
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask)
tmp2 = tmp0 * tmp1
tl.store(out_ptr0 + (x2), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4), (16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((4, 4, 4), (16, 1, 4), torch.float32)
# Topologically Sorted Source Nodes: [cross_entropy], Original ATen: [aten._log_softmax]
stream0 = get_raw_stream(0)
triton_poi_fused__log_softmax_0.run(arg0_1, buf1, 64, grid=grid(64), stream=stream0)
del arg0_1
buf2 = empty_strided_cuda((4, 1, 4), (4, 16, 1), torch.float32)
# Topologically Sorted Source Nodes: [target, cross_entropy], Original ATen: [aten.argmax, aten.nll_loss2d_forward]
triton_poi_fused_argmax_nll_loss2d_forward_1.run(arg1_1, buf1, buf2, 16, grid=grid(16), stream=stream0)
del arg1_1
buf3 = reinterpret_tensor(buf1, (4, 4, 4), (16, 4, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [loss], Original ATen: [aten.mul]
triton_poi_fused_mul_2.run(buf2, arg2_1, buf3, 64, grid=grid(64), stream=stream0)
del arg2_1
del buf2
return (buf3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
arg2_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1, arg2_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class WeightedCrossEntropyLoss(nn.Module):
"""
Transform input to fit the fomation of PyTorch offical cross entropy loss
with anchor-wise weighting.
"""
def __init__(self):
super(WeightedCrossEntropyLoss, self).__init__()
def forward(self, input: 'torch.Tensor', target: 'torch.Tensor',
weights: 'torch.Tensor'):
"""
Args:
input: (B, #anchors, #classes) float tensor.
Predited logits for each class.
target: (B, #anchors, #classes) float tensor.
One-hot classification targets.
weights: (B, #anchors) float tensor.
Anchor-wise weights.
Returns:
loss: (B, #anchors) float tensor.
Weighted cross entropy loss without reduction
"""
input = input.permute(0, 2, 1)
target = target.argmax(dim=-1)
loss = F.cross_entropy(input, target, reduction='none') * weights
return loss
def get_inputs():
return [torch.rand([4, 4, 4]), torch.rand([4, 4, 4]), torch.rand([4, 4, 4])
]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused__log_softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tl.store(out_ptr0 + x2, tmp8, xmask)
@triton.jit
def triton_poi_fused_argmax_nll_loss2d_forward_1(in_ptr0, in_ptr1, out_ptr1,
xnumel, XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + 4 * x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + 4 * x0), xmask, eviction_policy='evict_last')
tmp17 = tl.load(in_ptr0 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp32 = tl.load(in_ptr0 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp56 = tl.load(in_ptr1 + 4 * x0, xmask, eviction_policy='evict_last')
tmp58 = tl.load(in_ptr1 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp61 = tl.load(in_ptr1 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp64 = tl.load(in_ptr1 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp2 = tmp0 > tmp1
tmp3 = tmp0 == tmp1
tmp4 = tmp0 != tmp0
tmp5 = tmp1 != tmp1
tmp6 = tmp4 > tmp5
tmp7 = tmp2 | tmp6
tmp8 = tmp4 & tmp5
tmp9 = tmp3 | tmp8
tmp10 = tl.full([1], 0, tl.int64)
tmp11 = tl.full([1], 1, tl.int64)
tmp12 = tmp10 < tmp11
tmp13 = tmp9 & tmp12
tmp14 = tmp7 | tmp13
tmp15 = tl.where(tmp14, tmp0, tmp1)
tmp16 = tl.where(tmp14, tmp10, tmp11)
tmp18 = tmp15 > tmp17
tmp19 = tmp15 == tmp17
tmp20 = tmp15 != tmp15
tmp21 = tmp17 != tmp17
tmp22 = tmp20 > tmp21
tmp23 = tmp18 | tmp22
tmp24 = tmp20 & tmp21
tmp25 = tmp19 | tmp24
tmp26 = tl.full([1], 2, tl.int64)
tmp27 = tmp16 < tmp26
tmp28 = tmp25 & tmp27
tmp29 = tmp23 | tmp28
tmp30 = tl.where(tmp29, tmp15, tmp17)
tmp31 = tl.where(tmp29, tmp16, tmp26)
tmp33 = tmp30 > tmp32
tmp34 = tmp30 == tmp32
tmp35 = tmp30 != tmp30
tmp36 = tmp32 != tmp32
tmp37 = tmp35 > tmp36
tmp38 = tmp33 | tmp37
tmp39 = tmp35 & tmp36
tmp40 = tmp34 | tmp39
tmp41 = tl.full([1], 3, tl.int64)
tmp42 = tmp31 < tmp41
tmp43 = tmp40 & tmp42
tmp44 = tmp38 | tmp43
tl.where(tmp44, tmp30, tmp32)
tmp46 = tl.where(tmp44, tmp31, tmp41)
tmp47 = tl.full([1], -100, tl.int64)
tmp48 = tmp46 != tmp47
tmp49 = tl.where(tmp48, tmp46, tmp10)
tmp50 = tl.full([XBLOCK], 4, tl.int32)
tmp51 = tmp49 + tmp50
tmp52 = tmp49 < 0
tmp53 = tl.where(tmp52, tmp51, tmp49)
tl.device_assert((0 <= tmp53) & (tmp53 < 4) | ~xmask,
'index out of bounds: 0 <= tmp53 < 4')
tmp55 = tl.load(in_ptr1 + (tmp53 + 4 * x0), xmask, eviction_policy=
'evict_last')
tmp57 = tl_math.exp(tmp56)
tmp59 = tl_math.exp(tmp58)
tmp60 = tmp57 + tmp59
tmp62 = tl_math.exp(tmp61)
tmp63 = tmp60 + tmp62
tmp65 = tl_math.exp(tmp64)
tmp66 = tmp63 + tmp65
tmp67 = tl_math.log(tmp66)
tmp68 = tmp55 - tmp67
tmp69 = -tmp68
tmp70 = 0.0
tmp71 = tl.where(tmp48, tmp69, tmp70)
tl.store(out_ptr1 + x0, tmp71, xmask)
@triton.jit
def triton_poi_fused_mul_2(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 16
x2 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask)
tmp2 = tmp0 * tmp1
tl.store(out_ptr0 + x2, tmp2, xmask)
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4), (16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((4, 4, 4), (16, 1, 4), torch.float32)
get_raw_stream(0)
triton_poi_fused__log_softmax_0[grid(64)](arg0_1, buf1, 64, XBLOCK=
64, num_warps=1, num_stages=1)
del arg0_1
buf2 = empty_strided_cuda((4, 1, 4), (4, 16, 1), torch.float32)
triton_poi_fused_argmax_nll_loss2d_forward_1[grid(16)](arg1_1, buf1,
buf2, 16, XBLOCK=16, num_warps=1, num_stages=1)
del arg1_1
buf3 = reinterpret_tensor(buf1, (4, 4, 4), (16, 4, 1), 0)
del buf1
triton_poi_fused_mul_2[grid(64)](buf2, arg2_1, buf3, 64, XBLOCK=64,
num_warps=1, num_stages=1)
del arg2_1
del buf2
return buf3,
class WeightedCrossEntropyLossNew(nn.Module):
"""
Transform input to fit the fomation of PyTorch offical cross entropy loss
with anchor-wise weighting.
"""
def __init__(self):
super(WeightedCrossEntropyLossNew, self).__init__()
def forward(self, input_0, input_1, input_2):
arg0_1 = input_0
arg1_1 = input_1
arg2_1 = input_2
output = call([arg0_1, arg1_1, arg2_1])
return output[0]
|
CSL-KU/OpenPCDet
|
WeightedCrossEntropyLoss
| false | 2,093 |
[
"Apache-2.0"
] | 0 |
2c5fca0da1521add4b40e6cdfe75d02d4285b83f
|
https://github.com/CSL-KU/OpenPCDet/tree/2c5fca0da1521add4b40e6cdfe75d02d4285b83f
|
GHMR
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/oz/cozsertrqgjrqyur62xx2dwoox3tbac6et7fykm33ltnl7jxfmfm.py
# Topologically Sorted Source Nodes: [sum_1, valid], Original ATen: [aten.sum, aten.gt]
# Source node to ATen node mapping:
# sum_1 => sum_1
# valid => gt
# Graph fragment:
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%arg2_1,), kwargs = {})
# %gt : [num_users=1] = call_function[target=torch.ops.aten.gt.Scalar](args = (%arg2_1, 0), kwargs = {})
triton_per_fused_gt_sum_0 = async_compile.triton('triton_per_fused_gt_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_gt_sum_0', 'mutated_arg_names': [], 'no_x_dim': True, 'num_load': 1, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_gt_sum_0(in_ptr0, out_ptr0, out_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.broadcast_to(tmp0, [RBLOCK])
tmp3 = triton_helpers.promote_to_tensor(tl.sum(tmp1, 0))
tmp4 = 0.0
tmp5 = tmp0 > tmp4
tl.store(out_ptr1 + (tl.broadcast_to(r0, [RBLOCK])), tmp5, None)
tl.store(out_ptr0 + (tl.full([1], 0, tl.int32)), tmp3, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/2a/c2ayatl72atxz7llof44xg6xfcod4w34uyxjsxirgoqzc6bhc5er.py
# Topologically Sorted Source Nodes: [diff, mul, add, sqrt, loss, mul_1, add_1, sqrt_1, truediv, abs_1], Original ATen: [aten.sub, aten.mul, aten.add, aten.sqrt, aten.div, aten.abs]
# Source node to ATen node mapping:
# abs_1 => abs_1
# add => add
# add_1 => add_1
# diff => sub
# loss => sub_1
# mul => mul
# mul_1 => mul_1
# sqrt => sqrt
# sqrt_1 => sqrt_1
# truediv => div
# Graph fragment:
# %sub : [num_users=3] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, %sub), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, 0.0004), kwargs = {})
# %sqrt : [num_users=1] = call_function[target=torch.ops.aten.sqrt.default](args = (%add,), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sqrt, 0.02), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, %sub), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, 0.0004), kwargs = {})
# %sqrt_1 : [num_users=1] = call_function[target=torch.ops.aten.sqrt.default](args = (%add_1,), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%sub, %sqrt_1), kwargs = {})
# %abs_1 : [num_users=1] = call_function[target=torch.ops.aten.abs.default](args = (%div,), kwargs = {})
triton_poi_fused_abs_add_div_mul_sqrt_sub_1 = async_compile.triton('triton_poi_fused_abs_add_div_mul_sqrt_sub_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_abs_add_div_mul_sqrt_sub_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_abs_add_div_mul_sqrt_sub_1(in_ptr0, in_ptr1, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = tl.load(in_ptr1 + (x0), xmask)
tmp2 = tmp0 - tmp1
tmp3 = tmp2 * tmp2
tmp4 = 0.0004
tmp5 = tmp3 + tmp4
tmp6 = libdevice.sqrt(tmp5)
tmp7 = 0.02
tmp8 = tmp6 - tmp7
tmp9 = tmp2 / tmp6
tmp10 = tl_math.abs(tmp9)
tl.store(out_ptr0 + (x0), tmp8, xmask)
tl.store(out_ptr1 + (x0), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/zd/czdhovzy3i75dbb4lrrvs36jdqekoz77qi3q3aloxdafcrzuwdjh.py
# Topologically Sorted Source Nodes: [weights], Original ATen: [aten.zeros_like]
# Source node to ATen node mapping:
# weights => full_default
# Graph fragment:
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([4, 4, 4, 4], 0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
triton_poi_fused_zeros_like_2 = async_compile.triton('triton_poi_fused_zeros_like_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_zeros_like_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 0, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_zeros_like_2(out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = 0.0
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf4 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
# Topologically Sorted Source Nodes: [sum_1, valid], Original ATen: [aten.sum, aten.gt]
stream0 = get_raw_stream(0)
triton_per_fused_gt_sum_0.run(arg2_1, buf0, buf4, 1, 256, grid=grid(1), stream=stream0)
del arg2_1
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [diff, mul, add, sqrt, loss, mul_1, add_1, sqrt_1, truediv, abs_1], Original ATen: [aten.sub, aten.mul, aten.add, aten.sqrt, aten.div, aten.abs]
triton_poi_fused_abs_add_div_mul_sqrt_sub_1.run(arg0_1, arg1_1, buf1, buf2, 256, grid=grid(256), stream=stream0)
del arg0_1
del arg1_1
buf3 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [weights], Original ATen: [aten.zeros_like]
triton_poi_fused_zeros_like_2.run(buf3, 256, grid=grid(256), stream=stream0)
return (buf0, buf1, buf2, buf3, buf4, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg2_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1, arg2_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class GHMR(nn.Module):
"""GHM Regression Loss.
Details of the theorem can be viewed in the paper
"Gradient Harmonized Single-stage Detector"
https://arxiv.org/abs/1811.05181
Args:
mu (float): The parameter for the Authentic Smooth L1 loss.
bins (int): Number of the unit regions for distribution calculation.
momentum (float): The parameter for moving average.
loss_weight (float): The weight of the total GHM-R loss.
"""
def __init__(self, mu=0.02, bins=10, momentum=0, loss_weight=1.0):
super(GHMR, self).__init__()
self.mu = mu
self.bins = bins
edges = torch.arange(bins + 1).float() / bins
self.register_buffer('edges', edges)
self.edges[-1] = 1000.0
self.momentum = momentum
if momentum > 0:
acc_sum = torch.zeros(bins)
self.register_buffer('acc_sum', acc_sum)
self.loss_weight = loss_weight
def forward(self, pred, target, label_weight, avg_factor=None):
"""Calculate the GHM-R loss.
Args:
pred (float tensor of size [batch_num, 4 (* class_num)]):
The prediction of box regression layer. Channel number can be 4
or 4 * class_num depending on whether it is class-agnostic.
target (float tensor of size [batch_num, 4 (* class_num)]):
The target regression values with the same size of pred.
label_weight (float tensor of size [batch_num, 4 (* class_num)]):
The weight of each sample, 0 if ignored.
Returns:
The gradient harmonized loss.
"""
mu = self.mu
edges = self.edges
mmt = self.momentum
diff = pred - target
loss = torch.sqrt(diff * diff + mu * mu) - mu
g = torch.abs(diff / torch.sqrt(mu * mu + diff * diff)).detach()
weights = torch.zeros_like(g)
valid = label_weight > 0
tot = max(label_weight.float().sum().item(), 1.0)
n = 0
for i in range(self.bins):
inds = (g >= edges[i]) & (g < edges[i + 1]) & valid
num_in_bin = inds.sum().item()
if num_in_bin > 0:
n += 1
if mmt > 0:
self.acc_sum[i] = mmt * self.acc_sum[i] + (1 - mmt
) * num_in_bin
weights[inds] = tot / self.acc_sum[i]
else:
weights[inds] = tot / num_in_bin
if n > 0:
weights /= n
loss = loss * weights
loss = loss.sum() / tot
return loss * self.loss_weight
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4]), torch.rand(
[4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_gt_sum_0(in_ptr0, out_ptr0, out_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.broadcast_to(tmp0, [RBLOCK])
tmp3 = triton_helpers.promote_to_tensor(tl.sum(tmp1, 0))
tmp4 = 0.0
tmp5 = tmp0 > tmp4
tl.store(out_ptr1 + tl.broadcast_to(r0, [RBLOCK]), tmp5, None)
tl.store(out_ptr0 + tl.full([1], 0, tl.int32), tmp3, None)
@triton.jit
def triton_poi_fused_abs_add_div_mul_sqrt_sub_1(in_ptr0, in_ptr1, out_ptr0,
out_ptr1, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = tl.load(in_ptr1 + x0, xmask)
tmp2 = tmp0 - tmp1
tmp3 = tmp2 * tmp2
tmp4 = 0.0004
tmp5 = tmp3 + tmp4
tmp6 = libdevice.sqrt(tmp5)
tmp7 = 0.02
tmp8 = tmp6 - tmp7
tmp9 = tmp2 / tmp6
tmp10 = tl_math.abs(tmp9)
tl.store(out_ptr0 + x0, tmp8, xmask)
tl.store(out_ptr1 + x0, tmp10, xmask)
@triton.jit
def triton_poi_fused_zeros_like_2(out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = 0.0
tl.store(out_ptr0 + x0, tmp0, xmask)
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf4 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
get_raw_stream(0)
triton_per_fused_gt_sum_0[grid(1)](arg2_1, buf0, buf4, 1, 256,
num_warps=2, num_stages=1)
del arg2_1
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_abs_add_div_mul_sqrt_sub_1[grid(256)](arg0_1,
arg1_1, buf1, buf2, 256, XBLOCK=256, num_warps=4, num_stages=1)
del arg0_1
del arg1_1
buf3 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_zeros_like_2[grid(256)](buf3, 256, XBLOCK=256,
num_warps=4, num_stages=1)
return buf0, buf1, buf2, buf3, buf4
class GHMRNew(nn.Module):
"""GHM Regression Loss.
Details of the theorem can be viewed in the paper
"Gradient Harmonized Single-stage Detector"
https://arxiv.org/abs/1811.05181
Args:
mu (float): The parameter for the Authentic Smooth L1 loss.
bins (int): Number of the unit regions for distribution calculation.
momentum (float): The parameter for moving average.
loss_weight (float): The weight of the total GHM-R loss.
"""
def __init__(self, mu=0.02, bins=10, momentum=0, loss_weight=1.0):
super(GHMRNew, self).__init__()
self.mu = mu
self.bins = bins
edges = torch.arange(bins + 1).float() / bins
self.register_buffer('edges', edges)
self.edges[-1] = 1000.0
self.momentum = momentum
if momentum > 0:
acc_sum = torch.zeros(bins)
self.register_buffer('acc_sum', acc_sum)
self.loss_weight = loss_weight
def forward(self, input_0, input_1, input_2):
arg0_1 = input_0
arg1_1 = input_1
arg2_1 = input_2
output = call([arg0_1, arg1_1, arg2_1])
return output[0]
|
CK-er/mmdet
|
GHMR
| false | 2,094 |
[
"Apache-2.0"
] | 0 |
9bea4068efbcf7bf739dbe41917a68d525c29868
|
https://github.com/CK-er/mmdet/tree/9bea4068efbcf7bf739dbe41917a68d525c29868
|
Scale
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/s3/cs3xfcsbv3q363t3gue76e5b2o6wfhbslxcdj5vsrheb24anhw4c.py
# Topologically Sorted Source Nodes: [mul], Original ATen: [aten.mul]
# Source node to ATen node mapping:
# mul => mul
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_2, %primals_1), kwargs = {})
triton_poi_fused_mul_0 = async_compile.triton('triton_poi_fused_mul_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mul_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mul_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = tl.load(in_ptr1 + (0))
tmp2 = tl.broadcast_to(tmp1, [XBLOCK])
tmp3 = tmp0 * tmp2
tl.store(out_ptr0 + (x0), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2 = args
args.clear()
assert_size_stride(primals_1, (), ())
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [mul], Original ATen: [aten.mul]
stream0 = get_raw_stream(0)
triton_poi_fused_mul_0.run(primals_2, primals_1, buf0, 256, grid=grid(256), stream=stream0)
del primals_1
return (buf0, primals_2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((), (), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class Scale(nn.Module):
def __init__(self, scale=1.0):
super(Scale, self).__init__()
self.scale = nn.Parameter(torch.tensor(scale, dtype=torch.float))
def forward(self, x):
return x * self.scale
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_mul_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = tl.load(in_ptr1 + 0)
tmp2 = tl.broadcast_to(tmp1, [XBLOCK])
tmp3 = tmp0 * tmp2
tl.store(out_ptr0 + x0, tmp3, xmask)
def call(args):
primals_1, primals_2 = args
args.clear()
assert_size_stride(primals_1, (), ())
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_mul_0[grid(256)](primals_2, primals_1, buf0, 256,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_1
return buf0, primals_2
class ScaleNew(nn.Module):
def __init__(self, scale=1.0):
super(ScaleNew, self).__init__()
self.scale = nn.Parameter(torch.tensor(scale, dtype=torch.float))
def forward(self, input_0):
primals_1 = self.scale
primals_2 = input_0
output = call([primals_1, primals_2])
return output[0]
|
ChuchuHan/DMRNet
|
Scale
| false | 2,095 |
[
"MIT"
] | 0 |
b933f364c56af148593d7a3b9967479c03aec398
|
https://github.com/ChuchuHan/DMRNet/tree/b933f364c56af148593d7a3b9967479c03aec398
|
PSN
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/vb/cvbbp37vzhsx7p7ngv5abef2cwj3juupjflkile3hciuzmikjvcl.py
# Topologically Sorted Source Nodes: [x_1, x_2], Original ATen: [aten.prod, aten.sigmoid]
# Source node to ATen node mapping:
# x_1 => prod
# x_2 => sigmoid
# Graph fragment:
# %prod : [num_users=1] = call_function[target=torch.ops.aten.prod.dim_int](args = (%view_1, 1), kwargs = {})
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%prod,), kwargs = {})
triton_poi_fused_prod_sigmoid_0 = async_compile.triton('triton_poi_fused_prod_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_prod_sigmoid_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_prod_sigmoid_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 16
x1 = (xindex // 16)
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (64*x1)), xmask)
tmp1 = tl.load(in_ptr0 + (16 + x0 + (64*x1)), xmask)
tmp3 = tl.load(in_ptr0 + (32 + x0 + (64*x1)), xmask)
tmp5 = tl.load(in_ptr0 + (48 + x0 + (64*x1)), xmask)
tmp2 = tmp0 * tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp7 = tl.sigmoid(tmp6)
tl.store(out_ptr0 + (x2), tmp7, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_2, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x_1, x_2], Original ATen: [aten.prod, aten.sigmoid]
stream0 = get_raw_stream(0)
triton_poi_fused_prod_sigmoid_0.run(buf0, buf1, 64, grid=grid(64), stream=stream0)
return (buf1, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0), buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
class PSN(torch.nn.Module):
def __init__(self, input_size, hidden_size, output_size):
super(PSN, self).__init__()
self.input_size = input_size
self.hidden_size = hidden_size
self.output_size = output_size
self.fc = torch.nn.Linear(self.input_size, self.hidden_size)
def forward(self, x):
x = self.fc(x)
x = torch.prod(x, 1)
x = torch.sigmoid(x)
return x
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'input_size': 4, 'hidden_size': 4, 'output_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_prod_sigmoid_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 16
x1 = xindex // 16
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 64 * x1), xmask)
tmp1 = tl.load(in_ptr0 + (16 + x0 + 64 * x1), xmask)
tmp3 = tl.load(in_ptr0 + (32 + x0 + 64 * x1), xmask)
tmp5 = tl.load(in_ptr0 + (48 + x0 + 64 * x1), xmask)
tmp2 = tmp0 * tmp1
tmp4 = tmp2 * tmp3
tmp6 = tmp4 * tmp5
tmp7 = tl.sigmoid(tmp6)
tl.store(out_ptr0 + x2, tmp7, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_2, reinterpret_tensor(primals_3, (64,
4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_prod_sigmoid_0[grid(64)](buf0, buf1, 64, XBLOCK=64,
num_warps=1, num_stages=1)
return buf1, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0
), reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0), buf1
class PSNNew(torch.nn.Module):
def __init__(self, input_size, hidden_size, output_size):
super(PSNNew, self).__init__()
self.input_size = input_size
self.hidden_size = hidden_size
self.output_size = output_size
self.fc = torch.nn.Linear(self.input_size, self.hidden_size)
def forward(self, input_0):
primals_1 = self.fc.weight
primals_2 = self.fc.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
Chay16/PortfolioOptimization
|
PSN
| false | 2,096 |
[
"Apache-2.0"
] | 0 |
d8a6e7215d64038766beaf1c9325abc46ef05ffc
|
https://github.com/Chay16/PortfolioOptimization/tree/d8a6e7215d64038766beaf1c9325abc46ef05ffc
|
FlowHead
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/3p/c3pccxgnuu4ndvejdrgnnzzkvckhydfsbcaf7lwd5g3lofpww4cc.py
# Topologically Sorted Source Nodes: [conv2d, relu], Original ATen: [aten.convolution, aten.relu]
# Source node to ATen node mapping:
# conv2d => convolution
# relu => relu
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [1, 1], [1, 1], False, [0, 0], 1), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%convolution,), kwargs = {})
triton_poi_fused_convolution_relu_0 = async_compile.triton('triton_poi_fused_convolution_relu_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4194304],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_relu_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_relu_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 4194304
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x3 = xindex
x1 = (xindex // 4096) % 256
tmp0 = tl.load(in_out_ptr0 + (x3), None)
tmp1 = tl.load(in_ptr0 + (x1), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + (x3), tmp4, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/sc/cscsiwn4jzs35kmdkiqiai55z42bpakheiazewur3x5beq7teiv3.py
# Topologically Sorted Source Nodes: [conv2d_1], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv2d_1 => convolution_1
# Graph fragment:
# %convolution_1 : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%relu, %primals_4, %primals_5, [1, 1], [1, 1], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_1 = async_compile.triton('triton_poi_fused_convolution_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[32768],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 32768
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x3 = xindex
x1 = (xindex // 4096) % 2
tmp0 = tl.load(in_out_ptr0 + (x3), None)
tmp1 = tl.load(in_ptr0 + (x1), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (256, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_2, (256, ), (1, ))
assert_size_stride(primals_3, (4, 128, 64, 64), (524288, 4096, 64, 1))
assert_size_stride(primals_4, (2, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_5, (2, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 256, 64, 64), (1048576, 4096, 64, 1))
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [conv2d, relu], Original ATen: [aten.convolution, aten.relu]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_relu_0.run(buf1, primals_2, 4194304, grid=grid(4194304), stream=stream0)
del primals_2
# Topologically Sorted Source Nodes: [conv2d_1], Original ATen: [aten.convolution]
buf2 = extern_kernels.convolution(buf1, primals_4, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 2, 64, 64), (8192, 4096, 64, 1))
buf3 = buf2; del buf2 # reuse
# Topologically Sorted Source Nodes: [conv2d_1], Original ATen: [aten.convolution]
triton_poi_fused_convolution_1.run(buf3, primals_5, 32768, grid=grid(32768), stream=stream0)
del primals_5
return (buf3, primals_1, primals_3, primals_4, buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((256, 128, 3, 3), (1152, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 128, 64, 64), (524288, 4096, 64, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((2, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((2, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class FlowHead(nn.Module):
def __init__(self, input_dim=128, hidden_dim=256, output_dim=2):
super(FlowHead, self).__init__()
self.conv1 = nn.Conv2d(input_dim, hidden_dim, 3, padding=1)
self.conv2 = nn.Conv2d(hidden_dim, output_dim, 3, padding=1)
self.relu = nn.ReLU(inplace=True)
def forward(self, x):
return self.conv2(self.relu(self.conv1(x)))
def get_inputs():
return [torch.rand([4, 128, 64, 64])]
def get_init_inputs():
return [[], {}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
@triton.jit
def triton_poi_fused_convolution_relu_0(in_out_ptr0, in_ptr0, xnumel,
XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x3 = xindex
x1 = xindex // 4096 % 256
tmp0 = tl.load(in_out_ptr0 + x3, None)
tmp1 = tl.load(in_ptr0 + x1, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + x3, tmp4, None)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x3 = xindex
x1 = xindex // 4096 % 2
tmp0 = tl.load(in_out_ptr0 + x3, None)
tmp1 = tl.load(in_ptr0 + x1, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, None)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (256, 128, 3, 3), (1152, 9, 3, 1))
assert_size_stride(primals_2, (256,), (1,))
assert_size_stride(primals_3, (4, 128, 64, 64), (524288, 4096, 64, 1))
assert_size_stride(primals_4, (2, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_5, (2,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 256, 64, 64), (1048576, 4096, 64, 1))
buf1 = buf0
del buf0
get_raw_stream(0)
triton_poi_fused_convolution_relu_0[grid(4194304)](buf1, primals_2,
4194304, XBLOCK=1024, num_warps=4, num_stages=1)
del primals_2
buf2 = extern_kernels.convolution(buf1, primals_4, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 2, 64, 64), (8192, 4096, 64, 1))
buf3 = buf2
del buf2
triton_poi_fused_convolution_1[grid(32768)](buf3, primals_5, 32768,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_5
return buf3, primals_1, primals_3, primals_4, buf1
class FlowHeadNew(nn.Module):
def __init__(self, input_dim=128, hidden_dim=256, output_dim=2):
super(FlowHeadNew, self).__init__()
self.conv1 = nn.Conv2d(input_dim, hidden_dim, 3, padding=1)
self.conv2 = nn.Conv2d(hidden_dim, output_dim, 3, padding=1)
self.relu = nn.ReLU(inplace=True)
def forward(self, input_0):
primals_1 = self.conv1.weight
primals_2 = self.conv1.bias
primals_4 = self.conv2.weight
primals_5 = self.conv2.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
BrianPugh/RAFT-Stereo
|
FlowHead
| false | 2,097 |
[
"MIT"
] | 0 |
494dd79545411eee56e32540bfd6f45a16c74a19
|
https://github.com/BrianPugh/RAFT-Stereo/tree/494dd79545411eee56e32540bfd6f45a16c74a19
|
GramMatrix
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/r5/cr52v5yotzudnablrrwmfpcsyvq37jz2x7fx3mcszdca66xahvgc.py
# Topologically Sorted Source Nodes: [G_1], Original ATen: [aten.div]
# Source node to ATen node mapping:
# G_1 => div
# Graph fragment:
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%bmm, 16), kwargs = {})
triton_poi_fused_div_0 = async_compile.triton('triton_poi_fused_div_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_div_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_div_0(in_out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + (x0), xmask)
tmp1 = 0.0625
tmp2 = tmp0 * tmp1
tl.store(in_out_ptr0 + (x0), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [G], Original ATen: [aten.bmm]
extern_kernels.bmm(reinterpret_tensor(arg0_1, (4, 4, 16), (64, 16, 1), 0), reinterpret_tensor(arg0_1, (4, 16, 4), (64, 1, 16), 0), out=buf0)
del arg0_1
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [G_1], Original ATen: [aten.div]
stream0 = get_raw_stream(0)
triton_poi_fused_div_0.run(buf1, 64, grid=grid(64), stream=stream0)
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class GramMatrix(nn.Module):
"""
Base Gram Matrix calculation as per Gatys et al. 2015
"""
def forward(self, input):
b, c, h, w = input.size()
F = input.view(b, c, h * w)
G = torch.bmm(F, F.transpose(1, 2))
G = G.div_(h * w)
return G
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_div_0(in_out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + x0, xmask)
tmp1 = 0.0625
tmp2 = tmp0 * tmp1
tl.store(in_out_ptr0 + x0, tmp2, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
extern_kernels.bmm(reinterpret_tensor(arg0_1, (4, 4, 16), (64, 16,
1), 0), reinterpret_tensor(arg0_1, (4, 16, 4), (64, 1, 16), 0),
out=buf0)
del arg0_1
buf1 = buf0
del buf0
get_raw_stream(0)
triton_poi_fused_div_0[grid(64)](buf1, 64, XBLOCK=64, num_warps=1,
num_stages=1)
return buf1,
class GramMatrixNew(nn.Module):
"""
Base Gram Matrix calculation as per Gatys et al. 2015
"""
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
ChuckHend/nst-zoo
|
GramMatrix
| false | 2,098 |
[
"MIT"
] | 0 |
130e485289c5a9417c3dc36980b87373f12f3697
|
https://github.com/ChuckHend/nst-zoo/tree/130e485289c5a9417c3dc36980b87373f12f3697
|
NormalSampler
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/gi/cgif32a2wfs45bh7axmyrqfirotrk647j5jhcoati6xtmmnm2id6.py
# Topologically Sorted Source Nodes: [mul, std, z], Original ATen: [aten.mul, aten.exp, aten.addcmul]
# Source node to ATen node mapping:
# mul => mul
# std => exp
# z => add, mul_1, mul_2
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg1_1, 0.5), kwargs = {})
# %exp : [num_users=1] = call_function[target=torch.ops.aten.exp.default](args = (%mul,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%exp, 1), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_1, %randn), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%arg0_1, %mul_2), kwargs = {})
triton_poi_fused_addcmul_exp_mul_0 = async_compile.triton('triton_poi_fused_addcmul_exp_mul_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_addcmul_exp_mul_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_addcmul_exp_mul_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = tl.load(in_ptr1 + (x0), xmask)
tmp7 = tl.load(in_out_ptr0 + (x0), xmask)
tmp2 = 0.5
tmp3 = tmp1 * tmp2
tmp4 = tl_math.exp(tmp3)
tmp5 = 1.0
tmp6 = tmp4 * tmp5
tmp8 = tmp6 * tmp7
tmp9 = tmp0 + tmp8
tl.store(in_out_ptr0 + (x0), tmp9, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [epsilon], Original ATen: [aten.randn]
buf0 = torch.ops.aten.randn.default([4, 4, 4, 4], device=device(type='cuda', index=0), pin_memory=False)
buf1 = buf0
del buf0
buf2 = buf1; del buf1 # reuse
# Topologically Sorted Source Nodes: [mul, std, z], Original ATen: [aten.mul, aten.exp, aten.addcmul]
stream0 = get_raw_stream(0)
triton_poi_fused_addcmul_exp_mul_0.run(buf2, arg0_1, arg1_1, 256, grid=grid(256), stream=stream0)
del arg0_1
del arg1_1
return (buf2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
class NormalSampler(nn.Module):
"""p(z)"""
def __init__(self):
super(NormalSampler, self).__init__()
self.register_buffer('eps', torch.tensor(1e-10))
def forward(self, mean, log_var):
epsilon = torch.randn(mean.size(), requires_grad=False, device=mean
.device)
std = log_var.mul(0.5).exp_()
z = mean.addcmul(std, epsilon)
return z
def kl_divergence(self, mean, log_var, z):
"""
L elbo(x) = Eq(z|x)[log p(x|z)] - KL(q(z|x)||p(z))
D_{KL}(q(z|x)||p(z))
"""
return -0.5 * torch.sum(1 + log_var - mean.pow(2) - log_var.exp(),
dim=1)
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
from torch import device
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import math as tl_math
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
@triton.jit
def triton_poi_fused_addcmul_exp_mul_0(in_out_ptr0, in_ptr0, in_ptr1,
xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = tl.load(in_ptr1 + x0, xmask)
tmp7 = tl.load(in_out_ptr0 + x0, xmask)
tmp2 = 0.5
tmp3 = tmp1 * tmp2
tmp4 = tl_math.exp(tmp3)
tmp5 = 1.0
tmp6 = tmp4 * tmp5
tmp8 = tmp6 * tmp7
tmp9 = tmp0 + tmp8
tl.store(in_out_ptr0 + x0, tmp9, xmask)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = torch.ops.aten.randn.default([4, 4, 4, 4], device=device(
type='cuda', index=0), pin_memory=False)
buf1 = buf0
del buf0
buf2 = buf1
del buf1
get_raw_stream(0)
triton_poi_fused_addcmul_exp_mul_0[grid(256)](buf2, arg0_1, arg1_1,
256, XBLOCK=128, num_warps=4, num_stages=1)
del arg0_1
del arg1_1
return buf2,
class NormalSamplerNew(nn.Module):
"""p(z)"""
def __init__(self):
super(NormalSamplerNew, self).__init__()
self.register_buffer('eps', torch.tensor(1e-10))
def kl_divergence(self, mean, log_var, z):
"""
L elbo(x) = Eq(z|x)[log p(x|z)] - KL(q(z|x)||p(z))
D_{KL}(q(z|x)||p(z))
"""
return -0.5 * torch.sum(1 + log_var - mean.pow(2) - log_var.exp(),
dim=1)
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ChengF-Lab/scGGN
|
NormalSampler
| false | 2,099 |
[
"MIT"
] | 0 |
eab585219e6d3eb06c94057f0e3b276d1846e8b6
|
https://github.com/ChengF-Lab/scGGN/tree/eab585219e6d3eb06c94057f0e3b276d1846e8b6
|
GlobalAvgPool2d
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/is/cispe7zbbl4nxt2jjus6h5iou2w7htohqj7z2oz6g7nqz6vbpbqr.py
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.avg_pool2d]
# Source node to ATen node mapping:
# x => avg_pool2d
# Graph fragment:
# %avg_pool2d : [num_users=1] = call_function[target=torch.ops.aten.avg_pool2d.default](args = (%arg0_1, [4, 4]), kwargs = {})
triton_poi_fused_avg_pool2d_0 = async_compile.triton('triton_poi_fused_avg_pool2d_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_avg_pool2d_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 16, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_avg_pool2d_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (16*x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + (16*x0)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (2 + (16*x0)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (3 + (16*x0)), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr0 + (4 + (16*x0)), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (5 + (16*x0)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (6 + (16*x0)), xmask, eviction_policy='evict_last')
tmp13 = tl.load(in_ptr0 + (7 + (16*x0)), xmask, eviction_policy='evict_last')
tmp15 = tl.load(in_ptr0 + (8 + (16*x0)), xmask, eviction_policy='evict_last')
tmp17 = tl.load(in_ptr0 + (9 + (16*x0)), xmask, eviction_policy='evict_last')
tmp19 = tl.load(in_ptr0 + (10 + (16*x0)), xmask, eviction_policy='evict_last')
tmp21 = tl.load(in_ptr0 + (11 + (16*x0)), xmask, eviction_policy='evict_last')
tmp23 = tl.load(in_ptr0 + (12 + (16*x0)), xmask, eviction_policy='evict_last')
tmp25 = tl.load(in_ptr0 + (13 + (16*x0)), xmask, eviction_policy='evict_last')
tmp27 = tl.load(in_ptr0 + (14 + (16*x0)), xmask, eviction_policy='evict_last')
tmp29 = tl.load(in_ptr0 + (15 + (16*x0)), xmask, eviction_policy='evict_last')
tmp2 = tmp1 + tmp0
tmp4 = tmp3 + tmp2
tmp6 = tmp5 + tmp4
tmp8 = tmp7 + tmp6
tmp10 = tmp9 + tmp8
tmp12 = tmp11 + tmp10
tmp14 = tmp13 + tmp12
tmp16 = tmp15 + tmp14
tmp18 = tmp17 + tmp16
tmp20 = tmp19 + tmp18
tmp22 = tmp21 + tmp20
tmp24 = tmp23 + tmp22
tmp26 = tmp25 + tmp24
tmp28 = tmp27 + tmp26
tmp30 = tmp29 + tmp28
tmp31 = 0.0625
tmp32 = tmp30 * tmp31
tl.store(out_ptr0 + (x0), tmp32, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 1, 1), (4, 1, 1, 1), torch.float32)
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.avg_pool2d]
stream0 = get_raw_stream(0)
triton_poi_fused_avg_pool2d_0.run(arg0_1, buf0, 16, grid=grid(16), stream=stream0)
del arg0_1
return (reinterpret_tensor(buf0, (4, 4), (4, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class GlobalAvgPool2d(nn.Module):
def __init__(self):
super(GlobalAvgPool2d, self).__init__()
def forward(self, x):
N = x.data.size(0)
C = x.data.size(1)
H = x.data.size(2)
W = x.data.size(3)
x = F.avg_pool2d(x, (H, W))
x = x.view(N, C)
return x
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_avg_pool2d_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + 16 * x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + 16 * x0), xmask, eviction_policy='evict_last'
)
tmp3 = tl.load(in_ptr0 + (2 + 16 * x0), xmask, eviction_policy='evict_last'
)
tmp5 = tl.load(in_ptr0 + (3 + 16 * x0), xmask, eviction_policy='evict_last'
)
tmp7 = tl.load(in_ptr0 + (4 + 16 * x0), xmask, eviction_policy='evict_last'
)
tmp9 = tl.load(in_ptr0 + (5 + 16 * x0), xmask, eviction_policy='evict_last'
)
tmp11 = tl.load(in_ptr0 + (6 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp13 = tl.load(in_ptr0 + (7 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp15 = tl.load(in_ptr0 + (8 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp17 = tl.load(in_ptr0 + (9 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp19 = tl.load(in_ptr0 + (10 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp21 = tl.load(in_ptr0 + (11 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp23 = tl.load(in_ptr0 + (12 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp25 = tl.load(in_ptr0 + (13 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp27 = tl.load(in_ptr0 + (14 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp29 = tl.load(in_ptr0 + (15 + 16 * x0), xmask, eviction_policy=
'evict_last')
tmp2 = tmp1 + tmp0
tmp4 = tmp3 + tmp2
tmp6 = tmp5 + tmp4
tmp8 = tmp7 + tmp6
tmp10 = tmp9 + tmp8
tmp12 = tmp11 + tmp10
tmp14 = tmp13 + tmp12
tmp16 = tmp15 + tmp14
tmp18 = tmp17 + tmp16
tmp20 = tmp19 + tmp18
tmp22 = tmp21 + tmp20
tmp24 = tmp23 + tmp22
tmp26 = tmp25 + tmp24
tmp28 = tmp27 + tmp26
tmp30 = tmp29 + tmp28
tmp31 = 0.0625
tmp32 = tmp30 * tmp31
tl.store(out_ptr0 + x0, tmp32, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 1, 1), (4, 1, 1, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_avg_pool2d_0[grid(16)](arg0_1, buf0, 16, XBLOCK=16,
num_warps=1, num_stages=1)
del arg0_1
return reinterpret_tensor(buf0, (4, 4), (4, 1), 0),
class GlobalAvgPool2dNew(nn.Module):
def __init__(self):
super(GlobalAvgPool2dNew, self).__init__()
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
CoDaS-Lab/Contextual-Adversarial-Patches
|
GlobalAvgPool2d
| false | 2,100 |
[
"MIT"
] | 0 |
ffbd897174fc381ba7c3ba1e6f827b84ccb30fd4
|
https://github.com/CoDaS-Lab/Contextual-Adversarial-Patches/tree/ffbd897174fc381ba7c3ba1e6f827b84ccb30fd4
|
Attention
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/22/c2243krwvvvf4r4yarww4z2i5qpn4ituopmbv2ri27owefyawe3a.py
# Topologically Sorted Source Nodes: [add, relu], Original ATen: [aten.add, aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# add => add
# relu => relu
# Graph fragment:
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_1, %unsqueeze), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%add,), kwargs = {})
# %le : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_add_relu_threshold_backward_0 = async_compile.triton('triton_poi_fused_add_relu_threshold_backward_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*i1', 6: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_relu_threshold_backward_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_relu_threshold_backward_0(in_ptr0, in_ptr1, in_ptr2, in_ptr3, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x5 = xindex % 256
x0 = xindex % 4
x3 = (xindex // 256)
x6 = xindex % 64
x4 = xindex
tmp0 = tl.load(in_ptr0 + (x5), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x0), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (x6 + (64*x3)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr3 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tmp2 + tmp5
tmp7 = tl.full([1], 0, tl.int32)
tmp8 = triton_helpers.maximum(tmp7, tmp6)
tmp9 = 0.0
tmp10 = tmp8 <= tmp9
tl.store(out_ptr0 + (x4), tmp8, xmask)
tl.store(out_ptr1 + (x4), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/xk/cxkugsynlmnyrjhah42fewrhwovuvurnuv2qimo2qhxq27wjmq7q.py
# Topologically Sorted Source Nodes: [alpha], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# alpha => amax, exp, sub
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%squeeze, [1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%squeeze, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
triton_poi_fused__softmax_1 = async_compile.triton('triton_poi_fused__softmax_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + (x3), tmp9, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/jf/cjfzp64ny4hf7wdw5wptah3hqv5fcsh5rrw4brz7uxcy6ad57n7h.py
# Topologically Sorted Source Nodes: [alpha], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# alpha => div, sum_1
# Graph fragment:
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [1], True), kwargs = {})
# %div : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
triton_poi_fused__softmax_2 = async_compile.triton('triton_poi_fused__softmax_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_2(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + (x3), tmp8, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/df/cdf4yunxzwhg2apeu35u7judmlotrbwvwododu4qvc6xrng7w2yb.py
# Topologically Sorted Source Nodes: [mul, attention_weighted_encoding], Original ATen: [aten.mul, aten.sum]
# Source node to ATen node mapping:
# attention_weighted_encoding => sum_2
# mul => mul
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_3, %unsqueeze_1), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%mul, [1]), kwargs = {})
triton_poi_fused_mul_sum_3 = async_compile.triton('triton_poi_fused_mul_sum_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mul_sum_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mul_sum_3(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x4 = xindex % 256
x1 = (xindex // 4) % 16
x3 = (xindex // 256)
x5 = xindex
tmp0 = tl.load(in_ptr0 + (x4), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x1 + (64*x3)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + (16 + x1 + (64*x3)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr1 + (32 + x1 + (64*x3)), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr1 + (48 + x1 + (64*x3)), xmask, eviction_policy='evict_last')
tmp2 = tmp0 * tmp1
tmp4 = tmp0 * tmp3
tmp5 = tmp2 + tmp4
tmp7 = tmp0 * tmp6
tmp8 = tmp5 + tmp7
tmp10 = tmp0 * tmp9
tmp11 = tmp8 + tmp10
tl.store(out_ptr0 + (x5), tmp11, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_7, (1, 4), (4, 1))
assert_size_stride(primals_8, (1, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), out=buf0)
del primals_1
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_6, (64, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), out=buf1)
del primals_4
buf2 = empty_strided_cuda((4, 4, 4, 4, 4), (256, 64, 16, 4, 1), torch.float32)
buf8 = empty_strided_cuda((4, 4, 4, 4, 4), (256, 64, 16, 4, 1), torch.bool)
# Topologically Sorted Source Nodes: [add, relu], Original ATen: [aten.add, aten.relu, aten.threshold_backward]
stream0 = get_raw_stream(0)
triton_poi_fused_add_relu_threshold_backward_0.run(buf0, primals_2, buf1, primals_5, buf2, buf8, 1024, grid=grid(1024), stream=stream0)
del primals_2
del primals_5
buf4 = reinterpret_tensor(buf1, (256, 1), (1, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [linear_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_8, reinterpret_tensor(buf2, (256, 4), (4, 1), 0), reinterpret_tensor(primals_7, (4, 1), (1, 4), 0), alpha=1, beta=1, out=buf4)
del primals_8
buf5 = reinterpret_tensor(buf0, (4, 4, 4, 4, 1), (64, 16, 4, 1, 256), 0); del buf0 # reuse
# Topologically Sorted Source Nodes: [alpha], Original ATen: [aten._softmax]
triton_poi_fused__softmax_1.run(buf4, buf5, 256, grid=grid(256), stream=stream0)
buf6 = reinterpret_tensor(buf4, (4, 4, 4, 4, 1), (64, 16, 4, 1, 1), 0); del buf4 # reuse
# Topologically Sorted Source Nodes: [alpha], Original ATen: [aten._softmax]
triton_poi_fused__softmax_2.run(buf5, buf6, 256, grid=grid(256), stream=stream0)
del buf5
buf7 = empty_strided_cuda((4, 4, 4, 4, 4), (256, 64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [mul, attention_weighted_encoding], Original ATen: [aten.mul, aten.sum]
triton_poi_fused_mul_sum_3.run(primals_3, buf6, buf7, 1024, grid=grid(1024), stream=stream0)
return (buf7, buf6, primals_3, reinterpret_tensor(primals_6, (64, 4), (4, 1), 0), reinterpret_tensor(buf2, (256, 4), (4, 1), 0), buf6, primals_7, buf8, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((1, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((1, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
import torch.optim
import torch.utils.data
class Attention(nn.Module):
"""
Attention Network.
"""
def __init__(self, encoder_dim, decoder_dim, attention_dim):
"""
:param encoder_dim: feature size of encoded images
:param decoder_dim: size of decoder's RNN
:param attention_dim: size of the attention network
"""
super(Attention, self).__init__()
self.encoder_att = nn.Linear(encoder_dim, attention_dim)
self.decoder_att = nn.Linear(decoder_dim, attention_dim)
self.full_att = nn.Linear(attention_dim, 1)
self.relu = nn.ReLU()
self.softmax = nn.Softmax(dim=1)
def forward(self, encoder_out, decoder_hidden):
"""
Forward propagation.
:param encoder_out: encoded images, a tensor of dimension (batch_size, num_pixels, encoder_dim)
:param decoder_hidden: previous decoder output, a tensor of dimension (batch_size, decoder_dim)
:return: attention weighted encoding, weights
"""
att1 = self.encoder_att(encoder_out)
att2 = self.decoder_att(decoder_hidden)
att = self.full_att(self.relu(att1 + att2.unsqueeze(1))).squeeze(2)
alpha = self.softmax(att)
attention_weighted_encoding = (encoder_out * alpha.unsqueeze(2)).sum(
dim=1)
return attention_weighted_encoding, alpha
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'encoder_dim': 4, 'decoder_dim': 4, 'attention_dim': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
from torch import nn
import torch.optim
import torch.utils.data
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_add_relu_threshold_backward_0(in_ptr0, in_ptr1,
in_ptr2, in_ptr3, out_ptr0, out_ptr1, xnumel, XBLOCK: tl.constexpr):
xnumel = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x5 = xindex % 256
x0 = xindex % 4
x3 = xindex // 256
x6 = xindex % 64
x4 = xindex
tmp0 = tl.load(in_ptr0 + x5, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x0, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (x6 + 64 * x3), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr3 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tmp2 + tmp5
tmp7 = tl.full([1], 0, tl.int32)
tmp8 = triton_helpers.maximum(tmp7, tmp6)
tmp9 = 0.0
tmp10 = tmp8 <= tmp9
tl.store(out_ptr0 + x4, tmp8, xmask)
tl.store(out_ptr1 + x4, tmp10, xmask)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + x3, tmp9, xmask)
@triton.jit
def triton_poi_fused__softmax_2(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + x3, tmp8, xmask)
@triton.jit
def triton_poi_fused_mul_sum_3(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x4 = xindex % 256
x1 = xindex // 4 % 16
x3 = xindex // 256
x5 = xindex
tmp0 = tl.load(in_ptr0 + x4, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x1 + 64 * x3), xmask, eviction_policy=
'evict_last')
tmp3 = tl.load(in_ptr1 + (16 + x1 + 64 * x3), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr1 + (32 + x1 + 64 * x3), xmask, eviction_policy=
'evict_last')
tmp9 = tl.load(in_ptr1 + (48 + x1 + 64 * x3), xmask, eviction_policy=
'evict_last')
tmp2 = tmp0 * tmp1
tmp4 = tmp0 * tmp3
tmp5 = tmp2 + tmp4
tmp7 = tmp0 * tmp6
tmp8 = tmp5 + tmp7
tmp10 = tmp0 * tmp9
tmp11 = tmp8 + tmp10
tl.store(out_ptr0 + x5, tmp11, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8) = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_7, (1, 4), (4, 1))
assert_size_stride(primals_8, (1,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), out=buf0)
del primals_1
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_6, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), out=buf1)
del primals_4
buf2 = empty_strided_cuda((4, 4, 4, 4, 4), (256, 64, 16, 4, 1),
torch.float32)
buf8 = empty_strided_cuda((4, 4, 4, 4, 4), (256, 64, 16, 4, 1),
torch.bool)
get_raw_stream(0)
triton_poi_fused_add_relu_threshold_backward_0[grid(1024)](buf0,
primals_2, buf1, primals_5, buf2, buf8, 1024, XBLOCK=128,
num_warps=4, num_stages=1)
del primals_2
del primals_5
buf4 = reinterpret_tensor(buf1, (256, 1), (1, 1), 0)
del buf1
extern_kernels.addmm(primals_8, reinterpret_tensor(buf2, (256, 4),
(4, 1), 0), reinterpret_tensor(primals_7, (4, 1), (1, 4), 0),
alpha=1, beta=1, out=buf4)
del primals_8
buf5 = reinterpret_tensor(buf0, (4, 4, 4, 4, 1), (64, 16, 4, 1, 256), 0
)
del buf0
triton_poi_fused__softmax_1[grid(256)](buf4, buf5, 256, XBLOCK=256,
num_warps=4, num_stages=1)
buf6 = reinterpret_tensor(buf4, (4, 4, 4, 4, 1), (64, 16, 4, 1, 1), 0)
del buf4
triton_poi_fused__softmax_2[grid(256)](buf5, buf6, 256, XBLOCK=256,
num_warps=4, num_stages=1)
del buf5
buf7 = empty_strided_cuda((4, 4, 4, 4, 4), (256, 64, 16, 4, 1),
torch.float32)
triton_poi_fused_mul_sum_3[grid(1024)](primals_3, buf6, buf7, 1024,
XBLOCK=256, num_warps=4, num_stages=1)
return buf7, buf6, primals_3, reinterpret_tensor(primals_6, (64, 4), (4,
1), 0), reinterpret_tensor(buf2, (256, 4), (4, 1), 0
), buf6, primals_7, buf8
class AttentionNew(nn.Module):
"""
Attention Network.
"""
def __init__(self, encoder_dim, decoder_dim, attention_dim):
"""
:param encoder_dim: feature size of encoded images
:param decoder_dim: size of decoder's RNN
:param attention_dim: size of the attention network
"""
super(AttentionNew, self).__init__()
self.encoder_att = nn.Linear(encoder_dim, attention_dim)
self.decoder_att = nn.Linear(decoder_dim, attention_dim)
self.full_att = nn.Linear(attention_dim, 1)
self.relu = nn.ReLU()
self.softmax = nn.Softmax(dim=1)
def forward(self, input_0, input_1):
primals_1 = self.encoder_att.weight
primals_2 = self.encoder_att.bias
primals_4 = self.decoder_att.weight
primals_5 = self.decoder_att.bias
primals_7 = self.full_att.weight
primals_8 = self.full_att.bias
primals_3 = input_0
primals_6 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8])
return output[0], output[1]
|
CasperLindbergAtGithub/CaptionGeneration
|
Attention
| false | 2,101 |
[
"MIT"
] | 0 |
a181d4e8db41e77cb2663ed10652f40f62bed482
|
https://github.com/CasperLindbergAtGithub/CaptionGeneration/tree/a181d4e8db41e77cb2663ed10652f40f62bed482
|
Reorg
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/md/cmdvvkvftnyzlmlhenb5cojabxyds4oikrxtdom7hg54fjve7bri.py
# Topologically Sorted Source Nodes: [x_2], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# x_2 => clone_2
# Graph fragment:
# %clone_2 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute_2,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_0 = async_compile.triton('triton_poi_fused_clone_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 16], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex % 2
x3 = (xindex // 2)
y0 = yindex % 4
y1 = (yindex // 4)
x5 = xindex
y4 = yindex
tmp0 = tl.load(in_ptr0 + ((2*x2) + (4*(y0 // 2)) + (8*x3) + (64*y1) + (y0 % 2)), xmask & ymask)
tl.store(out_ptr0 + (x5 + (16*y4)), tmp0, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 2, 2), (64, 16, 4, 2, 1), torch.float32)
# Topologically Sorted Source Nodes: [x_2], Original ATen: [aten.clone]
stream0 = get_raw_stream(0)
triton_poi_fused_clone_0.run(arg0_1, buf0, 16, 16, grid=grid(16, 16), stream=stream0)
del arg0_1
return (reinterpret_tensor(buf0, (4, 16, 2, 2), (64, 4, 2, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class Reorg(nn.Module):
def __init__(self, stride=2):
super(Reorg, self).__init__()
self.stride = stride
def forward(self, x):
stride = self.stride
assert x.data.dim() == 4
B = x.data.size(0)
C = x.data.size(1)
H = x.data.size(2)
W = x.data.size(3)
assert H % stride == 0
assert W % stride == 0
ws = stride
hs = stride
x = x.view(B, C, H // hs, hs, W // ws, ws).transpose(3, 4).contiguous()
x = x.view(B, C, H // hs * W // ws, hs * ws).transpose(2, 3
).contiguous()
x = x.view(B, C, hs * ws, H // hs, W // ws).transpose(1, 2).contiguous(
)
x = x.view(B, hs * ws * C, H // hs, W // ws)
return x
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex % 2
x3 = xindex // 2
y0 = yindex % 4
y1 = yindex // 4
x5 = xindex
y4 = yindex
tmp0 = tl.load(in_ptr0 + (2 * x2 + 4 * (y0 // 2) + 8 * x3 + 64 * y1 +
y0 % 2), xmask & ymask)
tl.store(out_ptr0 + (x5 + 16 * y4), tmp0, xmask & ymask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 2, 2), (64, 16, 4, 2, 1), torch
.float32)
get_raw_stream(0)
triton_poi_fused_clone_0[grid(16, 16)](arg0_1, buf0, 16, 16, XBLOCK
=16, YBLOCK=16, num_warps=4, num_stages=1)
del arg0_1
return reinterpret_tensor(buf0, (4, 16, 2, 2), (64, 4, 2, 1), 0),
class ReorgNew(nn.Module):
def __init__(self, stride=2):
super(ReorgNew, self).__init__()
self.stride = stride
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
CoDaS-Lab/Contextual-Adversarial-Patches
|
Reorg
| false | 2,102 |
[
"MIT"
] | 0 |
ffbd897174fc381ba7c3ba1e6f827b84ccb30fd4
|
https://github.com/CoDaS-Lab/Contextual-Adversarial-Patches/tree/ffbd897174fc381ba7c3ba1e6f827b84ccb30fd4
|
ConvBlock
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/qf/cqf7gwutkswogpoieukkzrlezczaf4jzo3cnrl7zupsezutoj3ez.py
# Topologically Sorted Source Nodes: [c, r], Original ATen: [aten.convolution, aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# c => convolution
# r => relu
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [1, 1], [1, 1], False, [0, 0], 1), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%convolution,), kwargs = {})
# %le : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_convolution_relu_threshold_backward_0 = async_compile.triton('triton_poi_fused_convolution_relu_threshold_backward_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_relu_threshold_backward_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_relu_threshold_backward_0(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x3), tmp4, xmask)
tl.store(out_ptr0 + (x3), tmp6, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [c], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 4, 4), (64, 16, 4, 1))
buf1 = buf0; del buf0 # reuse
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
# Topologically Sorted Source Nodes: [c, r], Original ATen: [aten.convolution, aten.relu, aten.threshold_backward]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_relu_threshold_backward_0.run(buf1, primals_2, buf2, 256, grid=grid(256), stream=stream0)
del primals_2
return (buf1, primals_1, primals_3, buf2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class ConvBlock(nn.Module):
"""
Simple 3x3 conv with padding size 1 (to leave the input size unchanged), followed by a ReLU.
"""
def __init__(self, input_channels: 'int', output_channels: 'int',
kernel_size: 'Param2D'=3, stride: 'Param2D'=1, padding: 'Param2D'=1
) ->None:
super().__init__()
self.conv = nn.Conv2d(input_channels, output_channels, kernel_size=
kernel_size, stride=stride, padding=padding)
self.relu = nn.ReLU()
def forward(self, x: 'torch.Tensor') ->torch.Tensor:
"""
Parameters
----------
x
of dimensions (B, C, H, W)
Returns
-------
torch.Tensor
of dimensions (B, C, H, W)
"""
c = self.conv(x)
r = self.relu(c)
return r
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'input_channels': 4, 'output_channels': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_convolution_relu_threshold_backward_0(in_out_ptr0,
in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 16 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x3, tmp4, xmask)
tl.store(out_ptr0 + x3, tmp6, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 4, 4), (64, 16, 4, 1))
buf1 = buf0
del buf0
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
get_raw_stream(0)
triton_poi_fused_convolution_relu_threshold_backward_0[grid(256)](buf1,
primals_2, buf2, 256, XBLOCK=256, num_warps=4, num_stages=1)
del primals_2
return buf1, primals_1, primals_3, buf2
class ConvBlockNew(nn.Module):
"""
Simple 3x3 conv with padding size 1 (to leave the input size unchanged), followed by a ReLU.
"""
def __init__(self, input_channels: 'int', output_channels: 'int',
kernel_size: 'Param2D'=3, stride: 'Param2D'=1, padding: 'Param2D'=1
) ->None:
super().__init__()
self.conv = nn.Conv2d(input_channels, output_channels, kernel_size=
kernel_size, stride=stride, padding=padding)
self.relu = nn.ReLU()
def forward(self, input_0):
primals_1 = self.conv.weight
primals_2 = self.conv.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
ChristianPoepselBE/fsdl-text-recognizer-2021-labs
|
ConvBlock
| false | 2,103 |
[
"MIT"
] | 0 |
161a9fa605f3fb955b1339e076248d317c881c47
|
https://github.com/ChristianPoepselBE/fsdl-text-recognizer-2021-labs/tree/161a9fa605f3fb955b1339e076248d317c881c47
|
EncoderLayer
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/dk/cdk4odz276xorciau5ehgl7f3s2mgkf3hrye6xep6kzubczdeqqy.py
# Topologically Sorted Source Nodes: [matmul], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# matmul => clone
# Graph fragment:
# %clone : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%expand,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_0 = async_compile.triton('triton_poi_fused_clone_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 4], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = (yindex // 4)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (4*x2) + (16*y1)), xmask & ymask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (y0), ymask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(out_ptr0 + (x2 + (4*y3)), tmp2, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/bs/cbsluabtq7ll426nybkislhh3cajm6f7ggrxam362hohynwnvtk6.py
# Topologically Sorted Source Nodes: [eq], Original ATen: [aten.eq]
# Source node to ATen node mapping:
# eq => eq
# Graph fragment:
# %eq : [num_users=2] = call_function[target=torch.ops.aten.eq.Scalar](args = (%unsqueeze, 0), kwargs = {})
triton_poi_fused_eq_1 = async_compile.triton('triton_poi_fused_eq_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*i1', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_eq_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_eq_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = 0.0
tmp2 = tmp0 == tmp1
tl.store(out_ptr0 + (x0), tmp2, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/6v/c6varcicuq4byhpi2ez4zfksc6c5naym336xenou4witslx53n6e.py
# Topologically Sorted Source Nodes: [scores, scores_1, scores_2], Original ATen: [aten.div, aten.masked_fill, aten._softmax]
# Source node to ATen node mapping:
# scores => div
# scores_1 => full_default, where
# scores_2 => amax, exp, sub, sum_1
# Graph fragment:
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%view_11, 1.0), kwargs = {})
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], -1000000000.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %where : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%eq, %full_default, %div), kwargs = {})
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%where, [-1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [-1], True), kwargs = {})
triton_poi_fused__softmax_div_masked_fill_2 = async_compile.triton('triton_poi_fused__softmax_div_masked_fill_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*i1', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_div_masked_fill_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_div_masked_fill_2(in_ptr0, in_ptr1, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = (xindex // 16)
x3 = xindex
tmp0 = tl.load(in_ptr0 + ((4*x0) + (16*x2)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp1 = tl.load(in_ptr1 + (4*x3), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (1 + (4*x0) + (16*x2)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp7 = tl.load(in_ptr1 + (1 + (4*x3)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (2 + (4*x0) + (16*x2)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp12 = tl.load(in_ptr1 + (2 + (4*x3)), xmask, eviction_policy='evict_last')
tmp16 = tl.load(in_ptr0 + (3 + (4*x0) + (16*x2)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp17 = tl.load(in_ptr1 + (3 + (4*x3)), xmask, eviction_policy='evict_last')
tmp2 = 1.0
tmp3 = tmp1 * tmp2
tmp4 = -1000000000.0
tmp5 = tl.where(tmp0, tmp4, tmp3)
tmp8 = tmp7 * tmp2
tmp9 = tl.where(tmp6, tmp4, tmp8)
tmp10 = triton_helpers.maximum(tmp5, tmp9)
tmp13 = tmp12 * tmp2
tmp14 = tl.where(tmp11, tmp4, tmp13)
tmp15 = triton_helpers.maximum(tmp10, tmp14)
tmp18 = tmp17 * tmp2
tmp19 = tl.where(tmp16, tmp4, tmp18)
tmp20 = triton_helpers.maximum(tmp15, tmp19)
tmp21 = tmp5 - tmp20
tmp22 = tl_math.exp(tmp21)
tmp23 = tmp9 - tmp20
tmp24 = tl_math.exp(tmp23)
tmp25 = tmp22 + tmp24
tmp26 = tmp14 - tmp20
tmp27 = tl_math.exp(tmp26)
tmp28 = tmp25 + tmp27
tmp29 = tmp19 - tmp20
tmp30 = tl_math.exp(tmp29)
tmp31 = tmp28 + tmp30
tl.store(out_ptr0 + (x3), tmp20, xmask)
tl.store(out_ptr1 + (x3), tmp31, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/fb/cfb6x4ausnhkt7gycxsexlmn75uyb6haot5nthwqf5hummcazrv4.py
# Topologically Sorted Source Nodes: [scores, scores_1, scores_2], Original ATen: [aten.div, aten.masked_fill, aten._softmax]
# Source node to ATen node mapping:
# scores => div
# scores_1 => full_default, where
# scores_2 => amax, div_1, exp, sub
# Graph fragment:
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%view_11, 1.0), kwargs = {})
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([], -1000000000.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %where : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%eq, %full_default, %div), kwargs = {})
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%where, [-1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %div_1 : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
triton_poi_fused__softmax_div_masked_fill_3 = async_compile.triton('triton_poi_fused__softmax_div_masked_fill_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*i1', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_div_masked_fill_3', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_div_masked_fill_3(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = (xindex // 64)
x4 = xindex % 16
x5 = xindex
x6 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x4 + (16*x3)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp1 = tl.load(in_out_ptr0 + (x5), xmask)
tmp6 = tl.load(in_ptr1 + (x6), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr2 + (x6), xmask, eviction_policy='evict_last')
tmp2 = 1.0
tmp3 = tmp1 * tmp2
tmp4 = -1000000000.0
tmp5 = tl.where(tmp0, tmp4, tmp3)
tmp7 = tmp5 - tmp6
tmp8 = tl_math.exp(tmp7)
tmp10 = tmp8 / tmp9
tl.store(in_out_ptr0 + (x5), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/6t/c6t5a5ere3lqjiu7zh3uu4oxmpdoujdaqqmeunxqapgzo4m74uav.py
# Topologically Sorted Source Nodes: [contiguous], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# contiguous => clone_4
# Graph fragment:
# %clone_4 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute_7,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_4 = async_compile.triton('triton_poi_fused_clone_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 4], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_4', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_4(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = (yindex // 4)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (4*x2) + (16*y1)), xmask & ymask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + (4*y3)), tmp0, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/mo/cmouuooozc57hgdgjesstcjytujvvur7nds6s4rkng5fpdiinckc.py
# Topologically Sorted Source Nodes: [x1, mean, std], Original ATen: [aten.add, aten.mean, aten.std]
# Source node to ATen node mapping:
# mean => mean
# std => var
# x1 => add
# Graph fragment:
# %add : [num_users=3] = call_function[target=torch.ops.aten.add.Tensor](args = (%primals_1, %view_17), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%add, [-1], True), kwargs = {})
# %var : [num_users=1] = call_function[target=torch.ops.aten.var.correction](args = (%add, [-1]), kwargs = {correction: 1.0, keepdim: True})
triton_poi_fused_add_mean_std_5 = async_compile.triton('triton_poi_fused_add_mean_std_5', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_mean_std_5', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 8, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_mean_std_5(in_out_ptr0, in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (4*x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (4*x0), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr0 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr1 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr1 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tmp2 + tmp5
tmp9 = tmp7 + tmp8
tmp10 = tmp6 + tmp9
tmp13 = tmp11 + tmp12
tmp14 = tmp10 + tmp13
tmp15 = 4.0
tmp16 = tmp14 / tmp15
tmp17 = tmp2 - tmp16
tmp18 = tmp17 * tmp17
tmp19 = tmp5 - tmp16
tmp20 = tmp19 * tmp19
tmp21 = tmp18 + tmp20
tmp22 = tmp9 - tmp16
tmp23 = tmp22 * tmp22
tmp24 = tmp21 + tmp23
tmp25 = tmp13 - tmp16
tmp26 = tmp25 * tmp25
tmp27 = tmp24 + tmp26
tmp28 = 3.0
tmp29 = tmp27 / tmp28
tl.store(out_ptr0 + (x0), tmp16, xmask)
tl.store(in_out_ptr0 + (x0), tmp29, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/or/cor2p63kvpdvr2op6flzvnrlopvepg3b24xoucuvemyenniflp34.py
# Topologically Sorted Source Nodes: [x1, mean, sub, mul, std, add_1, truediv_1, norm], Original ATen: [aten.add, aten.mean, aten.sub, aten.mul, aten.std, aten.div]
# Source node to ATen node mapping:
# add_1 => add_1
# mean => mean
# mul => mul
# norm => add_2
# std => sqrt
# sub => sub_1
# truediv_1 => div_2
# x1 => add
# Graph fragment:
# %add : [num_users=3] = call_function[target=torch.ops.aten.add.Tensor](args = (%primals_1, %view_17), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%add, [-1], True), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%add, %mean), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_11, %sub_1), kwargs = {})
# %sqrt : [num_users=1] = call_function[target=torch.ops.aten.sqrt.default](args = (%var,), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sqrt, 1e-06), kwargs = {})
# %div_2 : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%mul, %add_1), kwargs = {})
# %add_2 : [num_users=2] = call_function[target=torch.ops.aten.add.Tensor](args = (%div_2, %primals_12), kwargs = {})
triton_poi_fused_add_div_mean_mul_std_sub_6 = async_compile.triton('triton_poi_fused_add_div_mean_mul_std_sub_6', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_div_mean_mul_std_sub_6', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 6, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_div_mean_mul_std_sub_6(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, in_ptr5, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask)
tmp2 = tl.load(in_ptr2 + (x2), xmask)
tmp4 = tl.load(in_ptr3 + (x1), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + (x1), xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr5 + (x0), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 - tmp4
tmp6 = tmp0 * tmp5
tmp8 = libdevice.sqrt(tmp7)
tmp9 = 1e-06
tmp10 = tmp8 + tmp9
tmp11 = tmp6 / tmp10
tmp13 = tmp11 + tmp12
tl.store(out_ptr0 + (x2), tmp13, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/qg/cqg3fgo76ti6lkwmor7edhpv3dld6n4jdb263nqdw5afhpd7fujn.py
# Topologically Sorted Source Nodes: [relu], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# relu => relu
# Graph fragment:
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_19,), kwargs = {})
# %le : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_7 = async_compile.triton('triton_poi_fused_relu_threshold_backward_7', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_7', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_7(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 2048
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 128
tmp0 = tl.load(in_out_ptr0 + (x2), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, None)
tl.store(out_ptr0 + (x2), tmp6, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/he/chevf4d6tadiz3y2a2abr2lj2bvo3wyfykoivwj2s4xedp3vdjuf.py
# Topologically Sorted Source Nodes: [x3], Original ATen: [aten.add]
# Source node to ATen node mapping:
# x3 => add_3
# Graph fragment:
# %add_3 : [num_users=4] = call_function[target=torch.ops.aten.add.Tensor](args = (%add_2, %view_21), kwargs = {})
triton_poi_fused_add_8 = async_compile.triton('triton_poi_fused_add_8', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_8', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_8(in_out_ptr0, in_ptr0, in_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_out_ptr0 + (x2), xmask)
tmp2 = tl.load(in_ptr1 + (x0), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp4 = tmp0 + tmp3
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/dl/cdlcfltrwvgivwatrywkeiqrlwdntweybldlpm6mkieh7564w7gb.py
# Topologically Sorted Source Nodes: [mean_1, sub_1, mul_1, std_1, add_4, truediv_2, norm_1], Original ATen: [aten.mean, aten.sub, aten.mul, aten.std, aten.add, aten.div]
# Source node to ATen node mapping:
# add_4 => add_4
# mean_1 => mean_1
# mul_1 => mul_1
# norm_1 => add_5
# std_1 => sqrt_1, var_1
# sub_1 => sub_2
# truediv_2 => div_3
# Graph fragment:
# %mean_1 : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%add_3, [-1], True), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%add_3, %mean_1), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_17, %sub_2), kwargs = {})
# %var_1 : [num_users=1] = call_function[target=torch.ops.aten.var.correction](args = (%add_3, [-1]), kwargs = {correction: 1.0, keepdim: True})
# %sqrt_1 : [num_users=1] = call_function[target=torch.ops.aten.sqrt.default](args = (%var_1,), kwargs = {})
# %add_4 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sqrt_1, 1e-06), kwargs = {})
# %div_3 : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%mul_1, %add_4), kwargs = {})
# %add_5 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%div_3, %primals_18), kwargs = {})
triton_poi_fused_add_div_mean_mul_std_sub_9 = async_compile.triton('triton_poi_fused_add_div_mean_mul_std_sub_9', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_div_mean_mul_std_sub_9', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 7, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_div_mean_mul_std_sub_9(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask)
tmp2 = tl.load(in_ptr1 + (4*x1), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr1 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr1 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + (x0), xmask, eviction_policy='evict_last')
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp8 = tmp6 + tmp7
tmp9 = 4.0
tmp10 = tmp8 / tmp9
tmp11 = tmp1 - tmp10
tmp12 = tmp0 * tmp11
tmp13 = tmp2 - tmp10
tmp14 = tmp13 * tmp13
tmp15 = tmp3 - tmp10
tmp16 = tmp15 * tmp15
tmp17 = tmp14 + tmp16
tmp18 = tmp5 - tmp10
tmp19 = tmp18 * tmp18
tmp20 = tmp17 + tmp19
tmp21 = tmp7 - tmp10
tmp22 = tmp21 * tmp21
tmp23 = tmp20 + tmp22
tmp24 = 3.0
tmp25 = tmp23 / tmp24
tmp26 = libdevice.sqrt(tmp25)
tmp27 = 1e-06
tmp28 = tmp26 + tmp27
tmp29 = tmp12 / tmp28
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + (x2), tmp31, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15, primals_16, primals_17, primals_18 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4, ), (1, ))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 4), (4, 1))
assert_size_stride(primals_7, (4, ), (1, ))
assert_size_stride(primals_8, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_9, (4, 4), (4, 1))
assert_size_stride(primals_10, (4, ), (1, ))
assert_size_stride(primals_11, (4, ), (1, ))
assert_size_stride(primals_12, (4, ), (1, ))
assert_size_stride(primals_13, (128, 4), (4, 1))
assert_size_stride(primals_14, (128, ), (1, ))
assert_size_stride(primals_15, (4, 128), (128, 1))
assert_size_stride(primals_16, (4, ), (1, ))
assert_size_stride(primals_17, (4, ), (1, ))
assert_size_stride(primals_18, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), out=buf0)
del primals_2
buf1 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), out=buf1)
del primals_4
buf2 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_6, (4, 4), (1, 4), 0), out=buf2)
del primals_6
buf3 = empty_strided_cuda((4, 4, 4, 1), (16, 4, 1, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul], Original ATen: [aten.clone]
stream0 = get_raw_stream(0)
triton_poi_fused_clone_0.run(buf1, primals_5, buf3, 16, 4, grid=grid(16, 4), stream=stream0)
del primals_5
buf4 = reinterpret_tensor(buf1, (4, 4, 1, 4), (16, 4, 4, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [matmul], Original ATen: [aten.clone]
triton_poi_fused_clone_0.run(buf0, primals_3, buf4, 16, 4, grid=grid(16, 4), stream=stream0)
del primals_3
buf5 = empty_strided_cuda((16, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul], Original ATen: [aten.bmm]
extern_kernels.bmm(reinterpret_tensor(buf3, (16, 4, 1), (4, 1, 0), 0), reinterpret_tensor(buf4, (16, 1, 4), (4, 0, 1), 0), out=buf5)
buf6 = empty_strided_cuda((4, 1, 4, 4), (16, 16, 4, 1), torch.bool)
# Topologically Sorted Source Nodes: [eq], Original ATen: [aten.eq]
triton_poi_fused_eq_1.run(primals_8, buf6, 64, grid=grid(64), stream=stream0)
del primals_8
buf7 = reinterpret_tensor(buf0, (4, 4, 4, 1), (16, 4, 1, 64), 0); del buf0 # reuse
buf8 = empty_strided_cuda((4, 4, 4, 1), (16, 4, 1, 64), torch.float32)
# Topologically Sorted Source Nodes: [scores, scores_1, scores_2], Original ATen: [aten.div, aten.masked_fill, aten._softmax]
triton_poi_fused__softmax_div_masked_fill_2.run(buf6, buf5, buf7, buf8, 64, grid=grid(64), stream=stream0)
buf9 = reinterpret_tensor(buf5, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf5 # reuse
# Topologically Sorted Source Nodes: [scores, scores_1, scores_2], Original ATen: [aten.div, aten.masked_fill, aten._softmax]
triton_poi_fused__softmax_div_masked_fill_3.run(buf9, buf6, buf7, buf8, 256, grid=grid(256), stream=stream0)
buf10 = reinterpret_tensor(buf8, (4, 4, 4, 1), (16, 4, 1, 1), 0); del buf8 # reuse
# Topologically Sorted Source Nodes: [output], Original ATen: [aten.clone]
triton_poi_fused_clone_0.run(buf2, primals_7, buf10, 16, 4, grid=grid(16, 4), stream=stream0)
del primals_7
buf11 = reinterpret_tensor(buf2, (16, 4, 1), (4, 1, 1), 0); del buf2 # reuse
# Topologically Sorted Source Nodes: [output], Original ATen: [aten.bmm]
extern_kernels.bmm(reinterpret_tensor(buf9, (16, 4, 4), (16, 4, 1), 0), reinterpret_tensor(buf10, (16, 4, 1), (4, 1, 0), 0), out=buf11)
buf12 = reinterpret_tensor(buf7, (4, 4, 4, 1), (16, 4, 1, 1), 0); del buf7 # reuse
# Topologically Sorted Source Nodes: [contiguous], Original ATen: [aten.clone]
triton_poi_fused_clone_4.run(buf11, buf12, 16, 4, grid=grid(16, 4), stream=stream0)
buf13 = reinterpret_tensor(buf11, (16, 4), (4, 1), 0); del buf11 # reuse
# Topologically Sorted Source Nodes: [output_1], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_10, reinterpret_tensor(buf12, (16, 4), (4, 1), 0), reinterpret_tensor(primals_9, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf13)
del primals_10
buf14 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
buf15 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
buf16 = buf15; del buf15 # reuse
# Topologically Sorted Source Nodes: [x1, mean, std], Original ATen: [aten.add, aten.mean, aten.std]
triton_poi_fused_add_mean_std_5.run(buf16, primals_1, buf13, buf14, 16, grid=grid(16), stream=stream0)
buf17 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x1, mean, sub, mul, std, add_1, truediv_1, norm], Original ATen: [aten.add, aten.mean, aten.sub, aten.mul, aten.std, aten.div]
triton_poi_fused_add_div_mean_mul_std_sub_6.run(primals_11, primals_1, buf13, buf14, buf16, primals_12, buf17, 64, grid=grid(64), stream=stream0)
del buf14
del buf16
del primals_12
buf18 = empty_strided_cuda((16, 128), (128, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf17, (16, 4), (4, 1), 0), reinterpret_tensor(primals_13, (4, 128), (1, 4), 0), out=buf18)
buf19 = reinterpret_tensor(buf18, (4, 4, 128), (512, 128, 1), 0); del buf18 # reuse
buf23 = empty_strided_cuda((4, 4, 128), (512, 128, 1), torch.bool)
# Topologically Sorted Source Nodes: [relu], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_7.run(buf19, primals_14, buf23, 2048, grid=grid(2048), stream=stream0)
del primals_14
buf20 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf19, (16, 128), (128, 1), 0), reinterpret_tensor(primals_15, (128, 4), (1, 128), 0), out=buf20)
buf21 = reinterpret_tensor(buf20, (4, 4, 4), (16, 4, 1), 0); del buf20 # reuse
# Topologically Sorted Source Nodes: [x3], Original ATen: [aten.add]
triton_poi_fused_add_8.run(buf21, buf17, primals_16, 64, grid=grid(64), stream=stream0)
del primals_16
buf22 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [mean_1, sub_1, mul_1, std_1, add_4, truediv_2, norm_1], Original ATen: [aten.mean, aten.sub, aten.mul, aten.std, aten.add, aten.div]
triton_poi_fused_add_div_mean_mul_std_sub_9.run(primals_17, buf21, primals_18, buf22, 64, grid=grid(64), stream=stream0)
del primals_18
return (buf22, primals_1, primals_11, primals_17, buf6, buf9, reinterpret_tensor(buf12, (16, 4), (4, 1), 0), buf13, reinterpret_tensor(buf17, (16, 4), (4, 1), 0), reinterpret_tensor(buf19, (16, 128), (128, 1), 0), buf21, primals_15, buf23, primals_13, primals_9, reinterpret_tensor(buf10, (16, 1, 4), (4, 1, 1), 0), reinterpret_tensor(buf3, (16, 1, 4), (4, 1, 1), 0), reinterpret_tensor(buf4, (16, 4, 1), (4, 1, 4), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_12 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_13 = rand_strided((128, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_14 = rand_strided((128, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_15 = rand_strided((4, 128), (128, 1), device='cuda:0', dtype=torch.float32)
primals_16 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_17 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_18 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15, primals_16, primals_17, primals_18])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import math
import torch
import torch.nn as nn
import torch.nn.functional as F
class FeedForward(nn.Module):
def __init__(self, d_model, d_ff=2048, dropout=0.1):
super().__init__()
self.linear_1 = nn.Linear(d_model, d_ff)
self.dropout = nn.Dropout(dropout)
self.linear_2 = nn.Linear(d_ff, d_model)
def forward(self, x):
x = self.dropout(F.relu(self.linear_1(x)))
x = self.linear_2(x)
return x
class MultiHeadAttention(nn.Module):
def __init__(self, heads, d_model, dropout=0.1):
super().__init__()
self.d_model = d_model
self.d_k = d_model // heads
self.h = heads
self.q_linear = nn.Linear(d_model, d_model)
self.v_linear = nn.Linear(d_model, d_model)
self.k_linear = nn.Linear(d_model, d_model)
self.dropout = nn.Dropout(dropout)
self.out = nn.Linear(d_model, d_model)
def _attention(self, q, k, v, d_k, mask=None, dropout=None):
scores = torch.matmul(q, k.transpose(-2, -1)) / math.sqrt(d_k)
if mask is not None:
mask = mask.unsqueeze(1)
scores = scores.masked_fill(mask == 0, -1000000000.0)
scores = F.softmax(scores, dim=-1)
if dropout is not None:
scores = dropout(scores)
output = torch.matmul(scores, v)
return output
def forward(self, q, k, v, mask=None):
bs = q.size(0)
k = self.k_linear(k).view(bs, -1, self.h, self.d_k)
q = self.q_linear(q).view(bs, -1, self.h, self.d_k)
v = self.v_linear(v).view(bs, -1, self.h, self.d_k)
k = k.transpose(1, 2)
q = q.transpose(1, 2)
v = v.transpose(1, 2)
scores = self._attention(q, k, v, self.d_k, mask, self.dropout)
concat = scores.transpose(1, 2).contiguous().view(bs, -1, self.d_model)
output = self.out(concat)
return output
class Norm(nn.Module):
def __init__(self, d_model, eps=1e-06):
super().__init__()
self.size = d_model
self.alpha = nn.Parameter(torch.ones(self.size))
self.bias = nn.Parameter(torch.zeros(self.size))
self.eps = eps
def forward(self, x):
norm = self.alpha * (x - x.mean(dim=-1, keepdim=True)) / (x.std(dim
=-1, keepdim=True) + self.eps) + self.bias
return norm
class EncoderLayer(nn.Module):
def __init__(self, d_model, heads, dropout=0.1):
super().__init__()
self.norm_1 = Norm(d_model)
self.norm_2 = Norm(d_model)
self.attn = MultiHeadAttention(heads, d_model, dropout=dropout)
self.ff = FeedForward(d_model, d_ff=d_model * 32, dropout=dropout)
self.dropout_1 = nn.Dropout(dropout)
self.dropout_2 = nn.Dropout(dropout)
def forward(self, x, mask):
x1 = x + self.dropout_1(self.attn(x, x, x, mask))
x2 = self.norm_1(x1)
x3 = x2 + self.dropout_2(self.ff(x2))
return self.norm_2(x3)
def get_inputs():
return [torch.rand([4, 4, 4]), torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'d_model': 4, 'heads': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import math
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel,
YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = yindex // 4
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 4 * x2 + 16 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + y0, ymask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(out_ptr0 + (x2 + 4 * y3), tmp2, xmask & ymask)
@triton.jit
def triton_poi_fused_eq_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = 0.0
tmp2 = tmp0 == tmp1
tl.store(out_ptr0 + x0, tmp2, xmask)
@triton.jit
def triton_poi_fused__softmax_div_masked_fill_2(in_ptr0, in_ptr1, out_ptr0,
out_ptr1, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex // 16
x3 = xindex
tmp0 = tl.load(in_ptr0 + (4 * x0 + 16 * x2), xmask, eviction_policy=
'evict_last').to(tl.int1)
tmp1 = tl.load(in_ptr1 + 4 * x3, xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (1 + 4 * x0 + 16 * x2), xmask, eviction_policy
='evict_last').to(tl.int1)
tmp7 = tl.load(in_ptr1 + (1 + 4 * x3), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (2 + 4 * x0 + 16 * x2), xmask,
eviction_policy='evict_last').to(tl.int1)
tmp12 = tl.load(in_ptr1 + (2 + 4 * x3), xmask, eviction_policy='evict_last'
)
tmp16 = tl.load(in_ptr0 + (3 + 4 * x0 + 16 * x2), xmask,
eviction_policy='evict_last').to(tl.int1)
tmp17 = tl.load(in_ptr1 + (3 + 4 * x3), xmask, eviction_policy='evict_last'
)
tmp2 = 1.0
tmp3 = tmp1 * tmp2
tmp4 = -1000000000.0
tmp5 = tl.where(tmp0, tmp4, tmp3)
tmp8 = tmp7 * tmp2
tmp9 = tl.where(tmp6, tmp4, tmp8)
tmp10 = triton_helpers.maximum(tmp5, tmp9)
tmp13 = tmp12 * tmp2
tmp14 = tl.where(tmp11, tmp4, tmp13)
tmp15 = triton_helpers.maximum(tmp10, tmp14)
tmp18 = tmp17 * tmp2
tmp19 = tl.where(tmp16, tmp4, tmp18)
tmp20 = triton_helpers.maximum(tmp15, tmp19)
tmp21 = tmp5 - tmp20
tmp22 = tl_math.exp(tmp21)
tmp23 = tmp9 - tmp20
tmp24 = tl_math.exp(tmp23)
tmp25 = tmp22 + tmp24
tmp26 = tmp14 - tmp20
tmp27 = tl_math.exp(tmp26)
tmp28 = tmp25 + tmp27
tmp29 = tmp19 - tmp20
tmp30 = tl_math.exp(tmp29)
tmp31 = tmp28 + tmp30
tl.store(out_ptr0 + x3, tmp20, xmask)
tl.store(out_ptr1 + x3, tmp31, xmask)
@triton.jit
def triton_poi_fused__softmax_div_masked_fill_3(in_out_ptr0, in_ptr0,
in_ptr1, in_ptr2, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex // 64
x4 = xindex % 16
x5 = xindex
x6 = xindex // 4
tmp0 = tl.load(in_ptr0 + (x4 + 16 * x3), xmask, eviction_policy=
'evict_last').to(tl.int1)
tmp1 = tl.load(in_out_ptr0 + x5, xmask)
tmp6 = tl.load(in_ptr1 + x6, xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr2 + x6, xmask, eviction_policy='evict_last')
tmp2 = 1.0
tmp3 = tmp1 * tmp2
tmp4 = -1000000000.0
tmp5 = tl.where(tmp0, tmp4, tmp3)
tmp7 = tmp5 - tmp6
tmp8 = tl_math.exp(tmp7)
tmp10 = tmp8 / tmp9
tl.store(in_out_ptr0 + x5, tmp10, xmask)
@triton.jit
def triton_poi_fused_clone_4(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = yindex // 4
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 4 * x2 + 16 * y1), xmask & ymask,
eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + 4 * y3), tmp0, xmask & ymask)
@triton.jit
def triton_poi_fused_add_mean_std_5(in_out_ptr0, in_ptr0, in_ptr1, out_ptr0,
xnumel, XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + 4 * x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + 4 * x0, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (1 + 4 * x0), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (1 + 4 * x0), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr0 + (2 + 4 * x0), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr1 + (2 + 4 * x0), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp12 = tl.load(in_ptr1 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tmp2 + tmp5
tmp9 = tmp7 + tmp8
tmp10 = tmp6 + tmp9
tmp13 = tmp11 + tmp12
tmp14 = tmp10 + tmp13
tmp15 = 4.0
tmp16 = tmp14 / tmp15
tmp17 = tmp2 - tmp16
tmp18 = tmp17 * tmp17
tmp19 = tmp5 - tmp16
tmp20 = tmp19 * tmp19
tmp21 = tmp18 + tmp20
tmp22 = tmp9 - tmp16
tmp23 = tmp22 * tmp22
tmp24 = tmp21 + tmp23
tmp25 = tmp13 - tmp16
tmp26 = tmp25 * tmp25
tmp27 = tmp24 + tmp26
tmp28 = 3.0
tmp29 = tmp27 / tmp28
tl.store(out_ptr0 + x0, tmp16, xmask)
tl.store(in_out_ptr0 + x0, tmp29, xmask)
@triton.jit
def triton_poi_fused_add_div_mean_mul_std_sub_6(in_ptr0, in_ptr1, in_ptr2,
in_ptr3, in_ptr4, in_ptr5, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask)
tmp2 = tl.load(in_ptr2 + x2, xmask)
tmp4 = tl.load(in_ptr3 + x1, xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr4 + x1, xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr5 + x0, xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 - tmp4
tmp6 = tmp0 * tmp5
tmp8 = libdevice.sqrt(tmp7)
tmp9 = 1e-06
tmp10 = tmp8 + tmp9
tmp11 = tmp6 / tmp10
tmp13 = tmp11 + tmp12
tl.store(out_ptr0 + x2, tmp13, xmask)
@triton.jit
def triton_poi_fused_relu_threshold_backward_7(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 128
tmp0 = tl.load(in_out_ptr0 + x2, None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, None)
tl.store(out_ptr0 + x2, tmp6, None)
@triton.jit
def triton_poi_fused_add_8(in_out_ptr0, in_ptr0, in_ptr1, xnumel, XBLOCK:
tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_out_ptr0 + x2, xmask)
tmp2 = tl.load(in_ptr1 + x0, xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp4 = tmp0 + tmp3
tl.store(in_out_ptr0 + x2, tmp4, xmask)
@triton.jit
def triton_poi_fused_add_div_mean_mul_std_sub_9(in_ptr0, in_ptr1, in_ptr2,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask)
tmp2 = tl.load(in_ptr1 + 4 * x1, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr1 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr1 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp30 = tl.load(in_ptr2 + x0, xmask, eviction_policy='evict_last')
tmp4 = tmp2 + tmp3
tmp6 = tmp4 + tmp5
tmp8 = tmp6 + tmp7
tmp9 = 4.0
tmp10 = tmp8 / tmp9
tmp11 = tmp1 - tmp10
tmp12 = tmp0 * tmp11
tmp13 = tmp2 - tmp10
tmp14 = tmp13 * tmp13
tmp15 = tmp3 - tmp10
tmp16 = tmp15 * tmp15
tmp17 = tmp14 + tmp16
tmp18 = tmp5 - tmp10
tmp19 = tmp18 * tmp18
tmp20 = tmp17 + tmp19
tmp21 = tmp7 - tmp10
tmp22 = tmp21 * tmp21
tmp23 = tmp20 + tmp22
tmp24 = 3.0
tmp25 = tmp23 / tmp24
tmp26 = libdevice.sqrt(tmp25)
tmp27 = 1e-06
tmp28 = tmp26 + tmp27
tmp29 = tmp12 / tmp28
tmp31 = tmp29 + tmp30
tl.store(out_ptr0 + x2, tmp31, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11, primals_12,
primals_13, primals_14, primals_15, primals_16, primals_17, primals_18
) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4,), (1,))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 4), (4, 1))
assert_size_stride(primals_7, (4,), (1,))
assert_size_stride(primals_8, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_9, (4, 4), (4, 1))
assert_size_stride(primals_10, (4,), (1,))
assert_size_stride(primals_11, (4,), (1,))
assert_size_stride(primals_12, (4,), (1,))
assert_size_stride(primals_13, (128, 4), (4, 1))
assert_size_stride(primals_14, (128,), (1,))
assert_size_stride(primals_15, (4, 128), (128, 1))
assert_size_stride(primals_16, (4,), (1,))
assert_size_stride(primals_17, (4,), (1,))
assert_size_stride(primals_18, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_1, (16, 4), (4, 1), 0),
reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), out=buf0)
del primals_2
buf1 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_1, (16, 4), (4, 1), 0),
reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), out=buf1)
del primals_4
buf2 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_1, (16, 4), (4, 1), 0),
reinterpret_tensor(primals_6, (4, 4), (1, 4), 0), out=buf2)
del primals_6
buf3 = empty_strided_cuda((4, 4, 4, 1), (16, 4, 1, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_clone_0[grid(16, 4)](buf1, primals_5, buf3, 16, 4,
XBLOCK=2, YBLOCK=16, num_warps=1, num_stages=1)
del primals_5
buf4 = reinterpret_tensor(buf1, (4, 4, 1, 4), (16, 4, 4, 1), 0)
del buf1
triton_poi_fused_clone_0[grid(16, 4)](buf0, primals_3, buf4, 16, 4,
XBLOCK=2, YBLOCK=16, num_warps=1, num_stages=1)
del primals_3
buf5 = empty_strided_cuda((16, 4, 4), (16, 4, 1), torch.float32)
extern_kernels.bmm(reinterpret_tensor(buf3, (16, 4, 1), (4, 1, 0),
0), reinterpret_tensor(buf4, (16, 1, 4), (4, 0, 1), 0), out=buf5)
buf6 = empty_strided_cuda((4, 1, 4, 4), (16, 16, 4, 1), torch.bool)
triton_poi_fused_eq_1[grid(64)](primals_8, buf6, 64, XBLOCK=64,
num_warps=1, num_stages=1)
del primals_8
buf7 = reinterpret_tensor(buf0, (4, 4, 4, 1), (16, 4, 1, 64), 0)
del buf0
buf8 = empty_strided_cuda((4, 4, 4, 1), (16, 4, 1, 64), torch.float32)
triton_poi_fused__softmax_div_masked_fill_2[grid(64)](buf6, buf5,
buf7, buf8, 64, XBLOCK=64, num_warps=1, num_stages=1)
buf9 = reinterpret_tensor(buf5, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf5
triton_poi_fused__softmax_div_masked_fill_3[grid(256)](buf9, buf6,
buf7, buf8, 256, XBLOCK=128, num_warps=4, num_stages=1)
buf10 = reinterpret_tensor(buf8, (4, 4, 4, 1), (16, 4, 1, 1), 0)
del buf8
triton_poi_fused_clone_0[grid(16, 4)](buf2, primals_7, buf10, 16, 4,
XBLOCK=2, YBLOCK=16, num_warps=1, num_stages=1)
del primals_7
buf11 = reinterpret_tensor(buf2, (16, 4, 1), (4, 1, 1), 0)
del buf2
extern_kernels.bmm(reinterpret_tensor(buf9, (16, 4, 4), (16, 4, 1),
0), reinterpret_tensor(buf10, (16, 4, 1), (4, 1, 0), 0), out=buf11)
buf12 = reinterpret_tensor(buf7, (4, 4, 4, 1), (16, 4, 1, 1), 0)
del buf7
triton_poi_fused_clone_4[grid(16, 4)](buf11, buf12, 16, 4, XBLOCK=4,
YBLOCK=16, num_warps=1, num_stages=1)
buf13 = reinterpret_tensor(buf11, (16, 4), (4, 1), 0)
del buf11
extern_kernels.addmm(primals_10, reinterpret_tensor(buf12, (16, 4),
(4, 1), 0), reinterpret_tensor(primals_9, (4, 4), (1, 4), 0),
alpha=1, beta=1, out=buf13)
del primals_10
buf14 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
buf15 = empty_strided_cuda((4, 4, 1), (4, 1, 16), torch.float32)
buf16 = buf15
del buf15
triton_poi_fused_add_mean_std_5[grid(16)](buf16, primals_1, buf13,
buf14, 16, XBLOCK=16, num_warps=1, num_stages=1)
buf17 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
triton_poi_fused_add_div_mean_mul_std_sub_6[grid(64)](primals_11,
primals_1, buf13, buf14, buf16, primals_12, buf17, 64, XBLOCK=
64, num_warps=1, num_stages=1)
del buf14
del buf16
del primals_12
buf18 = empty_strided_cuda((16, 128), (128, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf17, (16, 4), (4, 1), 0),
reinterpret_tensor(primals_13, (4, 128), (1, 4), 0), out=buf18)
buf19 = reinterpret_tensor(buf18, (4, 4, 128), (512, 128, 1), 0)
del buf18
buf23 = empty_strided_cuda((4, 4, 128), (512, 128, 1), torch.bool)
triton_poi_fused_relu_threshold_backward_7[grid(2048)](buf19,
primals_14, buf23, 2048, XBLOCK=256, num_warps=4, num_stages=1)
del primals_14
buf20 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf19, (16, 128), (128, 1), 0),
reinterpret_tensor(primals_15, (128, 4), (1, 128), 0), out=buf20)
buf21 = reinterpret_tensor(buf20, (4, 4, 4), (16, 4, 1), 0)
del buf20
triton_poi_fused_add_8[grid(64)](buf21, buf17, primals_16, 64,
XBLOCK=64, num_warps=1, num_stages=1)
del primals_16
buf22 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
triton_poi_fused_add_div_mean_mul_std_sub_9[grid(64)](primals_17,
buf21, primals_18, buf22, 64, XBLOCK=64, num_warps=1, num_stages=1)
del primals_18
return (buf22, primals_1, primals_11, primals_17, buf6, buf9,
reinterpret_tensor(buf12, (16, 4), (4, 1), 0), buf13,
reinterpret_tensor(buf17, (16, 4), (4, 1), 0), reinterpret_tensor(
buf19, (16, 128), (128, 1), 0), buf21, primals_15, buf23,
primals_13, primals_9, reinterpret_tensor(buf10, (16, 1, 4), (4, 1,
1), 0), reinterpret_tensor(buf3, (16, 1, 4), (4, 1, 1), 0),
reinterpret_tensor(buf4, (16, 4, 1), (4, 1, 4), 0))
class FeedForward(nn.Module):
def __init__(self, d_model, d_ff=2048, dropout=0.1):
super().__init__()
self.linear_1 = nn.Linear(d_model, d_ff)
self.dropout = nn.Dropout(dropout)
self.linear_2 = nn.Linear(d_ff, d_model)
def forward(self, x):
x = self.dropout(F.relu(self.linear_1(x)))
x = self.linear_2(x)
return x
class MultiHeadAttention(nn.Module):
def __init__(self, heads, d_model, dropout=0.1):
super().__init__()
self.d_model = d_model
self.d_k = d_model // heads
self.h = heads
self.q_linear = nn.Linear(d_model, d_model)
self.v_linear = nn.Linear(d_model, d_model)
self.k_linear = nn.Linear(d_model, d_model)
self.dropout = nn.Dropout(dropout)
self.out = nn.Linear(d_model, d_model)
def _attention(self, q, k, v, d_k, mask=None, dropout=None):
scores = torch.matmul(q, k.transpose(-2, -1)) / math.sqrt(d_k)
if mask is not None:
mask = mask.unsqueeze(1)
scores = scores.masked_fill(mask == 0, -1000000000.0)
scores = F.softmax(scores, dim=-1)
if dropout is not None:
scores = dropout(scores)
output = torch.matmul(scores, v)
return output
def forward(self, q, k, v, mask=None):
bs = q.size(0)
k = self.k_linear(k).view(bs, -1, self.h, self.d_k)
q = self.q_linear(q).view(bs, -1, self.h, self.d_k)
v = self.v_linear(v).view(bs, -1, self.h, self.d_k)
k = k.transpose(1, 2)
q = q.transpose(1, 2)
v = v.transpose(1, 2)
scores = self._attention(q, k, v, self.d_k, mask, self.dropout)
concat = scores.transpose(1, 2).contiguous().view(bs, -1, self.d_model)
output = self.out(concat)
return output
class Norm(nn.Module):
def __init__(self, d_model, eps=1e-06):
super().__init__()
self.size = d_model
self.alpha = nn.Parameter(torch.ones(self.size))
self.bias = nn.Parameter(torch.zeros(self.size))
self.eps = eps
def forward(self, x):
norm = self.alpha * (x - x.mean(dim=-1, keepdim=True)) / (x.std(dim
=-1, keepdim=True) + self.eps) + self.bias
return norm
class EncoderLayerNew(nn.Module):
def __init__(self, d_model, heads, dropout=0.1):
super().__init__()
self.norm_1 = Norm(d_model)
self.norm_2 = Norm(d_model)
self.attn = MultiHeadAttention(heads, d_model, dropout=dropout)
self.ff = FeedForward(d_model, d_ff=d_model * 32, dropout=dropout)
self.dropout_1 = nn.Dropout(dropout)
self.dropout_2 = nn.Dropout(dropout)
def forward(self, input_0, input_1):
primals_3 = self.norm_1.alpha
primals_5 = self.norm_1.bias
primals_7 = self.norm_2.alpha
primals_10 = self.norm_2.bias
primals_2 = self.attn.q_linear.weight
primals_11 = self.attn.q_linear.bias
primals_4 = self.attn.v_linear.weight
primals_12 = self.attn.v_linear.bias
primals_6 = self.attn.k_linear.weight
primals_16 = self.attn.k_linear.bias
primals_9 = self.attn.out.weight
primals_17 = self.attn.out.bias
primals_13 = self.ff.linear_1.weight
primals_14 = self.ff.linear_1.bias
primals_15 = self.ff.linear_2.weight
primals_18 = self.ff.linear_2.bias
primals_1 = input_0
primals_8 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11, primals_12, primals_13, primals_14,
primals_15, primals_16, primals_17, primals_18])
return output[0]
|
CS-savvy/Transformer-for-Parkinsons-disease
|
EncoderLayer
| false | 2,104 |
[
"MIT"
] | 0 |
42ef54071092f4aab74c8b9ec82c52e944806a5b
|
https://github.com/CS-savvy/Transformer-for-Parkinsons-disease/tree/42ef54071092f4aab74c8b9ec82c52e944806a5b
|
Actor
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/6o/c6o7ainbzocsswla76yvmdsc5donraaar3dzlx2icwrueb7fc46u.py
# Topologically Sorted Source Nodes: [a], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# a => relu
# Graph fragment:
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_1,), kwargs = {})
# %le_1 : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_0 = async_compile.triton('triton_poi_fused_relu_threshold_backward_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16384],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16384
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 256
tmp0 = tl.load(in_out_ptr0 + (x2), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, None)
tl.store(out_ptr0 + (x2), tmp6, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/cp/ccp5m5apf7ka2skqyfxhf2df54c52qocprpycry7jrzoptyjvbti.py
# Topologically Sorted Source Nodes: [tanh, mul], Original ATen: [aten.tanh, aten.mul]
# Source node to ATen node mapping:
# mul => mul
# tanh => tanh
# Graph fragment:
# %tanh : [num_users=1] = call_function[target=torch.ops.aten.tanh.default](args = (%view_5,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%tanh, 4), kwargs = {})
triton_poi_fused_mul_tanh_1 = async_compile.triton('triton_poi_fused_mul_tanh_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mul_tanh_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mul_tanh_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = libdevice.tanh(tmp0)
tmp2 = 4.0
tmp3 = tmp1 * tmp2
tl.store(out_ptr0 + (x0), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7 = args
args.clear()
assert_size_stride(primals_1, (256, 4), (4, 1))
assert_size_stride(primals_2, (256, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (256, 256), (256, 1))
assert_size_stride(primals_5, (256, ), (1, ))
assert_size_stride(primals_6, (4, 256), (256, 1))
assert_size_stride(primals_7, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 256), (256, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 256), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 256), (4096, 1024, 256, 1), 0); del buf0 # reuse
buf7 = empty_strided_cuda((4, 4, 4, 256), (4096, 1024, 256, 1), torch.bool)
# Topologically Sorted Source Nodes: [a], Original ATen: [aten.relu, aten.threshold_backward]
stream0 = get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0.run(buf1, primals_2, buf7, 16384, grid=grid(16384), stream=stream0)
del primals_2
buf2 = empty_strided_cuda((64, 256), (256, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf1, (64, 256), (256, 1), 0), reinterpret_tensor(primals_4, (256, 256), (1, 256), 0), out=buf2)
buf3 = reinterpret_tensor(buf2, (4, 4, 4, 256), (4096, 1024, 256, 1), 0); del buf2 # reuse
buf6 = empty_strided_cuda((4, 4, 4, 256), (4096, 1024, 256, 1), torch.bool)
# Topologically Sorted Source Nodes: [a_1], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_0.run(buf3, primals_5, buf6, 16384, grid=grid(16384), stream=stream0)
del primals_5
buf4 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_7, reinterpret_tensor(buf3, (64, 256), (256, 1), 0), reinterpret_tensor(primals_6, (256, 4), (1, 256), 0), alpha=1, beta=1, out=buf4)
del primals_7
buf5 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [tanh, mul], Original ATen: [aten.tanh, aten.mul]
triton_poi_fused_mul_tanh_1.run(buf4, buf5, 256, grid=grid(256), stream=stream0)
return (buf5, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(buf1, (64, 256), (256, 1), 0), reinterpret_tensor(buf3, (64, 256), (256, 1), 0), buf4, primals_6, buf6, primals_4, buf7, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((256, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((256, 256), (256, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 256), (256, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class Actor(nn.Module):
def __init__(self, state_dim, action_dim, max_action):
super(Actor, self).__init__()
self.l1 = nn.Linear(state_dim, 256)
self.l2 = nn.Linear(256, 256)
self.l3 = nn.Linear(256, action_dim)
self.max_action = max_action
def forward(self, state):
a = F.relu(self.l1(state))
a = F.relu(self.l2(a))
return self.max_action * torch.tanh(self.l3(a))
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'state_dim': 4, 'action_dim': 4, 'max_action': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 256
tmp0 = tl.load(in_out_ptr0 + x2, None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, None)
tl.store(out_ptr0 + x2, tmp6, None)
@triton.jit
def triton_poi_fused_mul_tanh_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = libdevice.tanh(tmp0)
tmp2 = 4.0
tmp3 = tmp1 * tmp2
tl.store(out_ptr0 + x0, tmp3, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7) = args
args.clear()
assert_size_stride(primals_1, (256, 4), (4, 1))
assert_size_stride(primals_2, (256,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (256, 256), (256, 1))
assert_size_stride(primals_5, (256,), (1,))
assert_size_stride(primals_6, (4, 256), (256, 1))
assert_size_stride(primals_7, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 256), (256, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 256), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 256), (4096, 1024, 256, 1), 0
)
del buf0
buf7 = empty_strided_cuda((4, 4, 4, 256), (4096, 1024, 256, 1),
torch.bool)
get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0[grid(16384)](buf1,
primals_2, buf7, 16384, XBLOCK=128, num_warps=4, num_stages=1)
del primals_2
buf2 = empty_strided_cuda((64, 256), (256, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf1, (64, 256), (256, 1), 0),
reinterpret_tensor(primals_4, (256, 256), (1, 256), 0), out=buf2)
buf3 = reinterpret_tensor(buf2, (4, 4, 4, 256), (4096, 1024, 256, 1), 0
)
del buf2
buf6 = empty_strided_cuda((4, 4, 4, 256), (4096, 1024, 256, 1),
torch.bool)
triton_poi_fused_relu_threshold_backward_0[grid(16384)](buf3,
primals_5, buf6, 16384, XBLOCK=128, num_warps=4, num_stages=1)
del primals_5
buf4 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_7, reinterpret_tensor(buf3, (64, 256),
(256, 1), 0), reinterpret_tensor(primals_6, (256, 4), (1, 256),
0), alpha=1, beta=1, out=buf4)
del primals_7
buf5 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_mul_tanh_1[grid(256)](buf4, buf5, 256, XBLOCK=256,
num_warps=4, num_stages=1)
return buf5, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0
), reinterpret_tensor(buf1, (64, 256), (256, 1), 0
), reinterpret_tensor(buf3, (64, 256), (256, 1), 0
), buf4, primals_6, buf6, primals_4, buf7
class ActorNew(nn.Module):
def __init__(self, state_dim, action_dim, max_action):
super(ActorNew, self).__init__()
self.l1 = nn.Linear(state_dim, 256)
self.l2 = nn.Linear(256, 256)
self.l3 = nn.Linear(256, action_dim)
self.max_action = max_action
def forward(self, input_0):
primals_1 = self.l1.weight
primals_2 = self.l1.bias
primals_4 = self.l2.weight
primals_5 = self.l2.bias
primals_6 = self.l3.weight
primals_7 = self.l3.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7])
return output[0]
|
ChristianLin0420/DeepRL
|
Actor
| false | 2,105 |
[
"MIT"
] | 0 |
143a9bfebd264229d9d26fcdc070065225774e04
|
https://github.com/ChristianLin0420/DeepRL/tree/143a9bfebd264229d9d26fcdc070065225774e04
|
AlphaSlow
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/jw/cjw7ubja4hojpmayf27w3bnq2ce6edwzkqmmwo2yblsq6uncrvxt.py
# Topologically Sorted Source Nodes: [outputs], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# outputs => relu
# Graph fragment:
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_1,), kwargs = {})
# %le_7 : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_0 = async_compile.triton('triton_poi_fused_relu_threshold_backward_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[32768],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 20480
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 320
tmp0 = tl.load(in_out_ptr0 + (x2), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, None)
tl.store(out_ptr0 + (x2), tmp6, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/yg/cyg4mfxxegclwowpan5hfbi5qulziofwhyotfohv246hvg36ojqn.py
# Topologically Sorted Source Nodes: [outputs_1], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# outputs_1 => relu_1
# Graph fragment:
# %relu_1 : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_3,), kwargs = {})
# %le_6 : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu_1, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_1 = async_compile.triton('triton_poi_fused_relu_threshold_backward_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16384],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_1(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 10240
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 160
tmp0 = tl.load(in_out_ptr0 + (x2), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, None)
tl.store(out_ptr0 + (x2), tmp6, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/z4/cz4tjpvurjo2r2cyp2achmcvotna3ey4qf4yvebadrzvthluvtq2.py
# Topologically Sorted Source Nodes: [outputs_2], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# outputs_2 => relu_2
# Graph fragment:
# %relu_2 : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_5,), kwargs = {})
# %le_5 : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu_2, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_2 = async_compile.triton('triton_poi_fused_relu_threshold_backward_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[8192],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_2', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_2(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 5120
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 80
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
tl.store(out_ptr0 + (x2), tmp6, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/sm/csmouvkzhmoguab22cjnqcceaqv67wzl3bkblgzlihakomk7mftz.py
# Topologically Sorted Source Nodes: [outputs_4], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# outputs_4 => relu_4
# Graph fragment:
# %relu_4 : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_9,), kwargs = {})
# %le_3 : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu_4, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_3 = async_compile.triton('triton_poi_fused_relu_threshold_backward_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4096],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_3', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_3(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 2560
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 40
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
tl.store(out_ptr0 + (x2), tmp6, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/jd/cjdxbf6cfv7vtxvqebjbswxanlnwz7xlcjnubgimanjsio6scviu.py
# Topologically Sorted Source Nodes: [outputs_6], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# outputs_6 => relu_6
# Graph fragment:
# %relu_6 : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%view_13,), kwargs = {})
# %le_1 : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu_6, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_4 = async_compile.triton('triton_poi_fused_relu_threshold_backward_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[2048],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_4', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_4(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1280
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 20
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
tl.store(out_ptr0 + (x2), tmp6, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/2r/c2rwtdtumv5l7idkpiu2upl3c7h56kqfajqp52padvrqleaj5qfy.py
# Topologically Sorted Source Nodes: [outputs_8], Original ATen: [aten.tanh]
# Source node to ATen node mapping:
# outputs_8 => tanh
# Graph fragment:
# %tanh : [num_users=1] = call_function[target=torch.ops.aten.tanh.default](args = (%view_17,), kwargs = {})
triton_poi_fused_tanh_5 = async_compile.triton('triton_poi_fused_tanh_5', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_tanh_5', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_tanh_5(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = libdevice.tanh(tmp2)
tl.store(in_out_ptr0 + (x2), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15, primals_16, primals_17, primals_18, primals_19 = args
args.clear()
assert_size_stride(primals_1, (320, 4), (4, 1))
assert_size_stride(primals_2, (320, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (160, 320), (320, 1))
assert_size_stride(primals_5, (160, ), (1, ))
assert_size_stride(primals_6, (80, 160), (160, 1))
assert_size_stride(primals_7, (80, ), (1, ))
assert_size_stride(primals_8, (80, 80), (80, 1))
assert_size_stride(primals_9, (80, ), (1, ))
assert_size_stride(primals_10, (40, 80), (80, 1))
assert_size_stride(primals_11, (40, ), (1, ))
assert_size_stride(primals_12, (40, 40), (40, 1))
assert_size_stride(primals_13, (40, ), (1, ))
assert_size_stride(primals_14, (20, 40), (40, 1))
assert_size_stride(primals_15, (20, ), (1, ))
assert_size_stride(primals_16, (20, 20), (20, 1))
assert_size_stride(primals_17, (20, ), (1, ))
assert_size_stride(primals_18, (4, 20), (20, 1))
assert_size_stride(primals_19, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 320), (320, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 320), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 320), (5120, 1280, 320, 1), 0); del buf0 # reuse
buf25 = empty_strided_cuda((4, 4, 4, 320), (5120, 1280, 320, 1), torch.bool)
# Topologically Sorted Source Nodes: [outputs], Original ATen: [aten.relu, aten.threshold_backward]
stream0 = get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0.run(buf1, primals_2, buf25, 20480, grid=grid(20480), stream=stream0)
del primals_2
buf2 = empty_strided_cuda((64, 160), (160, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf1, (64, 320), (320, 1), 0), reinterpret_tensor(primals_4, (320, 160), (1, 320), 0), out=buf2)
buf3 = reinterpret_tensor(buf2, (4, 4, 4, 160), (2560, 640, 160, 1), 0); del buf2 # reuse
buf24 = empty_strided_cuda((4, 4, 4, 160), (2560, 640, 160, 1), torch.bool)
# Topologically Sorted Source Nodes: [outputs_1], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_1.run(buf3, primals_5, buf24, 10240, grid=grid(10240), stream=stream0)
del primals_5
buf4 = empty_strided_cuda((64, 80), (80, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf3, (64, 160), (160, 1), 0), reinterpret_tensor(primals_6, (160, 80), (1, 160), 0), out=buf4)
buf5 = reinterpret_tensor(buf4, (4, 4, 4, 80), (1280, 320, 80, 1), 0); del buf4 # reuse
buf23 = empty_strided_cuda((4, 4, 4, 80), (1280, 320, 80, 1), torch.bool)
# Topologically Sorted Source Nodes: [outputs_2], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_2.run(buf5, primals_7, buf23, 5120, grid=grid(5120), stream=stream0)
del primals_7
buf6 = empty_strided_cuda((64, 80), (80, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf5, (64, 80), (80, 1), 0), reinterpret_tensor(primals_8, (80, 80), (1, 80), 0), out=buf6)
buf7 = reinterpret_tensor(buf6, (4, 4, 4, 80), (1280, 320, 80, 1), 0); del buf6 # reuse
buf22 = empty_strided_cuda((4, 4, 4, 80), (1280, 320, 80, 1), torch.bool)
# Topologically Sorted Source Nodes: [outputs_3], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_2.run(buf7, primals_9, buf22, 5120, grid=grid(5120), stream=stream0)
del primals_9
buf8 = empty_strided_cuda((64, 40), (40, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf7, (64, 80), (80, 1), 0), reinterpret_tensor(primals_10, (80, 40), (1, 80), 0), out=buf8)
buf9 = reinterpret_tensor(buf8, (4, 4, 4, 40), (640, 160, 40, 1), 0); del buf8 # reuse
buf21 = empty_strided_cuda((4, 4, 4, 40), (640, 160, 40, 1), torch.bool)
# Topologically Sorted Source Nodes: [outputs_4], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_3.run(buf9, primals_11, buf21, 2560, grid=grid(2560), stream=stream0)
del primals_11
buf10 = empty_strided_cuda((64, 40), (40, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf9, (64, 40), (40, 1), 0), reinterpret_tensor(primals_12, (40, 40), (1, 40), 0), out=buf10)
buf11 = reinterpret_tensor(buf10, (4, 4, 4, 40), (640, 160, 40, 1), 0); del buf10 # reuse
buf20 = empty_strided_cuda((4, 4, 4, 40), (640, 160, 40, 1), torch.bool)
# Topologically Sorted Source Nodes: [outputs_5], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_3.run(buf11, primals_13, buf20, 2560, grid=grid(2560), stream=stream0)
del primals_13
buf12 = empty_strided_cuda((64, 20), (20, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf11, (64, 40), (40, 1), 0), reinterpret_tensor(primals_14, (40, 20), (1, 40), 0), out=buf12)
buf13 = reinterpret_tensor(buf12, (4, 4, 4, 20), (320, 80, 20, 1), 0); del buf12 # reuse
buf19 = empty_strided_cuda((4, 4, 4, 20), (320, 80, 20, 1), torch.bool)
# Topologically Sorted Source Nodes: [outputs_6], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_4.run(buf13, primals_15, buf19, 1280, grid=grid(1280), stream=stream0)
del primals_15
buf14 = empty_strided_cuda((64, 20), (20, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf13, (64, 20), (20, 1), 0), reinterpret_tensor(primals_16, (20, 20), (1, 20), 0), out=buf14)
buf15 = reinterpret_tensor(buf14, (4, 4, 4, 20), (320, 80, 20, 1), 0); del buf14 # reuse
buf18 = empty_strided_cuda((4, 4, 4, 20), (320, 80, 20, 1), torch.bool)
# Topologically Sorted Source Nodes: [outputs_7], Original ATen: [aten.relu, aten.threshold_backward]
triton_poi_fused_relu_threshold_backward_4.run(buf15, primals_17, buf18, 1280, grid=grid(1280), stream=stream0)
del primals_17
buf16 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf15, (64, 20), (20, 1), 0), reinterpret_tensor(primals_18, (20, 4), (1, 20), 0), out=buf16)
buf17 = reinterpret_tensor(buf16, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf16 # reuse
# Topologically Sorted Source Nodes: [outputs_8], Original ATen: [aten.tanh]
triton_poi_fused_tanh_5.run(buf17, primals_19, 256, grid=grid(256), stream=stream0)
del primals_19
return (buf17, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(buf1, (64, 320), (320, 1), 0), reinterpret_tensor(buf3, (64, 160), (160, 1), 0), reinterpret_tensor(buf5, (64, 80), (80, 1), 0), reinterpret_tensor(buf7, (64, 80), (80, 1), 0), reinterpret_tensor(buf9, (64, 40), (40, 1), 0), reinterpret_tensor(buf11, (64, 40), (40, 1), 0), reinterpret_tensor(buf13, (64, 20), (20, 1), 0), reinterpret_tensor(buf15, (64, 20), (20, 1), 0), buf17, primals_18, buf18, primals_16, buf19, primals_14, buf20, primals_12, buf21, primals_10, buf22, primals_8, buf23, primals_6, buf24, primals_4, buf25, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((320, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((320, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((160, 320), (320, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((160, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((80, 160), (160, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((80, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((80, 80), (80, 1), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((80, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((40, 80), (80, 1), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((40, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_12 = rand_strided((40, 40), (40, 1), device='cuda:0', dtype=torch.float32)
primals_13 = rand_strided((40, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_14 = rand_strided((20, 40), (40, 1), device='cuda:0', dtype=torch.float32)
primals_15 = rand_strided((20, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_16 = rand_strided((20, 20), (20, 1), device='cuda:0', dtype=torch.float32)
primals_17 = rand_strided((20, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_18 = rand_strided((4, 20), (20, 1), device='cuda:0', dtype=torch.float32)
primals_19 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14, primals_15, primals_16, primals_17, primals_18, primals_19])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class AlphaSlow(nn.Module):
def __init__(self, n_in, n_out):
super(AlphaSlow, self).__init__()
self.fc1 = nn.Linear(n_in, 320, bias=True)
self.fc2 = nn.Linear(320, 160, bias=True)
self.fc3 = nn.Linear(160, 80, bias=True)
self.fc4 = nn.Linear(80, 80, bias=True)
self.fc5 = nn.Linear(80, 40, bias=True)
self.fc6 = nn.Linear(40, 40, bias=True)
self.fc7 = nn.Linear(40, 20, bias=True)
self.fc8 = nn.Linear(20, 20, bias=True)
self.fc9 = nn.Linear(20, n_out, bias=True)
self.sigmoid = nn.Sigmoid()
self.Tanh = nn.Tanh()
self.ReLU = nn.ReLU()
def forward(self, inputs):
outputs = self.ReLU(self.fc1(inputs))
outputs = self.ReLU(self.fc2(outputs))
outputs = self.ReLU(self.fc3(outputs))
outputs = self.ReLU(self.fc4(outputs))
outputs = self.ReLU(self.fc5(outputs))
outputs = self.ReLU(self.fc6(outputs))
outputs = self.ReLU(self.fc7(outputs))
outputs = self.ReLU(self.fc8(outputs))
outputs = self.Tanh(self.fc9(outputs))
return outputs
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'n_in': 4, 'n_out': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 320
tmp0 = tl.load(in_out_ptr0 + x2, None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, None)
tl.store(out_ptr0 + x2, tmp6, None)
@triton.jit
def triton_poi_fused_relu_threshold_backward_1(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 160
tmp0 = tl.load(in_out_ptr0 + x2, None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, None)
tl.store(out_ptr0 + x2, tmp6, None)
@triton.jit
def triton_poi_fused_relu_threshold_backward_2(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 5120
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 80
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, xmask)
tl.store(out_ptr0 + x2, tmp6, xmask)
@triton.jit
def triton_poi_fused_relu_threshold_backward_3(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 2560
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 40
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, xmask)
tl.store(out_ptr0 + x2, tmp6, xmask)
@triton.jit
def triton_poi_fused_relu_threshold_backward_4(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 1280
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 20
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, xmask)
tl.store(out_ptr0 + x2, tmp6, xmask)
@triton.jit
def triton_poi_fused_tanh_5(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = libdevice.tanh(tmp2)
tl.store(in_out_ptr0 + x2, tmp3, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11, primals_12,
primals_13, primals_14, primals_15, primals_16, primals_17,
primals_18, primals_19) = args
args.clear()
assert_size_stride(primals_1, (320, 4), (4, 1))
assert_size_stride(primals_2, (320,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (160, 320), (320, 1))
assert_size_stride(primals_5, (160,), (1,))
assert_size_stride(primals_6, (80, 160), (160, 1))
assert_size_stride(primals_7, (80,), (1,))
assert_size_stride(primals_8, (80, 80), (80, 1))
assert_size_stride(primals_9, (80,), (1,))
assert_size_stride(primals_10, (40, 80), (80, 1))
assert_size_stride(primals_11, (40,), (1,))
assert_size_stride(primals_12, (40, 40), (40, 1))
assert_size_stride(primals_13, (40,), (1,))
assert_size_stride(primals_14, (20, 40), (40, 1))
assert_size_stride(primals_15, (20,), (1,))
assert_size_stride(primals_16, (20, 20), (20, 1))
assert_size_stride(primals_17, (20,), (1,))
assert_size_stride(primals_18, (4, 20), (20, 1))
assert_size_stride(primals_19, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 320), (320, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 320), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 320), (5120, 1280, 320, 1), 0
)
del buf0
buf25 = empty_strided_cuda((4, 4, 4, 320), (5120, 1280, 320, 1),
torch.bool)
get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0[grid(20480)](buf1,
primals_2, buf25, 20480, XBLOCK=128, num_warps=4, num_stages=1)
del primals_2
buf2 = empty_strided_cuda((64, 160), (160, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf1, (64, 320), (320, 1), 0),
reinterpret_tensor(primals_4, (320, 160), (1, 320), 0), out=buf2)
buf3 = reinterpret_tensor(buf2, (4, 4, 4, 160), (2560, 640, 160, 1), 0)
del buf2
buf24 = empty_strided_cuda((4, 4, 4, 160), (2560, 640, 160, 1),
torch.bool)
triton_poi_fused_relu_threshold_backward_1[grid(10240)](buf3,
primals_5, buf24, 10240, XBLOCK=256, num_warps=4, num_stages=1)
del primals_5
buf4 = empty_strided_cuda((64, 80), (80, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf3, (64, 160), (160, 1), 0),
reinterpret_tensor(primals_6, (160, 80), (1, 160), 0), out=buf4)
buf5 = reinterpret_tensor(buf4, (4, 4, 4, 80), (1280, 320, 80, 1), 0)
del buf4
buf23 = empty_strided_cuda((4, 4, 4, 80), (1280, 320, 80, 1), torch
.bool)
triton_poi_fused_relu_threshold_backward_2[grid(5120)](buf5,
primals_7, buf23, 5120, XBLOCK=256, num_warps=4, num_stages=1)
del primals_7
buf6 = empty_strided_cuda((64, 80), (80, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf5, (64, 80), (80, 1), 0),
reinterpret_tensor(primals_8, (80, 80), (1, 80), 0), out=buf6)
buf7 = reinterpret_tensor(buf6, (4, 4, 4, 80), (1280, 320, 80, 1), 0)
del buf6
buf22 = empty_strided_cuda((4, 4, 4, 80), (1280, 320, 80, 1), torch
.bool)
triton_poi_fused_relu_threshold_backward_2[grid(5120)](buf7,
primals_9, buf22, 5120, XBLOCK=256, num_warps=4, num_stages=1)
del primals_9
buf8 = empty_strided_cuda((64, 40), (40, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf7, (64, 80), (80, 1), 0),
reinterpret_tensor(primals_10, (80, 40), (1, 80), 0), out=buf8)
buf9 = reinterpret_tensor(buf8, (4, 4, 4, 40), (640, 160, 40, 1), 0)
del buf8
buf21 = empty_strided_cuda((4, 4, 4, 40), (640, 160, 40, 1), torch.bool
)
triton_poi_fused_relu_threshold_backward_3[grid(2560)](buf9,
primals_11, buf21, 2560, XBLOCK=256, num_warps=4, num_stages=1)
del primals_11
buf10 = empty_strided_cuda((64, 40), (40, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf9, (64, 40), (40, 1), 0),
reinterpret_tensor(primals_12, (40, 40), (1, 40), 0), out=buf10)
buf11 = reinterpret_tensor(buf10, (4, 4, 4, 40), (640, 160, 40, 1), 0)
del buf10
buf20 = empty_strided_cuda((4, 4, 4, 40), (640, 160, 40, 1), torch.bool
)
triton_poi_fused_relu_threshold_backward_3[grid(2560)](buf11,
primals_13, buf20, 2560, XBLOCK=256, num_warps=4, num_stages=1)
del primals_13
buf12 = empty_strided_cuda((64, 20), (20, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf11, (64, 40), (40, 1), 0),
reinterpret_tensor(primals_14, (40, 20), (1, 40), 0), out=buf12)
buf13 = reinterpret_tensor(buf12, (4, 4, 4, 20), (320, 80, 20, 1), 0)
del buf12
buf19 = empty_strided_cuda((4, 4, 4, 20), (320, 80, 20, 1), torch.bool)
triton_poi_fused_relu_threshold_backward_4[grid(1280)](buf13,
primals_15, buf19, 1280, XBLOCK=256, num_warps=4, num_stages=1)
del primals_15
buf14 = empty_strided_cuda((64, 20), (20, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf13, (64, 20), (20, 1), 0),
reinterpret_tensor(primals_16, (20, 20), (1, 20), 0), out=buf14)
buf15 = reinterpret_tensor(buf14, (4, 4, 4, 20), (320, 80, 20, 1), 0)
del buf14
buf18 = empty_strided_cuda((4, 4, 4, 20), (320, 80, 20, 1), torch.bool)
triton_poi_fused_relu_threshold_backward_4[grid(1280)](buf15,
primals_17, buf18, 1280, XBLOCK=256, num_warps=4, num_stages=1)
del primals_17
buf16 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf15, (64, 20), (20, 1), 0),
reinterpret_tensor(primals_18, (20, 4), (1, 20), 0), out=buf16)
buf17 = reinterpret_tensor(buf16, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf16
triton_poi_fused_tanh_5[grid(256)](buf17, primals_19, 256, XBLOCK=
256, num_warps=4, num_stages=1)
del primals_19
return (buf17, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(buf1, (64, 320), (320, 1), 0),
reinterpret_tensor(buf3, (64, 160), (160, 1), 0),
reinterpret_tensor(buf5, (64, 80), (80, 1), 0), reinterpret_tensor(
buf7, (64, 80), (80, 1), 0), reinterpret_tensor(buf9, (64, 40), (40,
1), 0), reinterpret_tensor(buf11, (64, 40), (40, 1), 0),
reinterpret_tensor(buf13, (64, 20), (20, 1), 0), reinterpret_tensor
(buf15, (64, 20), (20, 1), 0), buf17, primals_18, buf18, primals_16,
buf19, primals_14, buf20, primals_12, buf21, primals_10, buf22,
primals_8, buf23, primals_6, buf24, primals_4, buf25)
class AlphaSlowNew(nn.Module):
def __init__(self, n_in, n_out):
super(AlphaSlowNew, self).__init__()
self.fc1 = nn.Linear(n_in, 320, bias=True)
self.fc2 = nn.Linear(320, 160, bias=True)
self.fc3 = nn.Linear(160, 80, bias=True)
self.fc4 = nn.Linear(80, 80, bias=True)
self.fc5 = nn.Linear(80, 40, bias=True)
self.fc6 = nn.Linear(40, 40, bias=True)
self.fc7 = nn.Linear(40, 20, bias=True)
self.fc8 = nn.Linear(20, 20, bias=True)
self.fc9 = nn.Linear(20, n_out, bias=True)
self.sigmoid = nn.Sigmoid()
self.Tanh = nn.Tanh()
self.ReLU = nn.ReLU()
def forward(self, input_0):
primals_1 = self.fc1.weight
primals_2 = self.fc1.bias
primals_4 = self.fc2.weight
primals_5 = self.fc2.bias
primals_6 = self.fc3.weight
primals_7 = self.fc3.bias
primals_8 = self.fc4.weight
primals_9 = self.fc4.bias
primals_10 = self.fc5.weight
primals_11 = self.fc5.bias
primals_12 = self.fc6.weight
primals_13 = self.fc6.bias
primals_14 = self.fc7.weight
primals_15 = self.fc7.bias
primals_16 = self.fc8.weight
primals_17 = self.fc8.bias
primals_18 = self.fc9.weight
primals_19 = self.fc9.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11, primals_12, primals_13, primals_14,
primals_15, primals_16, primals_17, primals_18, primals_19])
return output[0]
|
CerberusLatrans/AlphaSlow
|
AlphaSlow
| false | 2,106 |
[
"MIT"
] | 0 |
6a65fabec2c87b85a8e496cb63f5cad9bc15cee0
|
https://github.com/CerberusLatrans/AlphaSlow/tree/6a65fabec2c87b85a8e496cb63f5cad9bc15cee0
|
L2Norm
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/fh/cfhnguw4v6uy4ysjg54ojclakwi3bj2lte6oqizl4rpf4lcxpiyp.py
# Topologically Sorted Source Nodes: [normalize], Original ATen: [aten.div]
# Source node to ATen node mapping:
# normalize => div
# Graph fragment:
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%arg0_1, %expand), kwargs = {})
triton_poi_fused_div_0 = async_compile.triton('triton_poi_fused_div_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_div_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_div_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tmp1 * tmp1
tmp4 = tmp3 * tmp3
tmp5 = tmp2 + tmp4
tmp7 = tmp6 * tmp6
tmp8 = tmp5 + tmp7
tmp10 = tmp9 * tmp9
tmp11 = tmp8 + tmp10
tmp12 = libdevice.sqrt(tmp11)
tmp13 = 1e-12
tmp14 = triton_helpers.maximum(tmp12, tmp13)
tmp15 = tmp0 / tmp14
tl.store(out_ptr0 + (x3), tmp15, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [normalize], Original ATen: [aten.div]
stream0 = get_raw_stream(0)
triton_poi_fused_div_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
from torch.nn import Module
import torch
import torch.nn.functional as F
class L2Norm(Module):
def forward(self, input):
return F.normalize(input)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice
from torch.nn import Module
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_div_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp9 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tmp1 * tmp1
tmp4 = tmp3 * tmp3
tmp5 = tmp2 + tmp4
tmp7 = tmp6 * tmp6
tmp8 = tmp5 + tmp7
tmp10 = tmp9 * tmp9
tmp11 = tmp8 + tmp10
tmp12 = libdevice.sqrt(tmp11)
tmp13 = 1e-12
tmp14 = triton_helpers.maximum(tmp12, tmp13)
tmp15 = tmp0 / tmp14
tl.store(out_ptr0 + x3, tmp15, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_div_0[grid(256)](arg0_1, buf0, 256, XBLOCK=256,
num_warps=4, num_stages=1)
del arg0_1
return buf0,
class L2NormNew(Module):
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
CodeLogist/Anti-Spoof_Face_recognitionV2
|
L2Norm
| false | 2,107 |
[
"MIT"
] | 0 |
ca2738f3d07442ffca92e76002ea24b26da39517
|
https://github.com/CodeLogist/Anti-Spoof_Face_recognitionV2/tree/ca2738f3d07442ffca92e76002ea24b26da39517
|
PCA_layer
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/qk/cqkc4sxt6vouie4anl4occwj2nuj2gl323feexsmp2cssxpzhtpt.py
# Topologically Sorted Source Nodes: [linalg_norm, pow_1, mul], Original ATen: [aten.linalg_vector_norm, aten.pow, aten.mul]
# Source node to ATen node mapping:
# linalg_norm => pow_1, pow_2, sum_1
# mul => mul
# pow_1 => pow_3
# Graph fragment:
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%arg0_1, 2), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%pow_1, [0, 1]), kwargs = {})
# %pow_2 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sum_1, 0.5), kwargs = {})
# %pow_3 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%pow_2, 2), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%pow_3, 0.25), kwargs = {})
triton_per_fused_linalg_vector_norm_mul_pow_0 = async_compile.triton('triton_per_fused_linalg_vector_norm_mul_pow_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 16],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {2: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 3), equal_to_1=(2,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_linalg_vector_norm_mul_pow_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_linalg_vector_norm_mul_pow_0(in_out_ptr0, in_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 1
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tmp0 * tmp0
tmp2 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp4 = tl.sum(tmp2, 1)[:, None]
tmp5 = libdevice.sqrt(tmp4)
tmp6 = tmp5 * tmp5
tmp7 = 0.25
tmp8 = tmp6 * tmp7
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([XBLOCK, 1], 0, tl.int32)), tmp8, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4), (4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [linalg_norm, pow_1, mul], Original ATen: [aten.linalg_vector_norm, aten.pow, aten.mul]
stream0 = get_raw_stream(0)
triton_per_fused_linalg_vector_norm_mul_pow_0.run(buf1, arg0_1, 1, 16, grid=grid(1), stream=stream0)
del arg0_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
class PCA_layer(torch.nn.Module):
def __init__(self, n_pc=2):
"""
Compute u^T S u as the optimization problem of PCA.
Arguments:
p: original dataset feature dimension
n_pc: number of principal components or dimension of projected space,
defaulted to be 2
"""
super().__init__()
def forward(self, XV):
"""
XV: X @ V, where V is the orthornormal column matrix
"""
n = XV.shape[0]
return 1 / n * torch.pow(torch.linalg.norm(XV, 'fro'), 2)
def get_inputs():
return [torch.rand([4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_linalg_vector_norm_mul_pow_0(in_out_ptr0, in_ptr0,
xnumel, rnumel, XBLOCK: tl.constexpr):
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xoffset + tl.arange(0, XBLOCK)[:, None]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tmp0 * tmp0
tmp2 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp4 = tl.sum(tmp2, 1)[:, None]
tmp5 = libdevice.sqrt(tmp4)
tmp6 = tmp5 * tmp5
tmp7 = 0.25
tmp8 = tmp6 * tmp7
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([XBLOCK, 1], 0, tl.int32), tmp8, None)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4), (4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_linalg_vector_norm_mul_pow_0[grid(1)](buf1, arg0_1,
1, 16, XBLOCK=1, num_warps=2, num_stages=1)
del arg0_1
return buf1,
class PCA_layerNew(torch.nn.Module):
def __init__(self, n_pc=2):
"""
Compute u^T S u as the optimization problem of PCA.
Arguments:
p: original dataset feature dimension
n_pc: number of principal components or dimension of projected space,
defaulted to be 2
"""
super().__init__()
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
CompTop/Interleaving-DR
|
PCA_layer
| false | 2,108 |
[
"MIT"
] | 0 |
479c190d9a9315038348cec115793258f067b1ca
|
https://github.com/CompTop/Interleaving-DR/tree/479c190d9a9315038348cec115793258f067b1ca
|
PointerSwitch
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/c4/cc4khg7fwbxxm2fufox7nnkf4gfybrmj5ir2tx3zuxfioc5b2dya.py
# Topologically Sorted Source Nodes: [cat], Original ATen: [aten.cat]
# Source node to ATen node mapping:
# cat => cat
# Graph fragment:
# %cat : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%primals_1, %primals_2], -1), kwargs = {})
triton_poi_fused_cat_0 = async_compile.triton('triton_poi_fused_cat_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[512],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 512
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 8
x1 = (xindex // 8)
x2 = xindex
tmp0 = x0
tmp1 = tl.full([1], 0, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + ((4*x1) + x0), tmp4 & xmask, eviction_policy='evict_last', other=0.0)
tmp6 = tmp0 >= tmp3
tmp7 = tl.full([1], 8, tl.int64)
tmp8 = tmp0 < tmp7
tmp9 = tl.load(in_ptr1 + ((4*x1) + ((-4) + x0)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp10 = tl.where(tmp4, tmp5, tmp9)
tl.store(out_ptr0 + (x2), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/7z/c7zsuucunqdovb2xa6tywxjxwmolzjzdk72ratro7fi3qvgyqb7c.py
# Topologically Sorted Source Nodes: [sigmoid], Original ATen: [aten.sigmoid]
# Source node to ATen node mapping:
# sigmoid => sigmoid
# Graph fragment:
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%view_1,), kwargs = {})
triton_poi_fused_sigmoid_1 = async_compile.triton('triton_poi_fused_sigmoid_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_sigmoid_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_sigmoid_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + (x0), xmask)
tmp1 = tl.load(in_ptr0 + (0))
tmp2 = tl.broadcast_to(tmp1, [XBLOCK])
tmp3 = tmp0 + tmp2
tmp4 = tl.sigmoid(tmp3)
tl.store(in_out_ptr0 + (x0), tmp4, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_3, (1, 8), (8, 1))
assert_size_stride(primals_4, (1, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 8), (128, 32, 8, 1), torch.float32)
# Topologically Sorted Source Nodes: [cat], Original ATen: [aten.cat]
stream0 = get_raw_stream(0)
triton_poi_fused_cat_0.run(primals_1, primals_2, buf0, 512, grid=grid(512), stream=stream0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((64, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(buf0, (64, 8), (8, 1), 0), reinterpret_tensor(primals_3, (8, 1), (1, 8), 0), out=buf1)
del primals_3
buf2 = reinterpret_tensor(buf1, (4, 4, 4, 1), (16, 4, 1, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [sigmoid], Original ATen: [aten.sigmoid]
triton_poi_fused_sigmoid_1.run(buf2, primals_4, 64, grid=grid(64), stream=stream0)
del primals_4
return (buf2, reinterpret_tensor(buf0, (64, 8), (8, 1), 0), buf2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((1, 8), (8, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((1, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class Linear(nn.Linear):
"""
Apply linear projection to the last dimention of a tensor.
"""
def forward(self, x):
size = x.size()
return super().forward(x.contiguous().view(-1, size[-1])).view(*
size[:-1], -1)
class ConcatAndProject(nn.Module):
def __init__(self, input_dim, output_dim, dropout, activation=None,
bias=True):
super().__init__()
self.input_dropout = nn.Dropout(dropout)
self.linear1 = Linear(input_dim, output_dim, bias=bias)
self.activation = activation
def forward(self, *args):
input = self.input_dropout(torch.cat(args, dim=-1))
if self.activation is None:
return self.linear1(input)
else:
return getattr(torch, self.activation)(self.linear1(input))
class PointerSwitch(nn.Module):
def __init__(self, query_dim, key_dim, input_dropout):
super().__init__()
self.project = ConcatAndProject(query_dim + key_dim, 1,
input_dropout, activation=None)
def forward(self, query, key):
return torch.sigmoid(self.project(query, key))
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'query_dim': 4, 'key_dim': 4, 'input_dropout': 0.5}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_cat_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 512
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 8
x1 = xindex // 8
x2 = xindex
tmp0 = x0
tl.full([1], 0, tl.int64)
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + (4 * x1 + x0), tmp4 & xmask, eviction_policy=
'evict_last', other=0.0)
tmp6 = tmp0 >= tmp3
tl.full([1], 8, tl.int64)
tmp9 = tl.load(in_ptr1 + (4 * x1 + (-4 + x0)), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp10 = tl.where(tmp4, tmp5, tmp9)
tl.store(out_ptr0 + x2, tmp10, xmask)
@triton.jit
def triton_poi_fused_sigmoid_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + x0, xmask)
tmp1 = tl.load(in_ptr0 + 0)
tmp2 = tl.broadcast_to(tmp1, [XBLOCK])
tmp3 = tmp0 + tmp2
tmp4 = tl.sigmoid(tmp3)
tl.store(in_out_ptr0 + x0, tmp4, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_3, (1, 8), (8, 1))
assert_size_stride(primals_4, (1,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 8), (128, 32, 8, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_cat_0[grid(512)](primals_1, primals_2, buf0, 512,
XBLOCK=256, num_warps=4, num_stages=1)
del primals_1
del primals_2
buf1 = empty_strided_cuda((64, 1), (1, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf0, (64, 8), (8, 1), 0),
reinterpret_tensor(primals_3, (8, 1), (1, 8), 0), out=buf1)
del primals_3
buf2 = reinterpret_tensor(buf1, (4, 4, 4, 1), (16, 4, 1, 1), 0)
del buf1
triton_poi_fused_sigmoid_1[grid(64)](buf2, primals_4, 64, XBLOCK=64,
num_warps=1, num_stages=1)
del primals_4
return buf2, reinterpret_tensor(buf0, (64, 8), (8, 1), 0), buf2
class Linear(nn.Linear):
"""
Apply linear projection to the last dimention of a tensor.
"""
def forward(self, x):
size = x.size()
return super().forward(x.contiguous().view(-1, size[-1])).view(*
size[:-1], -1)
class ConcatAndProject(nn.Module):
def __init__(self, input_dim, output_dim, dropout, activation=None,
bias=True):
super().__init__()
self.input_dropout = nn.Dropout(dropout)
self.linear1 = Linear(input_dim, output_dim, bias=bias)
self.activation = activation
def forward(self, *args):
input = self.input_dropout(torch.cat(args, dim=-1))
if self.activation is None:
return self.linear1(input)
else:
return getattr(torch, self.activation)(self.linear1(input))
class PointerSwitchNew(nn.Module):
def __init__(self, query_dim, key_dim, input_dropout):
super().__init__()
self.project = ConcatAndProject(query_dim + key_dim, 1,
input_dropout, activation=None)
def forward(self, input_0, input_1):
primals_3 = self.project.linear1.weight
primals_4 = self.project.linear1.bias
primals_1 = input_0
primals_2 = input_1
output = call([primals_1, primals_2, primals_3, primals_4])
return output[0]
|
CrafterKolyan/TabularSemanticParsing
|
PointerSwitch
| false | 2,109 |
[
"BSD-3-Clause"
] | 0 |
2d75a3b71fa4c58f2c14ac43a33916747e8f4d1f
|
https://github.com/CrafterKolyan/TabularSemanticParsing/tree/2d75a3b71fa4c58f2c14ac43a33916747e8f4d1f
|
Critic
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ms/cmsuzohbg5nq52jnvirovzkvykrzzko5xomu7zyu5e5u2lhegppw.py
# Topologically Sorted Source Nodes: [sa], Original ATen: [aten.cat]
# Source node to ATen node mapping:
# sa => cat
# Graph fragment:
# %cat : [num_users=3] = call_function[target=torch.ops.aten.cat.default](args = ([%primals_1, %primals_2], 1), kwargs = {})
triton_poi_fused_cat_0 = async_compile.triton('triton_poi_fused_cat_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[32],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 32
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 8
x1 = (xindex // 8)
x2 = xindex
tmp0 = x0
tmp1 = tl.full([1], 0, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + ((4*x1) + x0), tmp4 & xmask, eviction_policy='evict_last', other=0.0)
tmp6 = tmp0 >= tmp3
tmp7 = tl.full([1], 8, tl.int64)
tmp8 = tmp0 < tmp7
tmp9 = tl.load(in_ptr1 + ((4*x1) + ((-4) + x0)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp10 = tl.where(tmp4, tmp5, tmp9)
tl.store(out_ptr0 + (x2), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/y2/cy2lwgz7dq2q2z4ifepdde4l7vyyvrwcx4zjn2ezmtzcanvhv374.py
# Topologically Sorted Source Nodes: [q1], Original ATen: [aten.relu]
# Source node to ATen node mapping:
# q1 => relu
# Graph fragment:
# %add_tensor_3 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mm_default_3, %primals_4), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%add_tensor_3,), kwargs = {})
triton_poi_fused_relu_1 = async_compile.triton('triton_poi_fused_relu_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 256
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (256, 8), (8, 1))
assert_size_stride(primals_4, (256, ), (1, ))
assert_size_stride(primals_5, (256, 256), (256, 1))
assert_size_stride(primals_6, (256, ), (1, ))
assert_size_stride(primals_7, (1, 256), (256, 1))
assert_size_stride(primals_8, (1, ), (1, ))
assert_size_stride(primals_9, (256, 8), (8, 1))
assert_size_stride(primals_10, (256, ), (1, ))
assert_size_stride(primals_11, (256, 256), (256, 1))
assert_size_stride(primals_12, (256, ), (1, ))
assert_size_stride(primals_13, (1, 256), (256, 1))
assert_size_stride(primals_14, (1, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 8), (8, 1), torch.float32)
# Topologically Sorted Source Nodes: [sa], Original ATen: [aten.cat]
stream0 = get_raw_stream(0)
triton_poi_fused_cat_0.run(primals_1, primals_2, buf0, 32, grid=grid(32), stream=stream0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((4, 256), (256, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(buf0, reinterpret_tensor(primals_3, (8, 256), (1, 8), 0), out=buf1)
del primals_3
buf2 = buf1; del buf1 # reuse
# Topologically Sorted Source Nodes: [q1], Original ATen: [aten.relu]
triton_poi_fused_relu_1.run(buf2, primals_4, 1024, grid=grid(1024), stream=stream0)
del primals_4
buf3 = empty_strided_cuda((4, 256), (256, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(buf2, reinterpret_tensor(primals_5, (256, 256), (1, 256), 0), out=buf3)
buf4 = buf3; del buf3 # reuse
# Topologically Sorted Source Nodes: [q1_1], Original ATen: [aten.relu]
triton_poi_fused_relu_1.run(buf4, primals_6, 1024, grid=grid(1024), stream=stream0)
del primals_6
buf6 = empty_strided_cuda((4, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [q1_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_8, buf4, reinterpret_tensor(primals_7, (256, 1), (1, 256), 0), alpha=1, beta=1, out=buf6)
del primals_8
buf7 = empty_strided_cuda((4, 256), (256, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(buf0, reinterpret_tensor(primals_9, (8, 256), (1, 8), 0), out=buf7)
del primals_9
buf8 = buf7; del buf7 # reuse
# Topologically Sorted Source Nodes: [q2], Original ATen: [aten.relu]
triton_poi_fused_relu_1.run(buf8, primals_10, 1024, grid=grid(1024), stream=stream0)
del primals_10
buf9 = empty_strided_cuda((4, 256), (256, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(buf8, reinterpret_tensor(primals_11, (256, 256), (1, 256), 0), out=buf9)
buf10 = buf9; del buf9 # reuse
# Topologically Sorted Source Nodes: [q2_1], Original ATen: [aten.relu]
triton_poi_fused_relu_1.run(buf10, primals_12, 1024, grid=grid(1024), stream=stream0)
del primals_12
buf12 = empty_strided_cuda((4, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [q2_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_14, buf10, reinterpret_tensor(primals_13, (256, 1), (1, 256), 0), alpha=1, beta=1, out=buf12)
del primals_14
return (buf6, buf12, buf0, buf2, buf4, buf8, buf10, primals_13, primals_11, primals_7, primals_5, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((256, 8), (8, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((256, 256), (256, 1), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((1, 256), (256, 1), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((1, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((256, 8), (8, 1), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((256, 256), (256, 1), device='cuda:0', dtype=torch.float32)
primals_12 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_13 = rand_strided((1, 256), (256, 1), device='cuda:0', dtype=torch.float32)
primals_14 = rand_strided((1, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12, primals_13, primals_14])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class Critic(nn.Module):
def __init__(self, state_dim, action_dim):
super(Critic, self).__init__()
self.l1 = nn.Linear(state_dim + action_dim, 256)
self.l2 = nn.Linear(256, 256)
self.l3 = nn.Linear(256, 1)
self.l4 = nn.Linear(state_dim + action_dim, 256)
self.l5 = nn.Linear(256, 256)
self.l6 = nn.Linear(256, 1)
def forward(self, state, action):
sa = torch.cat([state, action], 1)
q1 = F.relu(self.l1(sa))
q1 = F.relu(self.l2(q1))
q1 = self.l3(q1)
q2 = F.relu(self.l4(sa))
q2 = F.relu(self.l5(q2))
q2 = self.l6(q2)
return q1, q2
def Q1(self, state, action):
sa = torch.cat([state, action], 1)
q1 = F.relu(self.l1(sa))
q1 = F.relu(self.l2(q1))
q1 = self.l3(q1)
return q1
def get_inputs():
return [torch.rand([4, 4]), torch.rand([4, 4])]
def get_init_inputs():
return [[], {'state_dim': 4, 'action_dim': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_cat_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 32
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 8
x1 = xindex // 8
x2 = xindex
tmp0 = x0
tl.full([1], 0, tl.int64)
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + (4 * x1 + x0), tmp4 & xmask, eviction_policy=
'evict_last', other=0.0)
tmp6 = tmp0 >= tmp3
tl.full([1], 8, tl.int64)
tmp9 = tl.load(in_ptr1 + (4 * x1 + (-4 + x0)), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp10 = tl.where(tmp4, tmp5, tmp9)
tl.store(out_ptr0 + x2, tmp10, xmask)
@triton.jit
def triton_poi_fused_relu_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 256
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + x2, tmp4, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11, primals_12,
primals_13, primals_14) = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (256, 8), (8, 1))
assert_size_stride(primals_4, (256,), (1,))
assert_size_stride(primals_5, (256, 256), (256, 1))
assert_size_stride(primals_6, (256,), (1,))
assert_size_stride(primals_7, (1, 256), (256, 1))
assert_size_stride(primals_8, (1,), (1,))
assert_size_stride(primals_9, (256, 8), (8, 1))
assert_size_stride(primals_10, (256,), (1,))
assert_size_stride(primals_11, (256, 256), (256, 1))
assert_size_stride(primals_12, (256,), (1,))
assert_size_stride(primals_13, (1, 256), (256, 1))
assert_size_stride(primals_14, (1,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 8), (8, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_cat_0[grid(32)](primals_1, primals_2, buf0, 32,
XBLOCK=32, num_warps=1, num_stages=1)
del primals_1
del primals_2
buf1 = empty_strided_cuda((4, 256), (256, 1), torch.float32)
extern_kernels.mm(buf0, reinterpret_tensor(primals_3, (8, 256), (1,
8), 0), out=buf1)
del primals_3
buf2 = buf1
del buf1
triton_poi_fused_relu_1[grid(1024)](buf2, primals_4, 1024, XBLOCK=
256, num_warps=4, num_stages=1)
del primals_4
buf3 = empty_strided_cuda((4, 256), (256, 1), torch.float32)
extern_kernels.mm(buf2, reinterpret_tensor(primals_5, (256, 256), (
1, 256), 0), out=buf3)
buf4 = buf3
del buf3
triton_poi_fused_relu_1[grid(1024)](buf4, primals_6, 1024, XBLOCK=
256, num_warps=4, num_stages=1)
del primals_6
buf6 = empty_strided_cuda((4, 1), (1, 1), torch.float32)
extern_kernels.addmm(primals_8, buf4, reinterpret_tensor(primals_7,
(256, 1), (1, 256), 0), alpha=1, beta=1, out=buf6)
del primals_8
buf7 = empty_strided_cuda((4, 256), (256, 1), torch.float32)
extern_kernels.mm(buf0, reinterpret_tensor(primals_9, (8, 256), (1,
8), 0), out=buf7)
del primals_9
buf8 = buf7
del buf7
triton_poi_fused_relu_1[grid(1024)](buf8, primals_10, 1024, XBLOCK=
256, num_warps=4, num_stages=1)
del primals_10
buf9 = empty_strided_cuda((4, 256), (256, 1), torch.float32)
extern_kernels.mm(buf8, reinterpret_tensor(primals_11, (256, 256),
(1, 256), 0), out=buf9)
buf10 = buf9
del buf9
triton_poi_fused_relu_1[grid(1024)](buf10, primals_12, 1024, XBLOCK
=256, num_warps=4, num_stages=1)
del primals_12
buf12 = empty_strided_cuda((4, 1), (1, 1), torch.float32)
extern_kernels.addmm(primals_14, buf10, reinterpret_tensor(
primals_13, (256, 1), (1, 256), 0), alpha=1, beta=1, out=buf12)
del primals_14
return (buf6, buf12, buf0, buf2, buf4, buf8, buf10, primals_13,
primals_11, primals_7, primals_5)
class CriticNew(nn.Module):
def __init__(self, state_dim, action_dim):
super(CriticNew, self).__init__()
self.l1 = nn.Linear(state_dim + action_dim, 256)
self.l2 = nn.Linear(256, 256)
self.l3 = nn.Linear(256, 1)
self.l4 = nn.Linear(state_dim + action_dim, 256)
self.l5 = nn.Linear(256, 256)
self.l6 = nn.Linear(256, 1)
def Q1(self, state, action):
sa = torch.cat([state, action], 1)
q1 = F.relu(self.l1(sa))
q1 = F.relu(self.l2(q1))
q1 = self.l3(q1)
return q1
def forward(self, input_0, input_1):
primals_3 = self.l1.weight
primals_4 = self.l1.bias
primals_5 = self.l2.weight
primals_6 = self.l2.bias
primals_7 = self.l3.weight
primals_8 = self.l3.bias
primals_9 = self.l4.weight
primals_10 = self.l4.bias
primals_11 = self.l5.weight
primals_12 = self.l5.bias
primals_13 = self.l6.weight
primals_14 = self.l6.bias
primals_1 = input_0
primals_2 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11, primals_12, primals_13, primals_14])
return output[0], output[1]
|
ChristianLin0420/DeepRL
|
Critic
| false | 2,110 |
[
"MIT"
] | 0 |
143a9bfebd264229d9d26fcdc070065225774e04
|
https://github.com/ChristianLin0420/DeepRL/tree/143a9bfebd264229d9d26fcdc070065225774e04
|
DepthwiseSeparableConv
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/53/c53345w2ogarycgzyrcothtqrrb7taubpprhokfthwhic4knqepc.py
# Topologically Sorted Source Nodes: [x_2], Original ATen: [aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# x_2 => relu
# Graph fragment:
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%squeeze_1,), kwargs = {})
# %le : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu, 0), kwargs = {})
triton_poi_fused_relu_threshold_backward_0 = async_compile.triton('triton_poi_fused_relu_threshold_backward_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[32],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*i1', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_relu_threshold_backward_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 20
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 5)
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
tl.store(out_ptr0 + (x2), tmp6, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (4, 1, 4), (4, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4, 4, 1), (4, 1, 1))
assert_size_stride(primals_4, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(reinterpret_tensor(primals_2, (1, 4, 4), (16, 4, 1), 0), primals_1, stride=(1,), padding=(2,), dilation=(1,), transposed=False, output_padding=(0,), groups=4, bias=None)
assert_size_stride(buf0, (1, 4, 5), (20, 5, 1))
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten.convolution]
buf1 = extern_kernels.convolution(buf0, primals_3, stride=(1,), padding=(0,), dilation=(1,), transposed=False, output_padding=(0,), groups=1, bias=None)
assert_size_stride(buf1, (1, 4, 5), (20, 5, 1))
buf2 = reinterpret_tensor(buf1, (4, 5), (5, 1), 0); del buf1 # reuse
buf3 = empty_strided_cuda((4, 5), (5, 1), torch.bool)
# Topologically Sorted Source Nodes: [x_2], Original ATen: [aten.relu, aten.threshold_backward]
stream0 = get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0.run(buf2, primals_4, buf3, 20, grid=grid(20), stream=stream0)
del primals_4
return (buf2, primals_1, primals_3, reinterpret_tensor(primals_2, (1, 4, 4), (16, 4, 1), 0), buf0, buf3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 1, 4), (4, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 1), (4, 1, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.cuda
from torch.nn import functional as F
from torch import nn
class DepthwiseSeparableConv(nn.Module):
def __init__(self, in_channels, out_channels, kernel_size, bias=True,
activation=F.relu):
super(DepthwiseSeparableConv, self).__init__()
self.depthwise_conv = nn.Conv1d(in_channels=in_channels,
out_channels=in_channels, kernel_size=kernel_size, padding=
kernel_size // 2, groups=in_channels, bias=False)
self.pointwise_conv = nn.Conv1d(in_channels=in_channels,
out_channels=out_channels, padding=0, kernel_size=1, bias=bias)
self.activation = activation
def forward(self, x):
x = self.depthwise_conv(x)
x = self.pointwise_conv(x)
if self.activation:
x = self.activation(x)
return x
def get_inputs():
return [torch.rand([4, 4])]
def get_init_inputs():
return [[], {'in_channels': 4, 'out_channels': 4, 'kernel_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.cuda
from torch.nn import functional as F
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_relu_threshold_backward_0(in_out_ptr0, in_ptr0,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 20
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 5
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp5 = 0.0
tmp6 = tmp4 <= tmp5
tl.store(in_out_ptr0 + x2, tmp4, xmask)
tl.store(out_ptr0 + x2, tmp6, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (4, 1, 4), (4, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4, 4, 1), (4, 1, 1))
assert_size_stride(primals_4, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(reinterpret_tensor(primals_2, (1,
4, 4), (16, 4, 1), 0), primals_1, stride=(1,), padding=(2,),
dilation=(1,), transposed=False, output_padding=(0,), groups=4,
bias=None)
assert_size_stride(buf0, (1, 4, 5), (20, 5, 1))
buf1 = extern_kernels.convolution(buf0, primals_3, stride=(1,),
padding=(0,), dilation=(1,), transposed=False, output_padding=(
0,), groups=1, bias=None)
assert_size_stride(buf1, (1, 4, 5), (20, 5, 1))
buf2 = reinterpret_tensor(buf1, (4, 5), (5, 1), 0)
del buf1
buf3 = empty_strided_cuda((4, 5), (5, 1), torch.bool)
get_raw_stream(0)
triton_poi_fused_relu_threshold_backward_0[grid(20)](buf2,
primals_4, buf3, 20, XBLOCK=32, num_warps=1, num_stages=1)
del primals_4
return buf2, primals_1, primals_3, reinterpret_tensor(primals_2, (1, 4,
4), (16, 4, 1), 0), buf0, buf3
class DepthwiseSeparableConvNew(nn.Module):
def __init__(self, in_channels, out_channels, kernel_size, bias=True,
activation=F.relu):
super(DepthwiseSeparableConvNew, self).__init__()
self.depthwise_conv = nn.Conv1d(in_channels=in_channels,
out_channels=in_channels, kernel_size=kernel_size, padding=
kernel_size // 2, groups=in_channels, bias=False)
self.pointwise_conv = nn.Conv1d(in_channels=in_channels,
out_channels=out_channels, padding=0, kernel_size=1, bias=bias)
self.activation = activation
def forward(self, input_0):
primals_1 = self.depthwise_conv.weight
primals_3 = self.pointwise_conv.weight
primals_4 = self.pointwise_conv.bias
primals_2 = input_0
output = call([primals_1, primals_2, primals_3, primals_4])
return output[0]
|
CoyoteLeo/QANet-pytorch
|
DepthwiseSeparableConv
| false | 2,111 |
[
"MIT"
] | 0 |
a2d5290915c91c4bc84db142e8ce50c47a7a37d0
|
https://github.com/CoyoteLeo/QANet-pytorch/tree/a2d5290915c91c4bc84db142e8ce50c47a7a37d0
|
RegressionModel
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/au/caug6nesiygukdpkrndsclkfho3dygoeotjtbnihl4wlyyiuddug.py
# Topologically Sorted Source Nodes: [out, out_1], Original ATen: [aten.convolution, aten.relu]
# Source node to ATen node mapping:
# out => convolution
# out_1 => relu
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [1, 1], [1, 1], False, [0, 0], 1), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%convolution,), kwargs = {})
triton_poi_fused_convolution_relu_0 = async_compile.triton('triton_poi_fused_convolution_relu_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16384],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_relu_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_relu_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16384
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x3 = xindex
x1 = (xindex // 16) % 256
tmp0 = tl.load(in_out_ptr0 + (x3), None)
tmp1 = tl.load(in_ptr0 + (x1), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + (x3), tmp4, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/ra/craiyjihtbxcgcvbf4spz6ao2jo32kxcrold46xqwkp43zzisnpl.py
# Topologically Sorted Source Nodes: [contiguous, view], Original ATen: [aten.clone, aten.view]
# Source node to ATen node mapping:
# contiguous => clone
# view => view
# Graph fragment:
# %clone : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
# %view : [num_users=1] = call_function[target=torch.ops.aten.reshape.default](args = (%clone, [4, -1, 4]), kwargs = {})
triton_poi_fused_clone_view_1 = async_compile.triton('triton_poi_fused_clone_view_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64, 64], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_view_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_view_1(in_out_ptr0, in_ptr0, in_ptr1, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 64
xnumel = 60
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 16
y1 = (yindex // 16)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (16*x2) + (960*y1)), xmask & ymask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.debug_barrier()
tl.store(in_out_ptr0 + (x2 + (60*y3)), tmp2, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11 = args
args.clear()
assert_size_stride(primals_1, (256, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (256, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_5, (256, ), (1, ))
assert_size_stride(primals_6, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_7, (256, ), (1, ))
assert_size_stride(primals_8, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_9, (256, ), (1, ))
assert_size_stride(primals_10, (60, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_11, (60, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 256, 4, 4), (4096, 16, 4, 1))
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [out, out_1], Original ATen: [aten.convolution, aten.relu]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_relu_0.run(buf1, primals_2, 16384, grid=grid(16384), stream=stream0)
del primals_2
# Topologically Sorted Source Nodes: [out_2], Original ATen: [aten.convolution]
buf2 = extern_kernels.convolution(buf1, primals_4, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 256, 4, 4), (4096, 16, 4, 1))
buf3 = buf2; del buf2 # reuse
# Topologically Sorted Source Nodes: [out_2, out_3], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_0.run(buf3, primals_5, 16384, grid=grid(16384), stream=stream0)
del primals_5
# Topologically Sorted Source Nodes: [out_4], Original ATen: [aten.convolution]
buf4 = extern_kernels.convolution(buf3, primals_6, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf4, (4, 256, 4, 4), (4096, 16, 4, 1))
buf5 = buf4; del buf4 # reuse
# Topologically Sorted Source Nodes: [out_4, out_5], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_0.run(buf5, primals_7, 16384, grid=grid(16384), stream=stream0)
del primals_7
# Topologically Sorted Source Nodes: [out_6], Original ATen: [aten.convolution]
buf6 = extern_kernels.convolution(buf5, primals_8, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf6, (4, 256, 4, 4), (4096, 16, 4, 1))
buf7 = buf6; del buf6 # reuse
# Topologically Sorted Source Nodes: [out_6, out_7], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_0.run(buf7, primals_9, 16384, grid=grid(16384), stream=stream0)
del primals_9
# Topologically Sorted Source Nodes: [out_8], Original ATen: [aten.convolution]
buf8 = extern_kernels.convolution(buf7, primals_10, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf8, (4, 60, 4, 4), (960, 16, 4, 1))
buf9 = empty_strided_cuda((4, 4, 4, 60), (960, 240, 60, 1), torch.float32)
buf10 = reinterpret_tensor(buf9, (4, 240, 4), (960, 4, 1), 0); del buf9 # reuse
# Topologically Sorted Source Nodes: [contiguous, view], Original ATen: [aten.clone, aten.view]
triton_poi_fused_clone_view_1.run(buf10, buf8, primals_11, 64, 60, grid=grid(64, 60), stream=stream0)
del buf8
del primals_11
return (buf10, primals_1, primals_3, primals_4, primals_6, primals_8, primals_10, buf1, buf3, buf5, buf7, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((256, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((256, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((256, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((256, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((60, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((60, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class RegressionModel(nn.Module):
def __init__(self, num_features_in, num_anchors=15, feature_size=256):
super(RegressionModel, self).__init__()
self.conv1 = nn.Conv2d(num_features_in, feature_size, kernel_size=3,
padding=1)
self.act1 = nn.ReLU()
self.conv2 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act2 = nn.ReLU()
self.conv3 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act3 = nn.ReLU()
self.conv4 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act4 = nn.ReLU()
self.output = nn.Conv2d(feature_size, num_anchors * 4, kernel_size=
3, padding=1)
def forward(self, x):
out = self.conv1(x)
out = self.act1(out)
out = self.conv2(out)
out = self.act2(out)
out = self.conv3(out)
out = self.act3(out)
out = self.conv4(out)
out = self.act4(out)
out = self.output(out)
out = out.permute(0, 2, 3, 1)
return out.contiguous().view(out.shape[0], -1, 4)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'num_features_in': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_convolution_relu_0(in_out_ptr0, in_ptr0, xnumel,
XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x3 = xindex
x1 = xindex // 16 % 256
tmp0 = tl.load(in_out_ptr0 + x3, None)
tmp1 = tl.load(in_ptr0 + x1, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + x3, tmp4, None)
@triton.jit
def triton_poi_fused_clone_view_1(in_out_ptr0, in_ptr0, in_ptr1, ynumel,
xnumel, YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 64
xnumel = 60
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 16
y1 = yindex // 16
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 16 * x2 + 960 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.debug_barrier()
tl.store(in_out_ptr0 + (x2 + 60 * y3), tmp2, xmask & ymask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11) = args
args.clear()
assert_size_stride(primals_1, (256, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (256,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_5, (256,), (1,))
assert_size_stride(primals_6, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_7, (256,), (1,))
assert_size_stride(primals_8, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_9, (256,), (1,))
assert_size_stride(primals_10, (60, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_11, (60,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 256, 4, 4), (4096, 16, 4, 1))
buf1 = buf0
del buf0
get_raw_stream(0)
triton_poi_fused_convolution_relu_0[grid(16384)](buf1, primals_2,
16384, XBLOCK=256, num_warps=4, num_stages=1)
del primals_2
buf2 = extern_kernels.convolution(buf1, primals_4, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 256, 4, 4), (4096, 16, 4, 1))
buf3 = buf2
del buf2
triton_poi_fused_convolution_relu_0[grid(16384)](buf3, primals_5,
16384, XBLOCK=256, num_warps=4, num_stages=1)
del primals_5
buf4 = extern_kernels.convolution(buf3, primals_6, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf4, (4, 256, 4, 4), (4096, 16, 4, 1))
buf5 = buf4
del buf4
triton_poi_fused_convolution_relu_0[grid(16384)](buf5, primals_7,
16384, XBLOCK=256, num_warps=4, num_stages=1)
del primals_7
buf6 = extern_kernels.convolution(buf5, primals_8, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf6, (4, 256, 4, 4), (4096, 16, 4, 1))
buf7 = buf6
del buf6
triton_poi_fused_convolution_relu_0[grid(16384)](buf7, primals_9,
16384, XBLOCK=256, num_warps=4, num_stages=1)
del primals_9
buf8 = extern_kernels.convolution(buf7, primals_10, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf8, (4, 60, 4, 4), (960, 16, 4, 1))
buf9 = empty_strided_cuda((4, 4, 4, 60), (960, 240, 60, 1), torch.
float32)
buf10 = reinterpret_tensor(buf9, (4, 240, 4), (960, 4, 1), 0)
del buf9
triton_poi_fused_clone_view_1[grid(64, 60)](buf10, buf8, primals_11,
64, 60, XBLOCK=64, YBLOCK=4, num_warps=4, num_stages=1)
del buf8
del primals_11
return (buf10, primals_1, primals_3, primals_4, primals_6, primals_8,
primals_10, buf1, buf3, buf5, buf7)
class RegressionModelNew(nn.Module):
def __init__(self, num_features_in, num_anchors=15, feature_size=256):
super(RegressionModelNew, self).__init__()
self.conv1 = nn.Conv2d(num_features_in, feature_size, kernel_size=3,
padding=1)
self.act1 = nn.ReLU()
self.conv2 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act2 = nn.ReLU()
self.conv3 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act3 = nn.ReLU()
self.conv4 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act4 = nn.ReLU()
self.output = nn.Conv2d(feature_size, num_anchors * 4, kernel_size=
3, padding=1)
def forward(self, input_0):
primals_1 = self.conv1.weight
primals_2 = self.conv1.bias
primals_4 = self.conv2.weight
primals_5 = self.conv2.bias
primals_6 = self.conv3.weight
primals_7 = self.conv3.bias
primals_8 = self.conv4.weight
primals_9 = self.conv4.bias
primals_10 = self.output.weight
primals_11 = self.output.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11])
return output[0]
|
BradleyBrown19/CustomObjectDetector
|
RegressionModel
| false | 2,112 |
[
"Apache-2.0"
] | 0 |
11c14ec6127c553ac365703c768b75dde33d9a4d
|
https://github.com/BradleyBrown19/CustomObjectDetector/tree/11c14ec6127c553ac365703c768b75dde33d9a4d
|
NormalizedGramMatrix
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/fr/cfrrm5oerwfre4a5nssw6o6pkdslizcxc3d7kpldwmqfnm36yu6n.py
# Topologically Sorted Source Nodes: [std], Original ATen: [aten.std]
# Source node to ATen node mapping:
# std => var
# Graph fragment:
# %var : [num_users=1] = call_function[target=torch.ops.aten.var.correction](args = (%view, [0, 2]), kwargs = {correction: 1.0})
triton_per_fused_std_0 = async_compile.triton('triton_per_fused_std_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[4, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_std_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 3, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_std_0(in_ptr0, out_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 4
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex % 16
r2 = (rindex // 16)
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + (16*x0) + (64*r2)), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, 0)
tmp4 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp6 = tl.where(xmask, tmp4, 0)
tmp7 = tl.sum(tmp6, 1)[:, None]
tmp8 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp1 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [XBLOCK, RBLOCK])
tmp15 = tl.where(xmask, tmp13, 0)
tmp16 = tl.sum(tmp15, 1)[:, None]
tl.store(out_ptr0 + (x0), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/vz/cvzy7lal7flicvnpr4mvylsjr7t5gcnswrxewczbmxq4hhth7qqt.py
# Topologically Sorted Source Nodes: [stddev, F_1], Original ATen: [aten.add, aten.div]
# Source node to ATen node mapping:
# F_1 => div
# stddev => add
# Graph fragment:
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_1, 1e-15), kwargs = {})
# %div : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%view, %add), kwargs = {})
triton_poi_fused_add_div_1 = async_compile.triton('triton_poi_fused_add_div_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_div_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_div_1(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr1 + (x1), xmask, eviction_policy='evict_last')
tmp2 = 63.0
tmp3 = tmp1 / tmp2
tmp4 = libdevice.sqrt(tmp3)
tmp5 = 1e-15
tmp6 = tmp4 + tmp5
tmp7 = tmp0 / tmp6
tl.store(out_ptr0 + (x3), tmp7, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/ci/cciwtdt4shqy53cplutouc5xbpbqr5r62nawd6gyi7r4zcj34ei6.py
# Topologically Sorted Source Nodes: [G_1], Original ATen: [aten.div]
# Source node to ATen node mapping:
# G_1 => div_1
# Graph fragment:
# %div_1 : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%bmm, 16), kwargs = {})
triton_poi_fused_div_2 = async_compile.triton('triton_poi_fused_div_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_div_2', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_div_2(in_out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + (x0), xmask)
tmp1 = 0.0625
tmp2 = tmp0 * tmp1
tl.store(in_out_ptr0 + (x0), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((4, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [std], Original ATen: [aten.std]
stream0 = get_raw_stream(0)
triton_per_fused_std_0.run(arg0_1, buf1, 4, 64, grid=grid(4), stream=stream0)
buf3 = empty_strided_cuda((4, 4, 16), (64, 16, 1), torch.float32)
# Topologically Sorted Source Nodes: [stddev, F_1], Original ATen: [aten.add, aten.div]
triton_poi_fused_add_div_1.run(arg0_1, buf1, buf3, 256, grid=grid(256), stream=stream0)
del arg0_1
del buf1
buf4 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [G], Original ATen: [aten.bmm]
extern_kernels.bmm(buf3, reinterpret_tensor(buf3, (4, 16, 4), (64, 1, 16), 0), out=buf4)
del buf3
buf5 = buf4; del buf4 # reuse
# Topologically Sorted Source Nodes: [G_1], Original ATen: [aten.div]
triton_poi_fused_div_2.run(buf5, 64, grid=grid(64), stream=stream0)
return (buf5, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
def normalize_by_stddev(tensor):
"""
divides channel-wise by standard deviation of channel
"""
channels = tensor.shape[1]
stddev = tensor.std(dim=(0, 2)).view(1, channels, 1) + 1e-15
return tensor.div(stddev)
class NormalizedGramMatrix(nn.Module):
"""
I have found that normalizing the tensor before calculating the gram matrices leads to better convergence.
"""
def forward(self, input):
b, c, h, w = input.size()
F = input.view(b, c, h * w)
F = normalize_by_stddev(F)
G = torch.bmm(F, F.transpose(1, 2))
G = G.div_(h * w)
return G
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_per_fused_std_0(in_ptr0, out_ptr0, xnumel, rnumel, XBLOCK: tl.
constexpr):
xnumel = 4
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex % 16
r2 = rindex // 16
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + 16 * x0 + 64 * r2), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tl.where(xmask, tmp1, 0)
tmp4 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp6 = tl.where(xmask, tmp4, 0)
tmp7 = tl.sum(tmp6, 1)[:, None]
tmp8 = tl.full([XBLOCK, 1], 64, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp1 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [XBLOCK, RBLOCK])
tmp15 = tl.where(xmask, tmp13, 0)
tmp16 = tl.sum(tmp15, 1)[:, None]
tl.store(out_ptr0 + x0, tmp16, xmask)
@triton.jit
def triton_poi_fused_add_div_1(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 16 % 4
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr1 + x1, xmask, eviction_policy='evict_last')
tmp2 = 63.0
tmp3 = tmp1 / tmp2
tmp4 = libdevice.sqrt(tmp3)
tmp5 = 1e-15
tmp6 = tmp4 + tmp5
tmp7 = tmp0 / tmp6
tl.store(out_ptr0 + x3, tmp7, xmask)
@triton.jit
def triton_poi_fused_div_2(in_out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + x0, xmask)
tmp1 = 0.0625
tmp2 = tmp0 * tmp1
tl.store(in_out_ptr0 + x0, tmp2, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf1 = empty_strided_cuda((4,), (1,), torch.float32)
get_raw_stream(0)
triton_per_fused_std_0[grid(4)](arg0_1, buf1, 4, 64, XBLOCK=1,
num_warps=2, num_stages=1)
buf3 = empty_strided_cuda((4, 4, 16), (64, 16, 1), torch.float32)
triton_poi_fused_add_div_1[grid(256)](arg0_1, buf1, buf3, 256,
XBLOCK=256, num_warps=4, num_stages=1)
del arg0_1
del buf1
buf4 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
extern_kernels.bmm(buf3, reinterpret_tensor(buf3, (4, 16, 4), (64,
1, 16), 0), out=buf4)
del buf3
buf5 = buf4
del buf4
triton_poi_fused_div_2[grid(64)](buf5, 64, XBLOCK=64, num_warps=1,
num_stages=1)
return buf5,
def normalize_by_stddev(tensor):
"""
divides channel-wise by standard deviation of channel
"""
channels = tensor.shape[1]
stddev = tensor.std(dim=(0, 2)).view(1, channels, 1) + 1e-15
return tensor.div(stddev)
class NormalizedGramMatrixNew(nn.Module):
"""
I have found that normalizing the tensor before calculating the gram matrices leads to better convergence.
"""
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
ChuckHend/nst-zoo
|
NormalizedGramMatrix
| false | 2,113 |
[
"MIT"
] | 0 |
130e485289c5a9417c3dc36980b87373f12f3697
|
https://github.com/ChuckHend/nst-zoo/tree/130e485289c5a9417c3dc36980b87373f12f3697
|
LinearNormalize
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/l3/cl3gbxmsa3gw42v7xa4utm3ds4cngq2k2x4psn3b75a2zsx4d26u.py
# Topologically Sorted Source Nodes: [min_1, sub, max_1, truediv], Original ATen: [aten.min, aten.sub, aten.max, aten.div]
# Source node to ATen node mapping:
# max_1 => max_1
# min_1 => min_1
# sub => sub
# truediv => div
# Graph fragment:
# %min_1 : [num_users=1] = call_function[target=torch.ops.aten.min.default](args = (%arg0_1,), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %min_1), kwargs = {})
# %max_1 : [num_users=1] = call_function[target=torch.ops.aten.max.default](args = (%arg0_1,), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%sub, %max_1), kwargs = {})
triton_per_fused_div_max_min_sub_0 = async_compile.triton('triton_per_fused_div_max_min_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {2: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 3), equal_to_1=(2,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_div_max_min_sub_0', 'mutated_arg_names': [], 'no_x_dim': True, 'num_load': 1, 'num_reduction': 2, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_div_max_min_sub_0(in_ptr0, out_ptr2, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.broadcast_to(tmp0, [RBLOCK])
tmp3 = triton_helpers.promote_to_tensor(triton_helpers.min2(tmp1, 0))
tmp5 = triton_helpers.promote_to_tensor(triton_helpers.max2(tmp1, 0))
tmp6 = tmp0 - tmp3
tmp7 = tmp6 / tmp5
tl.store(out_ptr2 + (tl.broadcast_to(r0, [RBLOCK])), tmp7, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [min_1, sub, max_1, truediv], Original ATen: [aten.min, aten.sub, aten.max, aten.div]
stream0 = get_raw_stream(0)
triton_per_fused_div_max_min_sub_0.run(arg0_1, buf2, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
return (buf2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
class LinearNormalize(nn.Module):
def forward(self, x):
return (x - x.min()) / x.max()
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_div_max_min_sub_0(in_ptr0, out_ptr2, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.broadcast_to(tmp0, [RBLOCK])
tmp3 = triton_helpers.promote_to_tensor(triton_helpers.min2(tmp1, 0))
tmp5 = triton_helpers.promote_to_tensor(triton_helpers.max2(tmp1, 0))
tmp6 = tmp0 - tmp3
tmp7 = tmp6 / tmp5
tl.store(out_ptr2 + tl.broadcast_to(r0, [RBLOCK]), tmp7, None)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_per_fused_div_max_min_sub_0[grid(1)](arg0_1, buf2, 1, 256,
num_warps=2, num_stages=1)
del arg0_1
return buf2,
class LinearNormalizeNew(nn.Module):
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
DSciLab/eye_datasets
|
LinearNormalize
| false | 2,114 |
[
"MIT"
] | 0 |
4733ce8a272fef37aa9a3dab779254ab010e97b5
|
https://github.com/DSciLab/eye_datasets/tree/4733ce8a272fef37aa9a3dab779254ab010e97b5
|
MaxPoolStride1
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/hx/chx5m6qxrcu6wal56js3crjy4s6tfrcj5rpafrisgnvm7f2fknk4.py
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.max_pool2d_with_indices]
# Source node to ATen node mapping:
# x => getitem
# Graph fragment:
# %getitem : [num_users=1] = call_function[target=operator.getitem](args = (%_low_memory_max_pool2d_with_offsets, 0), kwargs = {})
triton_poi_fused_max_pool2d_with_indices_0 = async_compile.triton('triton_poi_fused_max_pool2d_with_indices_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_max_pool2d_with_indices_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_max_pool2d_with_indices_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = (xindex // 4) % 4
x2 = (xindex // 16)
x3 = xindex
tmp0 = tl.load(in_ptr0 + ((4*((3) * ((3) <= (x1)) + (x1) * ((x1) < (3)))) + (16*x2) + ((3) * ((3) <= (x0)) + (x0) * ((x0) < (3)))), xmask)
tmp1 = tl.load(in_ptr0 + ((4*((3) * ((3) <= (x1)) + (x1) * ((x1) < (3)))) + (16*x2) + ((3) * ((3) <= (1 + x0)) + (1 + x0) * ((1 + x0) < (3)))), xmask)
tmp3 = tl.load(in_ptr0 + ((4*((3) * ((3) <= (1 + x1)) + (1 + x1) * ((1 + x1) < (3)))) + (16*x2) + ((3) * ((3) <= (x0)) + (x0) * ((x0) < (3)))), xmask)
tmp5 = tl.load(in_ptr0 + ((4*((3) * ((3) <= (1 + x1)) + (1 + x1) * ((1 + x1) < (3)))) + (16*x2) + ((3) * ((3) <= (1 + x0)) + (1 + x0) * ((1 + x0) < (3)))), xmask)
tmp2 = triton_helpers.maximum(tmp1, tmp0)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp6 = triton_helpers.maximum(tmp5, tmp4)
tl.store(out_ptr0 + (x3), tmp6, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.max_pool2d_with_indices]
stream0 = get_raw_stream(0)
triton_poi_fused_max_pool2d_with_indices_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class MaxPoolStride1(nn.Module):
def __init__(self):
super(MaxPoolStride1, self).__init__()
def forward(self, x):
x = F.max_pool2d(F.pad(x, (0, 1, 0, 1), mode='replicate'), 2, stride=1)
return x
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_max_pool2d_with_indices_0(in_ptr0, out_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = xindex // 4 % 4
x2 = xindex // 16
x3 = xindex
tmp0 = tl.load(in_ptr0 + (4 * (3 * (3 <= x1) + x1 * (x1 < 3)) + 16 * x2 +
(3 * (3 <= x0) + x0 * (x0 < 3))), xmask)
tmp1 = tl.load(in_ptr0 + (4 * (3 * (3 <= x1) + x1 * (x1 < 3)) + 16 * x2 +
(3 * (3 <= 1 + x0) + (1 + x0) * (1 + x0 < 3))), xmask)
tmp3 = tl.load(in_ptr0 + (4 * (3 * (3 <= 1 + x1) + (1 + x1) * (1 + x1 <
3)) + 16 * x2 + (3 * (3 <= x0) + x0 * (x0 < 3))), xmask)
tmp5 = tl.load(in_ptr0 + (4 * (3 * (3 <= 1 + x1) + (1 + x1) * (1 + x1 <
3)) + 16 * x2 + (3 * (3 <= 1 + x0) + (1 + x0) * (1 + x0 < 3))), xmask)
tmp2 = triton_helpers.maximum(tmp1, tmp0)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tmp6 = triton_helpers.maximum(tmp5, tmp4)
tl.store(out_ptr0 + x3, tmp6, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_max_pool2d_with_indices_0[grid(256)](arg0_1, buf0,
256, XBLOCK=256, num_warps=4, num_stages=1)
del arg0_1
return buf0,
class MaxPoolStride1New(nn.Module):
def __init__(self):
super(MaxPoolStride1New, self).__init__()
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
CoDaS-Lab/Contextual-Adversarial-Patches
|
MaxPoolStride1
| false | 2,115 |
[
"MIT"
] | 0 |
ffbd897174fc381ba7c3ba1e6f827b84ccb30fd4
|
https://github.com/CoDaS-Lab/Contextual-Adversarial-Patches/tree/ffbd897174fc381ba7c3ba1e6f827b84ccb30fd4
|
PixelwiseNormalization
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/lg/clgum5lgqb2igszc5bgmtzzepcvym6hp73vttrcwjtey34a6skhy.py
# Topologically Sorted Source Nodes: [pow_1, mean, add, factor, truediv], Original ATen: [aten.pow, aten.mean, aten.add, aten.div]
# Source node to ATen node mapping:
# add => add
# factor => pow_2
# mean => mean
# pow_1 => pow_1
# truediv => div
# Graph fragment:
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%arg0_1, 2), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%pow_1, [1], True), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mean, 1e-08), kwargs = {})
# %pow_2 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%add, 0.5), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%arg0_1, %pow_2), kwargs = {})
triton_poi_fused_add_div_mean_pow_0 = async_compile.triton('triton_poi_fused_add_div_mean_pow_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_div_mean_pow_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_div_mean_pow_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tmp1 * tmp1
tmp4 = tmp3 * tmp3
tmp5 = tmp2 + tmp4
tmp7 = tmp6 * tmp6
tmp8 = tmp5 + tmp7
tmp10 = tmp9 * tmp9
tmp11 = tmp8 + tmp10
tmp12 = 4.0
tmp13 = tmp11 / tmp12
tmp14 = 1e-08
tmp15 = tmp13 + tmp14
tmp16 = libdevice.sqrt(tmp15)
tmp17 = tmp0 / tmp16
tl.store(out_ptr0 + (x3), tmp17, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [pow_1, mean, add, factor, truediv], Original ATen: [aten.pow, aten.mean, aten.add, aten.div]
stream0 = get_raw_stream(0)
triton_poi_fused_add_div_mean_pow_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class PixelwiseNormalization(nn.Module):
def __init__(self):
super().__init__()
def forward(self, x):
factor = ((x ** 2).mean(dim=1, keepdim=True) + 1e-08) ** 0.5
return x / factor
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_add_div_mean_pow_0(in_ptr0, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp9 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tmp1 * tmp1
tmp4 = tmp3 * tmp3
tmp5 = tmp2 + tmp4
tmp7 = tmp6 * tmp6
tmp8 = tmp5 + tmp7
tmp10 = tmp9 * tmp9
tmp11 = tmp8 + tmp10
tmp12 = 4.0
tmp13 = tmp11 / tmp12
tmp14 = 1e-08
tmp15 = tmp13 + tmp14
tmp16 = libdevice.sqrt(tmp15)
tmp17 = tmp0 / tmp16
tl.store(out_ptr0 + x3, tmp17, xmask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_add_div_mean_pow_0[grid(256)](arg0_1, buf0, 256,
XBLOCK=256, num_warps=4, num_stages=1)
del arg0_1
return buf0,
class PixelwiseNormalizationNew(nn.Module):
def __init__(self):
super().__init__()
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
DannyDannyDanny/DeepPrivacy
|
PixelwiseNormalization
| false | 2,116 |
[
"MIT"
] | 0 |
749e260bdcc28a0c12d526f24e4f5315d1b447ad
|
https://github.com/DannyDannyDanny/DeepPrivacy/tree/749e260bdcc28a0c12d526f24e4f5315d1b447ad
|
DiceLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ma/cma6x5bz2pwajdzlgc46dd6l2kf54jhvdqofvqvagobkfkoaglsn.py
# Topologically Sorted Source Nodes: [mul, intersection, mul_1, add, sum_2, sum_3, add_1, add_2, dsc, sub], Original ATen: [aten.mul, aten.sum, aten.add, aten.div, aten.rsub]
# Source node to ATen node mapping:
# add => add
# add_1 => add_1
# add_2 => add_2
# dsc => div
# intersection => sum_1
# mul => mul
# mul_1 => mul_1
# sub => sub
# sum_2 => sum_2
# sum_3 => sum_3
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view, %view_1), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%mul,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sum_1, 2.0), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, 1.0), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%view,), kwargs = {})
# %sum_3 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%view_1,), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sum_2, %sum_3), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%add_1, 1.0), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%add, %add_2), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1.0, %div), kwargs = {})
triton_per_fused_add_div_mul_rsub_sum_0 = async_compile.triton('triton_per_fused_add_div_mul_rsub_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_div_mul_rsub_sum_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 3, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_div_mul_rsub_sum_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 1
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + ((64*(r0 // 16)) + (r0 % 16)), None)
tmp1 = tl.load(in_ptr1 + ((64*(r0 // 16)) + (r0 % 16)), None)
tmp2 = tmp0 * tmp1
tmp3 = tl.broadcast_to(tmp2, [XBLOCK, RBLOCK])
tmp5 = tl.sum(tmp3, 1)[:, None]
tmp6 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp8 = tl.sum(tmp6, 1)[:, None]
tmp9 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp11 = tl.sum(tmp9, 1)[:, None]
tmp12 = 2.0
tmp13 = tmp5 * tmp12
tmp14 = 1.0
tmp15 = tmp13 + tmp14
tmp16 = tmp8 + tmp11
tmp17 = tmp16 + tmp14
tmp18 = tmp15 / tmp17
tmp19 = tmp14 - tmp18
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([XBLOCK, 1], 0, tl.int32)), tmp19, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf3 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [mul, intersection, mul_1, add, sum_2, sum_3, add_1, add_2, dsc, sub], Original ATen: [aten.mul, aten.sum, aten.add, aten.div, aten.rsub]
stream0 = get_raw_stream(0)
triton_per_fused_add_div_mul_rsub_sum_0.run(buf3, arg0_1, arg1_1, 1, 64, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
class DiceLoss(nn.Module):
def __init__(self):
super(DiceLoss, self).__init__()
self.smooth = 1.0
def forward(self, y_pred, y_true):
assert y_pred.size() == y_true.size()
y_pred = y_pred[:, 0].contiguous().view(-1)
y_true = y_true[:, 0].contiguous().view(-1)
intersection = (y_pred * y_true).sum()
dsc = (2.0 * intersection + self.smooth) / (y_pred.sum() + y_true.
sum() + self.smooth)
return 1.0 - dsc
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_div_mul_rsub_sum_0(in_out_ptr0, in_ptr0, in_ptr1,
xnumel, rnumel, XBLOCK: tl.constexpr):
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xoffset + tl.arange(0, XBLOCK)[:, None]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (64 * (r0 // 16) + r0 % 16), None)
tmp1 = tl.load(in_ptr1 + (64 * (r0 // 16) + r0 % 16), None)
tmp2 = tmp0 * tmp1
tmp3 = tl.broadcast_to(tmp2, [XBLOCK, RBLOCK])
tmp5 = tl.sum(tmp3, 1)[:, None]
tmp6 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp8 = tl.sum(tmp6, 1)[:, None]
tmp9 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp11 = tl.sum(tmp9, 1)[:, None]
tmp12 = 2.0
tmp13 = tmp5 * tmp12
tmp14 = 1.0
tmp15 = tmp13 + tmp14
tmp16 = tmp8 + tmp11
tmp17 = tmp16 + tmp14
tmp18 = tmp15 / tmp17
tmp19 = tmp14 - tmp18
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([XBLOCK, 1], 0, tl.int32), tmp19, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf3 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_add_div_mul_rsub_sum_0[grid(1)](buf3, arg0_1,
arg1_1, 1, 64, XBLOCK=1, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf3,
class DiceLossNew(nn.Module):
def __init__(self):
super(DiceLossNew, self).__init__()
self.smooth = 1.0
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
DRIP-AI-RESEARCH-JUNIOR/Medical_Unet_Dashboard
|
DiceLoss
| false | 2,117 |
[
"MIT"
] | 0 |
43b20e68ac6807b5e62771f3dcca3b9749c8c4c8
|
https://github.com/DRIP-AI-RESEARCH-JUNIOR/Medical_Unet_Dashboard/tree/43b20e68ac6807b5e62771f3dcca3b9749c8c4c8
|
LogSoftmaxOutput
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/nr/cnrkptzsuv7qm3ss6i6xgoxkou23z76h2vmwqkwz2zkgpdbxhedc.py
# Topologically Sorted Source Nodes: [log_softmax], Original ATen: [aten._log_softmax]
# Source node to ATen node mapping:
# log_softmax => amax, sub
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%view_1, [-1], True), kwargs = {})
# %sub : [num_users=2] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_1, %amax), kwargs = {})
triton_poi_fused__log_softmax_0 = async_compile.triton('triton_poi_fused__log_softmax_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__log_softmax_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__log_softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tl.store(out_ptr0 + (x2), tmp8, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/32/c32vfxouqe74ea5scuzrdhpd7r6adxwu4bzarm4icjfnb47jbizg.py
# Topologically Sorted Source Nodes: [log_softmax], Original ATen: [aten._log_softmax]
# Source node to ATen node mapping:
# log_softmax => exp, log, sub_1, sum_1
# Graph fragment:
# %exp : [num_users=1] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [-1], True), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%sum_1,), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sub, %log), kwargs = {})
triton_poi_fused__log_softmax_1 = async_compile.triton('triton_poi_fused__log_softmax_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__log_softmax_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__log_softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp2 = tl_math.exp(tmp1)
tmp4 = tl_math.exp(tmp3)
tmp5 = tmp2 + tmp4
tmp7 = tl_math.exp(tmp6)
tmp8 = tmp5 + tmp7
tmp10 = tl_math.exp(tmp9)
tmp11 = tmp8 + tmp10
tmp12 = tl_math.log(tmp11)
tmp13 = tmp0 - tmp12
tl.store(out_ptr0 + (x2), tmp13, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_3, reinterpret_tensor(primals_1, (64, 4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_2
del primals_3
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [log_softmax], Original ATen: [aten._log_softmax]
stream0 = get_raw_stream(0)
triton_poi_fused__log_softmax_0.run(buf0, buf1, 256, grid=grid(256), stream=stream0)
buf2 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf0 # reuse
# Topologically Sorted Source Nodes: [log_softmax], Original ATen: [aten._log_softmax]
triton_poi_fused__log_softmax_1.run(buf1, buf2, 256, grid=grid(256), stream=stream0)
del buf1
return (buf2, reinterpret_tensor(primals_1, (64, 4), (4, 1), 0), buf2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class Linear(nn.Linear):
"""
Apply linear projection to the last dimention of a tensor.
"""
def forward(self, x):
size = x.size()
return super().forward(x.contiguous().view(-1, size[-1])).view(*
size[:-1], -1)
class LogSoftmaxOutput(nn.Module):
def __init__(self, input_dim, output_dim):
super().__init__()
self.input_dim = input_dim
self.output_dim = output_dim
self.linear = Linear(input_dim, output_dim)
self.log_softmax = nn.LogSoftmax(dim=-1)
def forward(self, x):
return self.log_softmax(self.linear(x))
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'input_dim': 4, 'output_dim': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused__log_softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tl.store(out_ptr0 + x2, tmp8, xmask)
@triton.jit
def triton_poi_fused__log_softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp2 = tl_math.exp(tmp1)
tmp4 = tl_math.exp(tmp3)
tmp5 = tmp2 + tmp4
tmp7 = tl_math.exp(tmp6)
tmp8 = tmp5 + tmp7
tmp10 = tl_math.exp(tmp9)
tmp11 = tmp8 + tmp10
tmp12 = tl_math.log(tmp11)
tmp13 = tmp0 - tmp12
tl.store(out_ptr0 + x2, tmp13, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_3, reinterpret_tensor(primals_1, (64,
4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf0)
del primals_2
del primals_3
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused__log_softmax_0[grid(256)](buf0, buf1, 256, XBLOCK=
256, num_warps=4, num_stages=1)
buf2 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf0
triton_poi_fused__log_softmax_1[grid(256)](buf1, buf2, 256, XBLOCK=
256, num_warps=4, num_stages=1)
del buf1
return buf2, reinterpret_tensor(primals_1, (64, 4), (4, 1), 0), buf2
class Linear(nn.Linear):
"""
Apply linear projection to the last dimention of a tensor.
"""
def forward(self, x):
size = x.size()
return super().forward(x.contiguous().view(-1, size[-1])).view(*
size[:-1], -1)
class LogSoftmaxOutputNew(nn.Module):
def __init__(self, input_dim, output_dim):
super().__init__()
self.input_dim = input_dim
self.output_dim = output_dim
self.linear = Linear(input_dim, output_dim)
self.log_softmax = nn.LogSoftmax(dim=-1)
def forward(self, input_0):
primals_2 = self.linear.weight
primals_3 = self.linear.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
CrafterKolyan/TabularSemanticParsing
|
LogSoftmaxOutput
| false | 2,118 |
[
"BSD-3-Clause"
] | 0 |
2d75a3b71fa4c58f2c14ac43a33916747e8f4d1f
|
https://github.com/CrafterKolyan/TabularSemanticParsing/tree/2d75a3b71fa4c58f2c14ac43a33916747e8f4d1f
|
OutputLayer
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ku/ckutxoa3tdkp4vgpaf6cdwo3umpfmhw4aepnimgnqqvfrbw2wcgq.py
# Topologically Sorted Source Nodes: [start, end], Original ATen: [aten.cat]
# Source node to ATen node mapping:
# end => cat_1
# start => cat
# Graph fragment:
# %cat : [num_users=2] = call_function[target=torch.ops.aten.cat.default](args = ([%primals_1, %primals_2], 1), kwargs = {})
# %cat_1 : [num_users=2] = call_function[target=torch.ops.aten.cat.default](args = ([%primals_1, %primals_3], 1), kwargs = {})
triton_poi_fused_cat_0 = async_compile.triton('triton_poi_fused_cat_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[128],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 4) % 8
x0 = xindex % 4
x2 = (xindex // 32)
x3 = xindex
tmp0 = x1
tmp1 = tl.full([1], 0, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + (x0 + (4*x1) + (16*x2)), tmp4 & xmask, other=0.0)
tmp6 = tmp0 >= tmp3
tmp7 = tl.full([1], 8, tl.int64)
tmp8 = tmp0 < tmp7
tmp9 = tl.load(in_ptr1 + (x0 + (4*((-4) + x1)) + (16*x2)), tmp6 & xmask, other=0.0)
tmp10 = tl.where(tmp4, tmp5, tmp9)
tmp11 = tl.load(in_ptr2 + (x0 + (4*((-4) + x1)) + (16*x2)), tmp6 & xmask, other=0.0)
tmp12 = tl.where(tmp4, tmp5, tmp11)
tl.store(out_ptr0 + (x3), tmp10, xmask)
tl.store(out_ptr1 + (x3), tmp12, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/3t/c3t5csirwbtawodk3cpgfco7vfz4okeqa5sstoc5yqb6jmlcpgjd.py
# Topologically Sorted Source Nodes: [start_1], Original ATen: [aten.mv]
# Source node to ATen node mapping:
# start_1 => mul, sum_1
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view, %primals_4), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%mul, [1]), kwargs = {})
triton_per_fused_mv_1 = async_compile.triton('triton_per_fused_mv_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 8],
reduction_hint=ReductionHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_mv_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_mv_1(in_ptr0, in_ptr1, out_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 8
RBLOCK: tl.constexpr = 8
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + ((4*r1) + (32*(x0 // 4)) + (x0 % 4)), xmask, other=0.0)
tmp1 = tl.load(in_ptr1 + (r1), None, eviction_policy='evict_last')
tmp2 = tmp0 * tmp1
tmp3 = tl.broadcast_to(tmp2, [XBLOCK, RBLOCK])
tmp5 = tl.where(xmask, tmp3, 0)
tmp6 = tl.sum(tmp5, 1)[:, None]
tl.store(out_ptr0 + (x0), tmp6, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/nd/cndljox75uai37pdq3cuz63myowy23ecnxd5suljxuc3voesamxv.py
# Topologically Sorted Source Nodes: [sub, mul, start_2, end_2], Original ATen: [aten.rsub, aten.mul, aten.add]
# Source node to ATen node mapping:
# end_2 => add_1
# mul => mul_2
# start_2 => add
# sub => sub
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %primals_6), kwargs = {})
# %mul_2 : [num_users=2] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, -1e+30), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_1, %mul_2), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_3, %mul_2), kwargs = {})
triton_poi_fused_add_mul_rsub_2 = async_compile.triton('triton_poi_fused_add_mul_rsub_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_mul_rsub_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_mul_rsub_2(in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 16
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask)
tmp7 = tl.load(in_ptr2 + (x0), xmask, eviction_policy='evict_last')
tmp2 = 1.0
tmp3 = tmp2 - tmp1
tmp4 = -1e+30
tmp5 = tmp3 * tmp4
tmp6 = tmp0 + tmp5
tmp8 = tmp7 + tmp5
tl.store(out_ptr0 + (x2), tmp6, xmask)
tl.store(out_ptr1 + (x2), tmp8, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_3, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_4, (8, ), (1, ))
assert_size_stride(primals_5, (8, ), (1, ))
assert_size_stride(primals_6, (4, 4, 4), (16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 8, 4), (32, 4, 1), torch.float32)
buf1 = empty_strided_cuda((4, 8, 4), (32, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [start, end], Original ATen: [aten.cat]
stream0 = get_raw_stream(0)
triton_poi_fused_cat_0.run(primals_1, primals_2, primals_3, buf0, buf1, 128, grid=grid(128), stream=stream0)
del primals_1
del primals_2
del primals_3
buf2 = empty_strided_cuda((16, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [start_1], Original ATen: [aten.mv]
triton_per_fused_mv_1.run(buf0, primals_4, buf2, 16, 8, grid=grid(16), stream=stream0)
del primals_4
buf3 = empty_strided_cuda((16, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [end_1], Original ATen: [aten.mv]
triton_per_fused_mv_1.run(buf1, primals_5, buf3, 16, 8, grid=grid(16), stream=stream0)
del primals_5
buf4 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
buf5 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [sub, mul, start_2, end_2], Original ATen: [aten.rsub, aten.mul, aten.add]
triton_poi_fused_add_mul_rsub_2.run(buf2, primals_6, buf3, buf4, buf5, 64, grid=grid(64), stream=stream0)
del buf2
del buf3
del primals_6
return (buf4, buf5, buf0, buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((8, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((8, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.cuda
from torch import nn
def mask_logits(target, mask):
mask = mask.type(torch.float32)
return target + -1e+30 * (1 - mask)
class OutputLayer(nn.Module):
def __init__(self, hidden_size):
super(OutputLayer, self).__init__()
self.weight1 = torch.empty(hidden_size * 2, 1)
self.weight2 = torch.empty(hidden_size * 2, 1)
nn.init.xavier_uniform_(self.weight1)
nn.init.xavier_uniform_(self.weight2)
self.weight1 = nn.Parameter(self.weight1.squeeze(), requires_grad=True)
self.weight2 = nn.Parameter(self.weight2.squeeze(), requires_grad=True)
def forward(self, stacked_model_output1, stacked_model_output2,
stacked_model_output3, cmask):
start = torch.cat((stacked_model_output1, stacked_model_output2), dim=1
)
end = torch.cat((stacked_model_output1, stacked_model_output3), dim=1)
start = torch.matmul(self.weight1, start)
end = torch.matmul(self.weight2, end)
start = mask_logits(start, cmask)
end = mask_logits(end, cmask)
return start, end
def get_inputs():
return [torch.rand([4, 4, 4]), torch.rand([4, 4, 4]), torch.rand([4, 4,
4]), torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'hidden_size': 4}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.cuda
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_cat_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1,
xnumel, XBLOCK: tl.constexpr):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 4 % 8
x0 = xindex % 4
x2 = xindex // 32
x3 = xindex
tmp0 = x1
tl.full([1], 0, tl.int64)
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + (x0 + 4 * x1 + 16 * x2), tmp4 & xmask, other=0.0)
tmp6 = tmp0 >= tmp3
tl.full([1], 8, tl.int64)
tmp9 = tl.load(in_ptr1 + (x0 + 4 * (-4 + x1) + 16 * x2), tmp6 & xmask,
other=0.0)
tmp10 = tl.where(tmp4, tmp5, tmp9)
tmp11 = tl.load(in_ptr2 + (x0 + 4 * (-4 + x1) + 16 * x2), tmp6 & xmask,
other=0.0)
tmp12 = tl.where(tmp4, tmp5, tmp11)
tl.store(out_ptr0 + x3, tmp10, xmask)
tl.store(out_ptr1 + x3, tmp12, xmask)
@triton.jit
def triton_per_fused_mv_1(in_ptr0, in_ptr1, out_ptr0, xnumel, rnumel,
XBLOCK: tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 8
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (4 * r1 + 32 * (x0 // 4) + x0 % 4), xmask,
other=0.0)
tmp1 = tl.load(in_ptr1 + r1, None, eviction_policy='evict_last')
tmp2 = tmp0 * tmp1
tmp3 = tl.broadcast_to(tmp2, [XBLOCK, RBLOCK])
tmp5 = tl.where(xmask, tmp3, 0)
tmp6 = tl.sum(tmp5, 1)[:, None]
tl.store(out_ptr0 + x0, tmp6, xmask)
@triton.jit
def triton_poi_fused_add_mul_rsub_2(in_ptr0, in_ptr1, in_ptr2, out_ptr0,
out_ptr1, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 16
x2 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask)
tmp7 = tl.load(in_ptr2 + x0, xmask, eviction_policy='evict_last')
tmp2 = 1.0
tmp3 = tmp2 - tmp1
tmp4 = -1e+30
tmp5 = tmp3 * tmp4
tmp6 = tmp0 + tmp5
tmp8 = tmp7 + tmp5
tl.store(out_ptr0 + x2, tmp6, xmask)
tl.store(out_ptr1 + x2, tmp8, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_3, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_4, (8,), (1,))
assert_size_stride(primals_5, (8,), (1,))
assert_size_stride(primals_6, (4, 4, 4), (16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 8, 4), (32, 4, 1), torch.float32)
buf1 = empty_strided_cuda((4, 8, 4), (32, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_cat_0[grid(128)](primals_1, primals_2, primals_3,
buf0, buf1, 128, XBLOCK=128, num_warps=4, num_stages=1)
del primals_1
del primals_2
del primals_3
buf2 = empty_strided_cuda((16,), (1,), torch.float32)
triton_per_fused_mv_1[grid(16)](buf0, primals_4, buf2, 16, 8,
XBLOCK=8, num_warps=2, num_stages=1)
del primals_4
buf3 = empty_strided_cuda((16,), (1,), torch.float32)
triton_per_fused_mv_1[grid(16)](buf1, primals_5, buf3, 16, 8,
XBLOCK=8, num_warps=2, num_stages=1)
del primals_5
buf4 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
buf5 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
triton_poi_fused_add_mul_rsub_2[grid(64)](buf2, primals_6, buf3,
buf4, buf5, 64, XBLOCK=64, num_warps=1, num_stages=1)
del buf2
del buf3
del primals_6
return buf4, buf5, buf0, buf1
def mask_logits(target, mask):
mask = mask.type(torch.float32)
return target + -1e+30 * (1 - mask)
class OutputLayerNew(nn.Module):
def __init__(self, hidden_size):
super(OutputLayerNew, self).__init__()
self.weight1 = torch.empty(hidden_size * 2, 1)
self.weight2 = torch.empty(hidden_size * 2, 1)
nn.init.xavier_uniform_(self.weight1)
nn.init.xavier_uniform_(self.weight2)
self.weight1 = nn.Parameter(self.weight1.squeeze(), requires_grad=True)
self.weight2 = nn.Parameter(self.weight2.squeeze(), requires_grad=True)
def forward(self, input_0, input_1, input_2, input_3):
primals_4 = self.weight1
primals_5 = self.weight2
primals_1 = input_0
primals_2 = input_1
primals_3 = input_2
primals_6 = input_3
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6])
return output[0], output[1]
|
CoyoteLeo/QANet-pytorch
|
OutputLayer
| false | 2,119 |
[
"MIT"
] | 0 |
a2d5290915c91c4bc84db142e8ce50c47a7a37d0
|
https://github.com/CoyoteLeo/QANet-pytorch/tree/a2d5290915c91c4bc84db142e8ce50c47a7a37d0
|
GlobalAttentionGeneral
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/u5/cu56dhpcth43gy4shrd7mcexf4nfa6qetnnhwe4mno4v6ug76h6j.py
# Topologically Sorted Source Nodes: [targetT], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# targetT => clone
# Graph fragment:
# %clone : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_0 = async_compile.triton('triton_poi_fused_clone_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tl.store(out_ptr0 + (x0), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/hz/chz2sqsqk26mwhf2dxhgh44jfpu2er5yqjftwkzfav5ctqtx5e7f.py
# Topologically Sorted Source Nodes: [attn_2], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# attn_2 => amax, exp, sub
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%view_1, [1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_1, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
triton_poi_fused__softmax_1 = async_compile.triton('triton_poi_fused__softmax_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + (x2), tmp9, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/pm/cpmy57yidxxfl6wmlh5dsizlsat4uz6k43rz6t4r6h2u4z625i5l.py
# Topologically Sorted Source Nodes: [attn_4], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# attn_4 => clone_1
# Graph fragment:
# %clone_1 : [num_users=2] = call_function[target=torch.ops.aten.clone.default](args = (%permute_1,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_2 = async_compile.triton('triton_poi_fused_clone_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 16], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_2(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = (yindex // 4)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (4*x2) + (64*y1)), xmask & ymask)
tmp1 = tl.load(in_ptr0 + ((4*x2) + (64*y1)), xmask & ymask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x2) + (64*y1)), xmask & ymask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + (4*x2) + (64*y1)), xmask & ymask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + (4*x2) + (64*y1)), xmask & ymask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + (x2 + (16*y3)), tmp8, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4), (16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 16, 4), (64, 1, 16), torch.float32)
# Topologically Sorted Source Nodes: [targetT], Original ATen: [aten.clone]
stream0 = get_raw_stream(0)
triton_poi_fused_clone_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
buf1 = empty_strided_cuda((4, 16, 4), (64, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [targetT, attn], Original ATen: [aten.clone, aten.bmm]
extern_kernels.bmm(buf0, arg1_1, out=buf1)
del arg1_1
buf2 = reinterpret_tensor(buf0, (64, 4), (4, 1), 0); del buf0 # reuse
# Topologically Sorted Source Nodes: [attn_2], Original ATen: [aten._softmax]
triton_poi_fused__softmax_1.run(buf1, buf2, 256, grid=grid(256), stream=stream0)
buf3 = reinterpret_tensor(buf1, (4, 4, 16), (64, 16, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [attn_4], Original ATen: [aten.clone]
triton_poi_fused_clone_2.run(buf2, buf3, 16, 16, grid=grid(16, 16), stream=stream0)
buf4 = reinterpret_tensor(buf2, (4, 4, 16), (64, 16, 1), 0); del buf2 # reuse
# Topologically Sorted Source Nodes: [weightedContext], Original ATen: [aten.bmm]
extern_kernels.bmm(arg2_1, buf3, out=buf4)
del arg2_1
return (reinterpret_tensor(buf4, (4, 4, 4, 4), (64, 16, 4, 1), 0), reinterpret_tensor(buf3, (4, 4, 4, 4), (64, 16, 4, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
arg2_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1, arg2_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.utils.data
class GlobalAttentionGeneral(nn.Module):
def __init__(self, idf, cdf):
super(GlobalAttentionGeneral, self).__init__()
self.sm = nn.Softmax()
self.mask = None
def applyMask(self, mask):
self.mask = mask
def forward(self, input, context_key, content_value):
"""
input: batch x idf x ih x iw (queryL=ihxiw)
context: batch x cdf x sourceL
"""
ih, iw = input.size(2), input.size(3)
queryL = ih * iw
batch_size, sourceL = context_key.size(0), context_key.size(2)
target = input.view(batch_size, -1, queryL)
targetT = torch.transpose(target, 1, 2).contiguous()
sourceT = context_key
attn = torch.bmm(targetT, sourceT)
attn = attn.view(batch_size * queryL, sourceL)
if self.mask is not None:
mask = self.mask.repeat(queryL, 1)
attn.data.masked_fill_(mask.data, -float('inf'))
attn = self.sm(attn)
attn = attn.view(batch_size, queryL, sourceL)
attn = torch.transpose(attn, 1, 2).contiguous()
weightedContext = torch.bmm(content_value, attn)
weightedContext = weightedContext.view(batch_size, -1, ih, iw)
attn = attn.view(batch_size, -1, ih, iw)
return weightedContext, attn
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4]), torch.rand([4,
4, 4])]
def get_init_inputs():
return [[], {'idf': 4, 'cdf': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
import torch.nn.parallel
import torch.utils.data
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tl.store(out_ptr0 + x0, tmp0, xmask)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + x2, tmp9, xmask)
@triton.jit
def triton_poi_fused_clone_2(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 4
y1 = yindex // 4
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 4 * x2 + 64 * y1), xmask & ymask)
tmp1 = tl.load(in_ptr0 + (4 * x2 + 64 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x2 + 64 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + 4 * x2 + 64 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + 4 * x2 + 64 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + (x2 + 16 * y3), tmp8, xmask & ymask)
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4), (16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 16, 4), (64, 1, 16), torch.float32)
get_raw_stream(0)
triton_poi_fused_clone_0[grid(256)](arg0_1, buf0, 256, XBLOCK=256,
num_warps=4, num_stages=1)
del arg0_1
buf1 = empty_strided_cuda((4, 16, 4), (64, 4, 1), torch.float32)
extern_kernels.bmm(buf0, arg1_1, out=buf1)
del arg1_1
buf2 = reinterpret_tensor(buf0, (64, 4), (4, 1), 0)
del buf0
triton_poi_fused__softmax_1[grid(256)](buf1, buf2, 256, XBLOCK=128,
num_warps=4, num_stages=1)
buf3 = reinterpret_tensor(buf1, (4, 4, 16), (64, 16, 1), 0)
del buf1
triton_poi_fused_clone_2[grid(16, 16)](buf2, buf3, 16, 16, XBLOCK=
16, YBLOCK=16, num_warps=4, num_stages=1)
buf4 = reinterpret_tensor(buf2, (4, 4, 16), (64, 16, 1), 0)
del buf2
extern_kernels.bmm(arg2_1, buf3, out=buf4)
del arg2_1
return reinterpret_tensor(buf4, (4, 4, 4, 4), (64, 16, 4, 1), 0
), reinterpret_tensor(buf3, (4, 4, 4, 4), (64, 16, 4, 1), 0)
class GlobalAttentionGeneralNew(nn.Module):
def __init__(self, idf, cdf):
super(GlobalAttentionGeneralNew, self).__init__()
self.sm = nn.Softmax()
self.mask = None
def applyMask(self, mask):
self.mask = mask
def forward(self, input_0, input_1, input_2):
arg0_1 = input_0
arg1_1 = input_1
arg2_1 = input_2
output = call([arg0_1, arg1_1, arg2_1])
return output[0], output[1]
|
Creling/DM-GAN
|
GlobalAttentionGeneral
| false | 2,120 |
[
"MIT"
] | 0 |
ec2ce6d7fae4cf3ba2099b3db09926e544b2b759
|
https://github.com/Creling/DM-GAN/tree/ec2ce6d7fae4cf3ba2099b3db09926e544b2b759
|
marginLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/2f/c2ftqwnzyif6anm5yrd4wgshpwysy7vz2nbhztuwsnnrzkbr252x.py
# Topologically Sorted Source Nodes: [sub, val, zeros_like, max_1, sum_1], Original ATen: [aten.sub, aten.add, aten.zeros_like, aten.maximum, aten.sum]
# Source node to ATen node mapping:
# max_1 => maximum
# sub => sub
# sum_1 => sum_1
# val => add
# zeros_like => full_default
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %arg1_1), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sub, %arg2_1), kwargs = {})
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([4, 4, 4, 4], 0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %maximum : [num_users=1] = call_function[target=torch.ops.aten.maximum.default](args = (%add, %full_default), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%maximum,), kwargs = {})
triton_per_fused_add_maximum_sub_sum_zeros_like_0 = async_compile.triton('triton_per_fused_add_maximum_sub_sum_zeros_like_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {4: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 5), equal_to_1=(4,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_maximum_sub_sum_zeros_like_0', 'mutated_arg_names': [], 'no_x_dim': True, 'num_load': 3, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_maximum_sub_sum_zeros_like_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.load(in_ptr1 + (r0), None)
tmp3 = tl.load(in_ptr2 + (r0), None)
tmp2 = tmp0 - tmp1
tmp4 = tmp2 + tmp3
tmp5 = 0.0
tmp6 = triton_helpers.maximum(tmp4, tmp5)
tmp7 = tl.broadcast_to(tmp6, [RBLOCK])
tmp9 = triton_helpers.promote_to_tensor(tl.sum(tmp7, 0))
tl.store(out_ptr0 + (tl.full([1], 0, tl.int32)), tmp9, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
# Topologically Sorted Source Nodes: [sub, val, zeros_like, max_1, sum_1], Original ATen: [aten.sub, aten.add, aten.zeros_like, aten.maximum, aten.sum]
stream0 = get_raw_stream(0)
triton_per_fused_add_maximum_sub_sum_zeros_like_0.run(arg0_1, arg1_1, arg2_1, buf0, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
del arg2_1
return (buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg2_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1, arg2_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class marginLoss(nn.Module):
def __init__(self):
super(marginLoss, self).__init__()
def forward(self, pos, neg, margin):
val = pos - neg + margin
return torch.sum(torch.max(val, torch.zeros_like(val)))
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4]), torch.rand(
[4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_maximum_sub_sum_zeros_like_0(in_ptr0, in_ptr1,
in_ptr2, out_ptr0, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.load(in_ptr1 + r0, None)
tmp3 = tl.load(in_ptr2 + r0, None)
tmp2 = tmp0 - tmp1
tmp4 = tmp2 + tmp3
tmp5 = 0.0
tmp6 = triton_helpers.maximum(tmp4, tmp5)
tmp7 = tl.broadcast_to(tmp6, [RBLOCK])
tmp9 = triton_helpers.promote_to_tensor(tl.sum(tmp7, 0))
tl.store(out_ptr0 + tl.full([1], 0, tl.int32), tmp9, None)
def call(args):
arg0_1, arg1_1, arg2_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg2_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
get_raw_stream(0)
triton_per_fused_add_maximum_sub_sum_zeros_like_0[grid(1)](arg0_1,
arg1_1, arg2_1, buf0, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
del arg2_1
return buf0,
class marginLossNew(nn.Module):
def __init__(self):
super(marginLossNew, self).__init__()
def forward(self, input_0, input_1, input_2):
arg0_1 = input_0
arg1_1 = input_1
arg2_1 = input_2
output = call([arg0_1, arg1_1, arg2_1])
return output[0]
|
DSRnD/UMLs
|
marginLoss
| false | 2,121 |
[
"MIT"
] | 0 |
a524bc45bc3f2dc8b4a90f73f69e23ee36ba8be9
|
https://github.com/DSRnD/UMLs/tree/a524bc45bc3f2dc8b4a90f73f69e23ee36ba8be9
|
GCN
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/be/cbej2f3myglhqo2dienhyo4fp7tbscq32k7imbgc2psgl6gaxxhi.py
# Topologically Sorted Source Nodes: [add, x], Original ATen: [aten.add, aten.relu]
# Source node to ATen node mapping:
# add => add
# x => relu
# Graph fragment:
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mm_1, %primals_4), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%add,), kwargs = {})
triton_poi_fused_add_relu_0 = async_compile.triton('triton_poi_fused_add_relu_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_relu_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_relu_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4, 4), (4, 1))
assert_size_stride(primals_4, (4, ), (1, ))
assert_size_stride(primals_5, (4, 4), (4, 1))
assert_size_stride(primals_6, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [support], Original ATen: [aten.mm]
extern_kernels.mm(primals_2, primals_1, out=buf0)
del primals_1
buf1 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [output], Original ATen: [aten.mm]
extern_kernels.mm(primals_3, buf0, out=buf1)
buf2 = buf1; del buf1 # reuse
# Topologically Sorted Source Nodes: [add, x], Original ATen: [aten.add, aten.relu]
stream0 = get_raw_stream(0)
triton_poi_fused_add_relu_0.run(buf2, primals_4, 16, grid=grid(16), stream=stream0)
del primals_4
buf3 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [support_1], Original ATen: [aten.mm]
extern_kernels.mm(buf2, primals_5, out=buf3)
buf4 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.addmm(primals_6, primals_3, buf3, alpha=1, beta=1, out=buf4)
del buf3
del primals_6
return (buf4, buf2, reinterpret_tensor(primals_3, (4, 4), (1, 4), 0), reinterpret_tensor(primals_5, (4, 4), (1, 4), 0), reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
from torch.nn import Module
import math
import torch
from torch.nn.parameter import Parameter
from torch.nn.modules.module import Module
class GraphConvolution(Module):
def __init__(self, in_features, out_features, bias=True):
super(GraphConvolution, self).__init__()
self.in_features = in_features
self.out_features = out_features
self.weight = Parameter(torch.FloatTensor(in_features, out_features))
if bias:
self.bias = Parameter(torch.FloatTensor(out_features))
else:
self.register_parameter('bias', None)
self.reset_parameters()
def reset_parameters(self):
stdv = 1.0 / math.sqrt(self.weight.size(1))
self.weight.data.uniform_(-stdv, stdv)
if self.bias is not None:
self.bias.data.uniform_(-stdv, stdv)
def forward(self, input, adj):
support = torch.mm(input, self.weight)
output = torch.spmm(adj, support)
if self.bias is not None:
return output + self.bias
else:
return output
def __repr__(self):
return self.__class__.__name__ + ' (' + str(self.in_features
) + ' -> ' + str(self.out_features) + ')'
class GCN(Module):
def __init__(self, nfeat, nhid, nclass, dropout):
super(GCN, self).__init__()
self.gc1 = GraphConvolution(nfeat, nhid)
self.gc2 = GraphConvolution(nhid, nclass)
self.dropout = dropout
def forward(self, x, adj):
x = torch.nn.functional.relu(self.gc1(x, adj))
x = torch.nn.functional.dropout(x, self.dropout, training=self.training
)
x = self.gc2(x, adj)
return x
def get_inputs():
return [torch.rand([4, 4]), torch.rand([4, 4])]
def get_init_inputs():
return [[], {'nfeat': 4, 'nhid': 4, 'nclass': 4, 'dropout': 0.5}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch.nn import Module
import math
from torch.nn.parameter import Parameter
from torch.nn.modules.module import Module
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_add_relu_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + x2, tmp4, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (4, 4), (4, 1))
assert_size_stride(primals_4, (4,), (1,))
assert_size_stride(primals_5, (4, 4), (4, 1))
assert_size_stride(primals_6, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(primals_2, primals_1, out=buf0)
del primals_1
buf1 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(primals_3, buf0, out=buf1)
buf2 = buf1
del buf1
get_raw_stream(0)
triton_poi_fused_add_relu_0[grid(16)](buf2, primals_4, 16, XBLOCK=
16, num_warps=1, num_stages=1)
del primals_4
buf3 = buf0
del buf0
extern_kernels.mm(buf2, primals_5, out=buf3)
buf4 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_6, primals_3, buf3, alpha=1, beta=1,
out=buf4)
del buf3
del primals_6
return buf4, buf2, reinterpret_tensor(primals_3, (4, 4), (1, 4), 0
), reinterpret_tensor(primals_5, (4, 4), (1, 4), 0
), reinterpret_tensor(primals_2, (4, 4), (1, 4), 0)
class GraphConvolution(Module):
def __init__(self, in_features, out_features, bias=True):
super(GraphConvolution, self).__init__()
self.in_features = in_features
self.out_features = out_features
self.weight = Parameter(torch.FloatTensor(in_features, out_features))
if bias:
self.bias = Parameter(torch.FloatTensor(out_features))
else:
self.register_parameter('bias', None)
self.reset_parameters()
def reset_parameters(self):
stdv = 1.0 / math.sqrt(self.weight.size(1))
self.weight.data.uniform_(-stdv, stdv)
if self.bias is not None:
self.bias.data.uniform_(-stdv, stdv)
def forward(self, input, adj):
support = torch.mm(input, self.weight)
output = torch.spmm(adj, support)
if self.bias is not None:
return output + self.bias
else:
return output
def __repr__(self):
return self.__class__.__name__ + ' (' + str(self.in_features
) + ' -> ' + str(self.out_features) + ')'
class GCNNew(Module):
def __init__(self, nfeat, nhid, nclass, dropout):
super(GCNNew, self).__init__()
self.gc1 = GraphConvolution(nfeat, nhid)
self.gc2 = GraphConvolution(nhid, nclass)
self.dropout = dropout
def forward(self, input_0, input_1):
primals_1 = self.gc1.weight
primals_4 = self.gc1.bias
primals_2 = self.gc2.weight
primals_6 = self.gc2.bias
primals_3 = input_0
primals_5 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6])
return output[0]
|
CaiYufan-sjtu/GCNOIE
|
GCN
| false | 2,122 |
[
"MIT"
] | 0 |
c84afca5b66d75c7108b2719241e2907700b4111
|
https://github.com/CaiYufan-sjtu/GCNOIE/tree/c84afca5b66d75c7108b2719241e2907700b4111
|
MinibatchStdLayer
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/go/cgoemonetravwhfs3jooeia74m347lerealmmkenwlxtxtvgz7ov.py
# Topologically Sorted Source Nodes: [mean, y_2, cat], Original ATen: [aten.mean, aten.sub, aten.cat]
# Source node to ATen node mapping:
# cat => cat
# mean => mean
# y_2 => sub
# Graph fragment:
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%view, [0], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view, %mean), kwargs = {})
# %cat : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_1, %repeat], 1), kwargs = {})
# %copy_ : [num_users=0] = call_function[target=torch.ops.aten.copy_.default](args = (%arg0_1, %view_1), kwargs = {})
triton_poi_fused_cat_mean_sub_0 = async_compile.triton('triton_poi_fused_cat_mean_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 16], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_mean_sub_0', 'mutated_arg_names': ['in_ptr0', 'out_ptr2'], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_mean_sub_0(in_ptr0, out_ptr0, out_ptr1, out_ptr2, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = (yindex // 4)
tmp0 = tl.load(in_ptr0 + (x2 + (16*y3)), xmask & ymask)
tmp1 = tl.load(in_ptr0 + (x2 + (16*y0)), xmask & ymask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (64 + x2 + (16*y0)), xmask & ymask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (128 + x2 + (16*y0)), xmask & ymask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (192 + x2 + (16*y0)), xmask & ymask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = 4.0
tmp9 = tmp7 / tmp8
tmp10 = tmp0 - tmp9
tl.store(out_ptr0 + (x2 + (16*y3)), tmp10, xmask & ymask)
tl.store(out_ptr1 + (y0 + (5*x2) + (80*y1)), tmp10, xmask & ymask)
tl.store(out_ptr2 + (x2 + (16*y3)), tmp10, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/tl/ctlfmtteinb5u2bql6kyywc3hcmvjjgvvzdvxbyqu6lni6htenbp.py
# Topologically Sorted Source Nodes: [pow_1, y_3, add, y_4, y_5, y_6], Original ATen: [aten.pow, aten.mean, aten.add, aten.sqrt, aten.repeat]
# Source node to ATen node mapping:
# add => add
# pow_1 => pow_1
# y_3 => mean_1
# y_4 => sqrt
# y_5 => mean_2
# y_6 => repeat
# Graph fragment:
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%view_2, 2), kwargs = {})
# %mean_1 : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%pow_1, [0]), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mean_1, 1e-08), kwargs = {})
# %sqrt : [num_users=1] = call_function[target=torch.ops.aten.sqrt.default](args = (%add,), kwargs = {})
# %mean_2 : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%sqrt, [1, 2, 3], True), kwargs = {})
# %repeat : [num_users=1] = call_function[target=torch.ops.aten.repeat.default](args = (%mean_2, [4, 1, 4, 4]), kwargs = {})
triton_per_fused_add_mean_pow_repeat_sqrt_1 = async_compile.triton('triton_per_fused_add_mean_pow_repeat_sqrt_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 64],
reduction_hint=ReductionHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {2: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 3), equal_to_1=(2,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_mean_pow_repeat_sqrt_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_mean_pow_repeat_sqrt_1(in_ptr0, out_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 1
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp2 = tl.load(in_ptr0 + (64 + r0), None)
tmp5 = tl.load(in_ptr0 + (128 + r0), None)
tmp8 = tl.load(in_ptr0 + (192 + r0), None)
tmp1 = tmp0 * tmp0
tmp3 = tmp2 * tmp2
tmp4 = tmp1 + tmp3
tmp6 = tmp5 * tmp5
tmp7 = tmp4 + tmp6
tmp9 = tmp8 * tmp8
tmp10 = tmp7 + tmp9
tmp11 = 4.0
tmp12 = tmp10 / tmp11
tmp13 = 1e-08
tmp14 = tmp12 + tmp13
tmp15 = libdevice.sqrt(tmp14)
tmp16 = tl.broadcast_to(tmp15, [XBLOCK, RBLOCK])
tmp18 = tl.sum(tmp16, 1)[:, None]
tmp19 = 64.0
tmp20 = tmp18 / tmp19
tl.store(out_ptr1 + (tl.broadcast_to(5*r0, [XBLOCK, RBLOCK])), tmp20, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/sq/csq5p5npd3y3y7ildbzjhvet23a4o7ft5qvuurgkbcn5n4nyiuc5.py
# Topologically Sorted Source Nodes: [cat], Original ATen: [aten.cat]
# Source node to ATen node mapping:
# cat => cat
# Graph fragment:
# %cat : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view_1, %repeat], 1), kwargs = {})
triton_poi_fused_cat_2 = async_compile.triton('triton_poi_fused_cat_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[32, 16], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_2(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 20
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 5
y1 = (yindex // 5)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (5*x2) + (80*y1)), xmask & ymask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + (16*y3)), tmp0, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 1, 4, 4, 4), (64, 256, 16, 4, 1), torch.float32)
buf4 = empty_strided_cuda((4, 5, 4, 4), (80, 1, 20, 5), torch.float32)
buf2 = reinterpret_tensor(buf4, (4, 4, 4, 4), (80, 1, 20, 5), 0) # alias
# Topologically Sorted Source Nodes: [mean, y_2, cat], Original ATen: [aten.mean, aten.sub, aten.cat]
stream0 = get_raw_stream(0)
triton_poi_fused_cat_mean_sub_0.run(arg0_1, buf0, buf2, arg0_1, 16, 16, grid=grid(16, 16), stream=stream0)
del arg0_1
buf3 = reinterpret_tensor(buf4, (4, 1, 4, 4), (80, 1, 20, 5), 4) # alias
# Topologically Sorted Source Nodes: [pow_1, y_3, add, y_4, y_5, y_6], Original ATen: [aten.pow, aten.mean, aten.add, aten.sqrt, aten.repeat]
triton_per_fused_add_mean_pow_repeat_sqrt_1.run(buf0, buf3, 1, 64, grid=grid(1), stream=stream0)
del buf0
buf5 = empty_strided_cuda((4, 5, 4, 4), (80, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [cat], Original ATen: [aten.cat]
triton_poi_fused_cat_2.run(buf4, buf5, 20, 16, grid=grid(20, 16), stream=stream0)
del buf2
del buf3
del buf4
return (buf5, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class MinibatchStdLayer(nn.Module):
def __init__(self):
super().__init__()
def forward(self, x, group_size=4):
group_size = min(group_size, x.shape[0])
_channels, height, width = x.shape[1:]
y = x.view(group_size, -1, *x.shape[1:])
y = y.float()
y -= y.mean(dim=0, keepdim=True)
y = y.pow(2).mean(dim=0)
y = (y + 1e-08).sqrt()
y = y.mean(dim=[1, 2, 3], keepdim=True)
y = y.repeat(group_size, 1, height, width)
return torch.cat((x, y), dim=1)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_cat_mean_sub_0(in_ptr0, out_ptr0, out_ptr1, out_ptr2,
ynumel, xnumel, YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = yindex // 4
tmp0 = tl.load(in_ptr0 + (x2 + 16 * y3), xmask & ymask)
tmp1 = tl.load(in_ptr0 + (x2 + 16 * y0), xmask & ymask, eviction_policy
='evict_last')
tmp2 = tl.load(in_ptr0 + (64 + x2 + 16 * y0), xmask & ymask,
eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (128 + x2 + 16 * y0), xmask & ymask,
eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (192 + x2 + 16 * y0), xmask & ymask,
eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = 4.0
tmp9 = tmp7 / tmp8
tmp10 = tmp0 - tmp9
tl.store(out_ptr0 + (x2 + 16 * y3), tmp10, xmask & ymask)
tl.store(out_ptr1 + (y0 + 5 * x2 + 80 * y1), tmp10, xmask & ymask)
tl.store(out_ptr2 + (x2 + 16 * y3), tmp10, xmask & ymask)
@triton.jit
def triton_per_fused_add_mean_pow_repeat_sqrt_1(in_ptr0, out_ptr1, xnumel,
rnumel, XBLOCK: tl.constexpr):
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xoffset + tl.arange(0, XBLOCK)[:, None]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp2 = tl.load(in_ptr0 + (64 + r0), None)
tmp5 = tl.load(in_ptr0 + (128 + r0), None)
tmp8 = tl.load(in_ptr0 + (192 + r0), None)
tmp1 = tmp0 * tmp0
tmp3 = tmp2 * tmp2
tmp4 = tmp1 + tmp3
tmp6 = tmp5 * tmp5
tmp7 = tmp4 + tmp6
tmp9 = tmp8 * tmp8
tmp10 = tmp7 + tmp9
tmp11 = 4.0
tmp12 = tmp10 / tmp11
tmp13 = 1e-08
tmp14 = tmp12 + tmp13
tmp15 = libdevice.sqrt(tmp14)
tmp16 = tl.broadcast_to(tmp15, [XBLOCK, RBLOCK])
tmp18 = tl.sum(tmp16, 1)[:, None]
tmp19 = 64.0
tmp20 = tmp18 / tmp19
tl.store(out_ptr1 + tl.broadcast_to(5 * r0, [XBLOCK, RBLOCK]), tmp20, None)
@triton.jit
def triton_poi_fused_cat_2(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
ynumel = 20
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 5
y1 = yindex // 5
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 5 * x2 + 80 * y1), xmask & ymask,
eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + 16 * y3), tmp0, xmask & ymask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 1, 4, 4, 4), (64, 256, 16, 4, 1),
torch.float32)
buf4 = empty_strided_cuda((4, 5, 4, 4), (80, 1, 20, 5), torch.float32)
buf2 = reinterpret_tensor(buf4, (4, 4, 4, 4), (80, 1, 20, 5), 0)
get_raw_stream(0)
triton_poi_fused_cat_mean_sub_0[grid(16, 16)](arg0_1, buf0, buf2,
arg0_1, 16, 16, XBLOCK=16, YBLOCK=16, num_warps=4, num_stages=1)
del arg0_1
buf3 = reinterpret_tensor(buf4, (4, 1, 4, 4), (80, 1, 20, 5), 4)
triton_per_fused_add_mean_pow_repeat_sqrt_1[grid(1)](buf0, buf3, 1,
64, XBLOCK=1, num_warps=2, num_stages=1)
del buf0
buf5 = empty_strided_cuda((4, 5, 4, 4), (80, 16, 4, 1), torch.float32)
triton_poi_fused_cat_2[grid(20, 16)](buf4, buf5, 20, 16, XBLOCK=16,
YBLOCK=32, num_warps=4, num_stages=1)
del buf2
del buf3
del buf4
return buf5,
class MinibatchStdLayerNew(nn.Module):
def __init__(self):
super().__init__()
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
DannyDannyDanny/DeepPrivacy
|
MinibatchStdLayer
| false | 2,123 |
[
"MIT"
] | 0 |
749e260bdcc28a0c12d526f24e4f5315d1b447ad
|
https://github.com/DannyDannyDanny/DeepPrivacy/tree/749e260bdcc28a0c12d526f24e4f5315d1b447ad
|
MLP_Attention
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/da/cdanqyglcbodatp5d7x2cib5wtsqw7kak4rhmmkvuwq2rlebqmg3.py
# Topologically Sorted Source Nodes: [stacking_X, stacking_ref, add, tanh], Original ATen: [aten.repeat, aten.add, aten.tanh]
# Source node to ATen node mapping:
# add => add
# stacking_X => repeat
# stacking_ref => repeat_1
# tanh => tanh
# Graph fragment:
# %repeat : [num_users=1] = call_function[target=torch.ops.aten.repeat.default](args = (%view_2, [1, 1, 4, 1]), kwargs = {})
# %repeat_1 : [num_users=1] = call_function[target=torch.ops.aten.repeat.default](args = (%view_5, [1, 4, 1, 1]), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%repeat, %repeat_1), kwargs = {})
# %tanh : [num_users=2] = call_function[target=torch.ops.aten.tanh.default](args = (%add,), kwargs = {})
triton_poi_fused_add_repeat_tanh_0 = async_compile.triton('triton_poi_fused_add_repeat_tanh_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_repeat_tanh_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_repeat_tanh_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x4 = (xindex // 16)
x3 = (xindex // 64)
x5 = xindex % 16
x6 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (4*x4)), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x5 + (16*x3)), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = libdevice.tanh(tmp2)
tl.store(out_ptr0 + (x6), tmp3, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/dm/cdmkcxuzpnailvibeivaikqdr4zvashgzwju7qijhq5aizlo3aor.py
# Topologically Sorted Source Nodes: [attention_scores], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# attention_scores => amax, exp, sub
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%squeeze, [1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%squeeze, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
triton_poi_fused__softmax_1 = async_compile.triton('triton_poi_fused__softmax_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 4
x2 = (xindex // 16)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (16*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (4 + x0 + (16*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (8 + x0 + (16*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (12 + x0 + (16*x2)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + (x3), tmp9, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/kt/cktghousutx6xui2sl2rvevzmb7gkacvfhntjq5n2xzeu7v57oz6.py
# Topologically Sorted Source Nodes: [attention_scores], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# attention_scores => div, sum_1
# Graph fragment:
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [1], True), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
triton_poi_fused__softmax_2 = async_compile.triton('triton_poi_fused__softmax_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_2(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 4
x2 = (xindex // 16)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (16*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (4 + x0 + (16*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (8 + x0 + (16*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (12 + x0 + (16*x2)), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + (x3), tmp8, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_3, (4, 4), (4, 1))
assert_size_stride(primals_4, (4, ), (1, ))
assert_size_stride(primals_5, (4, 4), (4, 1))
assert_size_stride(primals_6, (4, ), (1, ))
assert_size_stride(primals_7, (1, 4), (4, 1))
assert_size_stride(primals_8, (1, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_4, reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_3, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_3
del primals_4
buf1 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_1], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_6, reinterpret_tensor(primals_2, (16, 4), (4, 1), 0), reinterpret_tensor(primals_5, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf1)
del primals_5
del primals_6
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [stacking_X, stacking_ref, add, tanh], Original ATen: [aten.repeat, aten.add, aten.tanh]
stream0 = get_raw_stream(0)
triton_poi_fused_add_repeat_tanh_0.run(buf0, buf1, buf2, 256, grid=grid(256), stream=stream0)
buf4 = reinterpret_tensor(buf1, (64, 1), (1, 1), 0); del buf1 # reuse
# Topologically Sorted Source Nodes: [linear_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_8, reinterpret_tensor(buf2, (64, 4), (4, 1), 0), reinterpret_tensor(primals_7, (4, 1), (1, 4), 0), alpha=1, beta=1, out=buf4)
del primals_8
buf5 = reinterpret_tensor(buf0, (4, 4, 4), (16, 4, 1), 0); del buf0 # reuse
# Topologically Sorted Source Nodes: [attention_scores], Original ATen: [aten._softmax]
triton_poi_fused__softmax_1.run(buf4, buf5, 64, grid=grid(64), stream=stream0)
buf6 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [attention_scores], Original ATen: [aten._softmax]
triton_poi_fused__softmax_2.run(buf5, buf6, 64, grid=grid(64), stream=stream0)
buf7 = buf5; del buf5 # reuse
# Topologically Sorted Source Nodes: [weighted_X], Original ATen: [aten.bmm]
extern_kernels.bmm(reinterpret_tensor(primals_1, (4, 4, 4), (16, 1, 4), 0), buf6, out=buf7)
del buf6
return (reinterpret_tensor(buf7, (4, 4, 4), (16, 1, 4), 0), primals_1, reinterpret_tensor(primals_2, (16, 4), (4, 1), 0), buf2, buf4, primals_7, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((1, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((1, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.init as init
class MLP_Attention(nn.Module):
def __init__(self, input_size, hidden_size):
super(MLP_Attention, self).__init__()
self.linear_X = nn.Linear(input_size, hidden_size, bias=True)
self.linear_ref = nn.Linear(input_size, hidden_size, bias=True)
self.v = nn.Linear(hidden_size, out_features=1)
def init_weight(self):
init.xavier_normal_(self.linear_X.weight)
init.xavier_normal_(self.linear_ref.weight)
init.xavier_normal_(self.v.weight)
init.constant_(self.linear1.bias, 0.0)
init.constant_(self.linear2.bias, 0.0)
init.constant_(self.v.bias, 0.0)
def forward(self, X, ref):
batch_size, n_X, _ = X.shape
_, n_ref, _ = ref.shape
stacking_X = self.linear_X(X).view(batch_size, n_X, 1, -1).repeat(1,
1, n_ref, 1)
stacking_ref = self.linear_ref(ref).view(batch_size, 1, n_ref, -1
).repeat(1, n_X, 1, 1)
out = self.v(torch.tanh(stacking_X + stacking_ref)).squeeze()
attention_scores = torch.softmax(out, dim=1)
weighted_X = torch.einsum('bxe,bxr->bre', X, attention_scores)
return weighted_X
def get_inputs():
return [torch.rand([4, 4, 4]), torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'input_size': 4, 'hidden_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
import torch.nn.init as init
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_add_repeat_tanh_0(in_ptr0, in_ptr1, out_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x4 = xindex // 16
x3 = xindex // 64
x5 = xindex % 16
x6 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 4 * x4), xmask, eviction_policy='evict_last'
)
tmp1 = tl.load(in_ptr1 + (x5 + 16 * x3), xmask, eviction_policy=
'evict_last')
tmp2 = tmp0 + tmp1
tmp3 = libdevice.tanh(tmp2)
tl.store(out_ptr0 + x6, tmp3, xmask)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 4
x2 = xindex // 16
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (4 + x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (8 + x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (12 + x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + x3, tmp9, xmask)
@triton.jit
def triton_poi_fused__softmax_2(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 4
x2 = xindex // 16
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (4 + x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (8 + x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (12 + x0 + 16 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + x3, tmp8, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_3, (4, 4), (4, 1))
assert_size_stride(primals_4, (4,), (1,))
assert_size_stride(primals_5, (4, 4), (4, 1))
assert_size_stride(primals_6, (4,), (1,))
assert_size_stride(primals_7, (1, 4), (4, 1))
assert_size_stride(primals_8, (1,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_4, reinterpret_tensor(primals_1, (16,
4), (4, 1), 0), reinterpret_tensor(primals_3, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf0)
del primals_3
del primals_4
buf1 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_6, reinterpret_tensor(primals_2, (16,
4), (4, 1), 0), reinterpret_tensor(primals_5, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf1)
del primals_5
del primals_6
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_add_repeat_tanh_0[grid(256)](buf0, buf1, buf2, 256,
XBLOCK=128, num_warps=4, num_stages=1)
buf4 = reinterpret_tensor(buf1, (64, 1), (1, 1), 0)
del buf1
extern_kernels.addmm(primals_8, reinterpret_tensor(buf2, (64, 4), (
4, 1), 0), reinterpret_tensor(primals_7, (4, 1), (1, 4), 0),
alpha=1, beta=1, out=buf4)
del primals_8
buf5 = reinterpret_tensor(buf0, (4, 4, 4), (16, 4, 1), 0)
del buf0
triton_poi_fused__softmax_1[grid(64)](buf4, buf5, 64, XBLOCK=64,
num_warps=1, num_stages=1)
buf6 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
triton_poi_fused__softmax_2[grid(64)](buf5, buf6, 64, XBLOCK=64,
num_warps=1, num_stages=1)
buf7 = buf5
del buf5
extern_kernels.bmm(reinterpret_tensor(primals_1, (4, 4, 4), (16, 1,
4), 0), buf6, out=buf7)
del buf6
return reinterpret_tensor(buf7, (4, 4, 4), (16, 1, 4), 0
), primals_1, reinterpret_tensor(primals_2, (16, 4), (4, 1), 0
), buf2, buf4, primals_7
class MLP_AttentionNew(nn.Module):
def __init__(self, input_size, hidden_size):
super(MLP_AttentionNew, self).__init__()
self.linear_X = nn.Linear(input_size, hidden_size, bias=True)
self.linear_ref = nn.Linear(input_size, hidden_size, bias=True)
self.v = nn.Linear(hidden_size, out_features=1)
def init_weight(self):
init.xavier_normal_(self.linear_X.weight)
init.xavier_normal_(self.linear_ref.weight)
init.xavier_normal_(self.v.weight)
init.constant_(self.linear1.bias, 0.0)
init.constant_(self.linear2.bias, 0.0)
init.constant_(self.v.bias, 0.0)
def forward(self, input_0, input_1):
primals_3 = self.linear_X.weight
primals_4 = self.linear_X.bias
primals_5 = self.linear_ref.weight
primals_6 = self.linear_ref.bias
primals_7 = self.v.weight
primals_8 = self.v.bias
primals_1 = input_0
primals_2 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8])
return output[0]
|
Coldog2333/DGMN-pytorch
|
MLP_Attention
| false | 2,124 |
[
"Apache-2.0"
] | 0 |
c34248afca516625c2ac2fc6d6f4ce8fe2988c99
|
https://github.com/Coldog2333/DGMN-pytorch/tree/c34248afca516625c2ac2fc6d6f4ce8fe2988c99
|
DiceLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/qz/cqza6p5fjiie2hfiu5dfjqqugrnzziwuwxzlhzy2aa7khopxjbym.py
# Topologically Sorted Source Nodes: [output], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# output => amax, exp, sub
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%arg0_1, [1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%arg0_1, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
triton_poi_fused__softmax_0 = async_compile.triton('triton_poi_fused__softmax_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + (x3), tmp9, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/ow/cowcmfm2nngivhyq4bs2mbwucbdqfobg6iiyxzaiowjvardl53yg.py
# Topologically Sorted Source Nodes: [contiguous], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# contiguous => clone
# Graph fragment:
# %clone : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_1 = async_compile.triton('triton_poi_fused_clone_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = (xindex // 64)
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + (64*x2)), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + (x3), tmp8, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/bh/cbh2bmdr7w3qvbew4pqw4afcg6vw2r54b5y4we3wgnpjykfrrvgk.py
# Topologically Sorted Source Nodes: [mul, sum_1, add_1, sum_3], Original ATen: [aten.mul, aten.sum, aten.add]
# Source node to ATen node mapping:
# add_1 => add_1
# mul => mul
# sum_1 => sum_2
# sum_3 => sum_4
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view, %view_1), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%mul, [-1]), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view, %view_1), kwargs = {})
# %sum_4 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%add_1, [-1]), kwargs = {})
triton_per_fused_add_mul_sum_2 = async_compile.triton('triton_per_fused_add_mul_sum_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[4, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_mul_sum_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 2, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_mul_sum_2(in_ptr0, in_ptr1, out_ptr0, out_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 4
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + ((16*x0) + (64*(r1 // 16)) + (r1 % 16)), xmask, other=0.0)
tmp1 = tl.load(in_ptr1 + ((16*x0) + (64*(r1 // 16)) + (r1 % 16)), xmask, other=0.0)
tmp2 = tmp0 * tmp1
tmp3 = tl.broadcast_to(tmp2, [XBLOCK, RBLOCK])
tmp5 = tl.where(xmask, tmp3, 0)
tmp6 = tl.sum(tmp5, 1)[:, None]
tmp7 = tmp0 + tmp1
tmp8 = tl.broadcast_to(tmp7, [XBLOCK, RBLOCK])
tmp10 = tl.where(xmask, tmp8, 0)
tmp11 = tl.sum(tmp10, 1)[:, None]
tl.store(out_ptr0 + (x0), tmp6, xmask)
tl.store(out_ptr1 + (x0), tmp11, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/d7/cd7f727anrqxy43435rf2xybxjucbvc5yya7lh63kacwvtmuizu4.py
# Topologically Sorted Source Nodes: [sum_2, intersect, sum_4, denominator, dice, dice_1, sub], Original ATen: [aten.sum, aten.add, aten.div, aten.mean, aten.rsub]
# Source node to ATen node mapping:
# denominator => add_2
# dice => div_1
# dice_1 => mean
# intersect => add
# sub => sub_1
# sum_2 => sum_3
# sum_4 => sum_5
# Graph fragment:
# %sum_3 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%sum_2,), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sum_3, 1e-05), kwargs = {})
# %sum_5 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%sum_4,), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sum_5, 1e-05), kwargs = {})
# %div_1 : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%add, %add_2), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%div_1,), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %mean), kwargs = {})
triton_per_fused_add_div_mean_rsub_sum_3 = async_compile.triton('triton_per_fused_add_div_mean_rsub_sum_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 4],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_div_mean_rsub_sum_3', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 2, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_div_mean_rsub_sum_3(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 1
rnumel = 4
RBLOCK: tl.constexpr = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp4 = tl.load(in_ptr1 + (r0), None)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.sum(tmp1, 1)[:, None]
tmp5 = tl.broadcast_to(tmp4, [XBLOCK, RBLOCK])
tmp7 = tl.sum(tmp5, 1)[:, None]
tmp8 = 1e-05
tmp9 = tmp3 + tmp8
tmp10 = tmp7 + tmp8
tmp11 = tmp9 / tmp10
tmp12 = 1.0
tmp13 = tmp11 / tmp12
tmp14 = tmp12 - tmp13
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([XBLOCK, 1], 0, tl.int32)), tmp14, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [output], Original ATen: [aten._softmax]
stream0 = get_raw_stream(0)
triton_poi_fused__softmax_0.run(arg0_1, buf0, 256, grid=grid(256), stream=stream0)
del arg0_1
buf1 = empty_strided_cuda((4, 4, 4, 4), (16, 64, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [contiguous], Original ATen: [aten.clone]
triton_poi_fused_clone_1.run(buf0, buf1, 256, grid=grid(256), stream=stream0)
del buf0
buf2 = empty_strided_cuda((4, ), (1, ), torch.float32)
buf4 = empty_strided_cuda((4, ), (1, ), torch.float32)
# Topologically Sorted Source Nodes: [mul, sum_1, add_1, sum_3], Original ATen: [aten.mul, aten.sum, aten.add]
triton_per_fused_add_mul_sum_2.run(buf1, arg1_1, buf2, buf4, 4, 64, grid=grid(4), stream=stream0)
del arg1_1
del buf1
buf3 = empty_strided_cuda((), (), torch.float32)
buf6 = buf3; del buf3 # reuse
# Topologically Sorted Source Nodes: [sum_2, intersect, sum_4, denominator, dice, dice_1, sub], Original ATen: [aten.sum, aten.add, aten.div, aten.mean, aten.rsub]
triton_per_fused_add_div_mean_rsub_sum_3.run(buf6, buf2, buf4, 1, 4, grid=grid(1), stream=stream0)
del buf2
del buf4
return (buf6, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
from torch import optim as optim
def flatten(tensor):
"""Flattens a given tensor such that the channel axis is first.
The shapes are transformed as follows:
(N, C, D, H, W) -> (C, N * D * H * W)
"""
C = tensor.size(1)
axis_order = (1, 0) + tuple(range(2, tensor.dim()))
transposed = tensor.permute(axis_order)
return transposed.contiguous().view(C, -1)
class DiceLoss(nn.Module):
def __init__(self):
super().__init__()
self.epsilon = 1e-05
def forward(self, output, target):
assert output.size() == target.size(
), "'input' and 'target' must have the same shape"
output = F.softmax(output, dim=1)
output = flatten(output)
target = flatten(target)
intersect = (output * target).sum(-1).sum() + self.epsilon
denominator = (output + target).sum(-1).sum() + self.epsilon
dice = intersect / denominator
dice = torch.mean(dice)
return 1 - dice
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
from torch import optim as optim
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused__softmax_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = triton_helpers.maximum(tmp1, tmp2)
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp7 = triton_helpers.maximum(tmp5, tmp6)
tmp8 = tmp0 - tmp7
tmp9 = tl_math.exp(tmp8)
tl.store(out_ptr0 + x3, tmp9, xmask)
@triton.jit
def triton_poi_fused_clone_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 16
x2 = xindex // 64
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp2 = tl.load(in_ptr0 + (16 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp4 = tl.load(in_ptr0 + (32 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp6 = tl.load(in_ptr0 + (48 + x0 + 64 * x2), xmask, eviction_policy=
'evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + x3, tmp8, xmask)
@triton.jit
def triton_per_fused_add_mul_sum_2(in_ptr0, in_ptr1, out_ptr0, out_ptr1,
xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 4
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (16 * x0 + 64 * (r1 // 16) + r1 % 16), xmask,
other=0.0)
tmp1 = tl.load(in_ptr1 + (16 * x0 + 64 * (r1 // 16) + r1 % 16), xmask,
other=0.0)
tmp2 = tmp0 * tmp1
tmp3 = tl.broadcast_to(tmp2, [XBLOCK, RBLOCK])
tmp5 = tl.where(xmask, tmp3, 0)
tmp6 = tl.sum(tmp5, 1)[:, None]
tmp7 = tmp0 + tmp1
tmp8 = tl.broadcast_to(tmp7, [XBLOCK, RBLOCK])
tmp10 = tl.where(xmask, tmp8, 0)
tmp11 = tl.sum(tmp10, 1)[:, None]
tl.store(out_ptr0 + x0, tmp6, xmask)
tl.store(out_ptr1 + x0, tmp11, xmask)
@triton.jit
def triton_per_fused_add_div_mean_rsub_sum_3(in_out_ptr0, in_ptr0, in_ptr1,
xnumel, rnumel, XBLOCK: tl.constexpr):
RBLOCK: tl.constexpr = 4
xoffset = tl.program_id(0) * XBLOCK
xoffset + tl.arange(0, XBLOCK)[:, None]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp4 = tl.load(in_ptr1 + r0, None)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.sum(tmp1, 1)[:, None]
tmp5 = tl.broadcast_to(tmp4, [XBLOCK, RBLOCK])
tmp7 = tl.sum(tmp5, 1)[:, None]
tmp8 = 1e-05
tmp9 = tmp3 + tmp8
tmp10 = tmp7 + tmp8
tmp11 = tmp9 / tmp10
tmp12 = 1.0
tmp13 = tmp11 / tmp12
tmp14 = tmp12 - tmp13
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([XBLOCK, 1], 0, tl.int32), tmp14, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused__softmax_0[grid(256)](arg0_1, buf0, 256, XBLOCK=
256, num_warps=4, num_stages=1)
del arg0_1
buf1 = empty_strided_cuda((4, 4, 4, 4), (16, 64, 4, 1), torch.float32)
triton_poi_fused_clone_1[grid(256)](buf0, buf1, 256, XBLOCK=128,
num_warps=4, num_stages=1)
del buf0
buf2 = empty_strided_cuda((4,), (1,), torch.float32)
buf4 = empty_strided_cuda((4,), (1,), torch.float32)
triton_per_fused_add_mul_sum_2[grid(4)](buf1, arg1_1, buf2, buf4, 4,
64, XBLOCK=1, num_warps=2, num_stages=1)
del arg1_1
del buf1
buf3 = empty_strided_cuda((), (), torch.float32)
buf6 = buf3
del buf3
triton_per_fused_add_div_mean_rsub_sum_3[grid(1)](buf6, buf2, buf4,
1, 4, XBLOCK=1, num_warps=2, num_stages=1)
del buf2
del buf4
return buf6,
def flatten(tensor):
"""Flattens a given tensor such that the channel axis is first.
The shapes are transformed as follows:
(N, C, D, H, W) -> (C, N * D * H * W)
"""
C = tensor.size(1)
axis_order = (1, 0) + tuple(range(2, tensor.dim()))
transposed = tensor.permute(axis_order)
return transposed.contiguous().view(C, -1)
class DiceLossNew(nn.Module):
def __init__(self):
super().__init__()
self.epsilon = 1e-05
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
DarkoBomer/VCANet
|
DiceLoss
| false | 2,125 |
[
"MIT"
] | 0 |
1c76deb195a2dcb8aa4b40856d49eb6796de12bc
|
https://github.com/DarkoBomer/VCANet/tree/1c76deb195a2dcb8aa4b40856d49eb6796de12bc
|
GlobalAttention_text
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/qi/cqinh332474qtv7bgen4bcfz2yfclns66jnudr7z7wmvlrgqoduc.py
# Topologically Sorted Source Nodes: [targetT], Original ATen: [aten.clone, aten.transpose]
# Source node to ATen node mapping:
# targetT => clone
# Graph fragment:
# %clone : [num_users=2] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
# %permute_2 : [num_users=1] = call_function[target=torch.ops.aten.permute.default](args = (%clone, [0, 2, 1]), kwargs = {})
triton_poi_fused_clone_transpose_0 = async_compile.triton('triton_poi_fused_clone_transpose_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 16], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_transpose_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_transpose_0(in_ptr0, out_ptr0, out_ptr1, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x1 = xindex
y0 = yindex
y2 = yindex % 4
y3 = (yindex // 4)
tmp0 = tl.load(in_ptr0 + (x1 + (16*y0)), xmask & ymask)
tl.store(out_ptr0 + (x1 + (16*y0)), tmp0, xmask & ymask)
tl.store(out_ptr1 + (y2 + (4*x1) + (64*y3)), tmp0, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/au/cau4pihcaptiev5y2ewn2o2nvrwhk7hogc72cofmmtbyv4rxc2oy.py
# Topologically Sorted Source Nodes: [sourceT], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# sourceT => convolution
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_2, %primals_3, %primals_4, [1], [0], [1], False, [0], 1), kwargs = {})
triton_poi_fused_convolution_1 = async_compile.triton('triton_poi_fused_convolution_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 4) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/js/cjsclua4iuftg7a2rk5qyk4r72wuw5hseuiaj7uhqdg66dzh7l4f.py
# Topologically Sorted Source Nodes: [attn_3], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# attn_3 => amax, exp, sub, sum_1
# Graph fragment:
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%view_2, [1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_2, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [1], True), kwargs = {})
triton_per_fused__softmax_2 = async_compile.triton('triton_per_fused__softmax_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 16],
reduction_hint=ReductionHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__softmax_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 2, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__softmax_2(in_ptr0, out_ptr0, out_ptr1, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r2 = rindex
x0 = xindex % 4
x1 = (xindex // 4)
x3 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (4*r2) + (64*x1)), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, float("-inf"))
tmp4 = triton_helpers.max2(tmp3, 1)[:, None]
tmp5 = tmp0 - tmp4
tmp6 = tl_math.exp(tmp5)
tmp7 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp9 = tl.where(xmask, tmp7, 0)
tmp10 = tl.sum(tmp9, 1)[:, None]
tl.store(out_ptr0 + (x3), tmp4, xmask)
tl.store(out_ptr1 + (x3), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/zq/czqcs6dvidywumpqt6lrleels5g6fvxrenvde5asprdgf4kgsyzx.py
# Topologically Sorted Source Nodes: [attn_3], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# attn_3 => div, exp, sub
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_2, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %div : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
triton_poi_fused__softmax_3 = async_compile.triton('triton_poi_fused__softmax_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_3', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_3(in_out_ptr0, in_ptr0, in_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 4
x2 = (xindex // 64)
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x0 + (4*x2)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (x0 + (4*x2)), xmask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp3 = tl_math.exp(tmp2)
tmp5 = tmp3 / tmp4
tl.store(in_out_ptr0 + (x3), tmp5, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_3, (4, 4, 1), (4, 1, 1))
assert_size_stride(primals_4, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [sourceT], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_2, primals_3, stride=(1,), padding=(0,), dilation=(1,), transposed=False, output_padding=(0,), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 4), (16, 4, 1))
buf1 = empty_strided_cuda((4, 16, 4), (64, 1, 16), torch.float32)
buf8 = empty_strided_cuda((4, 4, 16), (64, 1, 4), torch.float32)
# Topologically Sorted Source Nodes: [targetT], Original ATen: [aten.clone, aten.transpose]
stream0 = get_raw_stream(0)
triton_poi_fused_clone_transpose_0.run(primals_1, buf1, buf8, 16, 16, grid=grid(16, 16), stream=stream0)
buf2 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [sourceT], Original ATen: [aten.convolution]
triton_poi_fused_convolution_1.run(buf2, primals_4, 64, grid=grid(64), stream=stream0)
del primals_4
buf3 = empty_strided_cuda((4, 16, 4), (64, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [targetT, sourceT, attn], Original ATen: [aten.clone, aten.convolution, aten.bmm]
extern_kernels.bmm(buf1, buf2, out=buf3)
del buf1
buf4 = empty_strided_cuda((4, 1, 4), (4, 16, 1), torch.float32)
buf5 = empty_strided_cuda((4, 1, 4), (4, 16, 1), torch.float32)
# Topologically Sorted Source Nodes: [attn_3], Original ATen: [aten._softmax]
triton_per_fused__softmax_2.run(buf3, buf4, buf5, 16, 16, grid=grid(16), stream=stream0)
buf6 = buf3; del buf3 # reuse
# Topologically Sorted Source Nodes: [attn_3], Original ATen: [aten._softmax]
triton_poi_fused__softmax_3.run(buf6, buf4, buf5, 256, grid=grid(256), stream=stream0)
del buf4
del buf5
buf7 = buf2; del buf2 # reuse
# Topologically Sorted Source Nodes: [text_weighted], Original ATen: [aten.bmm]
extern_kernels.bmm(reinterpret_tensor(primals_1, (4, 4, 16), (64, 16, 1), 0), buf6, out=buf7)
return (buf7, primals_2, primals_3, reinterpret_tensor(primals_1, (4, 16, 4), (64, 1, 16), 0), buf6, buf8, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 1), (4, 1, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.utils.data
class GlobalAttention_text(nn.Module):
def __init__(self, idf, cdf):
super(GlobalAttention_text, self).__init__()
self.conv_context = nn.Conv1d(cdf, idf, kernel_size=1, stride=1,
padding=0)
self.sm = nn.Softmax()
self.mask = None
def applyMask(self, mask):
self.mask = mask
def forward(self, input, context):
"""
input: batch x idf x ih x iw (queryL=ihxiw)
context: batch x cdf x sourceL
"""
ih, iw = input.size(2), input.size(3)
queryL = ih * iw
batch_size, sourceL = context.size(0), context.size(2)
target = input.view(batch_size, -1, queryL)
targetT = torch.transpose(target, 1, 2).contiguous()
sourceT = self.conv_context(context)
attn = torch.bmm(targetT, sourceT)
attn = attn.view(batch_size * queryL, sourceL)
if self.mask is not None:
mask = self.mask.repeat(queryL, 1)
attn.data.masked_fill_(mask.data, -float('inf'))
attn = attn.view(batch_size, queryL, sourceL)
attn = torch.nn.Softmax(dim=1)(attn)
text_weighted = torch.bmm(target, attn)
return text_weighted
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'idf': 4, 'cdf': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
import torch.nn.parallel
import torch.utils.data
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_clone_transpose_0(in_ptr0, out_ptr0, out_ptr1, ynumel,
xnumel, YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x1 = xindex
y0 = yindex
y2 = yindex % 4
y3 = yindex // 4
tmp0 = tl.load(in_ptr0 + (x1 + 16 * y0), xmask & ymask)
tl.store(out_ptr0 + (x1 + 16 * y0), tmp0, xmask & ymask)
tl.store(out_ptr1 + (y2 + 4 * x1 + 64 * y3), tmp0, xmask & ymask)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 4 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, xmask)
@triton.jit
def triton_per_fused__softmax_2(in_ptr0, out_ptr0, out_ptr1, xnumel, rnumel,
XBLOCK: tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r2 = rindex
x0 = xindex % 4
x1 = xindex // 4
x3 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 4 * r2 + 64 * x1), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, float('-inf'))
tmp4 = triton_helpers.max2(tmp3, 1)[:, None]
tmp5 = tmp0 - tmp4
tmp6 = tl_math.exp(tmp5)
tmp7 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp9 = tl.where(xmask, tmp7, 0)
tmp10 = tl.sum(tmp9, 1)[:, None]
tl.store(out_ptr0 + x3, tmp4, xmask)
tl.store(out_ptr1 + x3, tmp10, xmask)
@triton.jit
def triton_poi_fused__softmax_3(in_out_ptr0, in_ptr0, in_ptr1, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x0 = xindex % 4
x2 = xindex // 64
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + (x0 + 4 * x2), xmask, eviction_policy='evict_last'
)
tmp4 = tl.load(in_ptr1 + (x0 + 4 * x2), xmask, eviction_policy='evict_last'
)
tmp2 = tmp0 - tmp1
tmp3 = tl_math.exp(tmp2)
tmp5 = tmp3 / tmp4
tl.store(in_out_ptr0 + x3, tmp5, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_3, (4, 4, 1), (4, 1, 1))
assert_size_stride(primals_4, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_2, primals_3, stride=(1,),
padding=(0,), dilation=(1,), transposed=False, output_padding=(
0,), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 4), (16, 4, 1))
buf1 = empty_strided_cuda((4, 16, 4), (64, 1, 16), torch.float32)
buf8 = empty_strided_cuda((4, 4, 16), (64, 1, 4), torch.float32)
get_raw_stream(0)
triton_poi_fused_clone_transpose_0[grid(16, 16)](primals_1, buf1,
buf8, 16, 16, XBLOCK=16, YBLOCK=16, num_warps=4, num_stages=1)
buf2 = buf0
del buf0
triton_poi_fused_convolution_1[grid(64)](buf2, primals_4, 64,
XBLOCK=64, num_warps=1, num_stages=1)
del primals_4
buf3 = empty_strided_cuda((4, 16, 4), (64, 4, 1), torch.float32)
extern_kernels.bmm(buf1, buf2, out=buf3)
del buf1
buf4 = empty_strided_cuda((4, 1, 4), (4, 16, 1), torch.float32)
buf5 = empty_strided_cuda((4, 1, 4), (4, 16, 1), torch.float32)
triton_per_fused__softmax_2[grid(16)](buf3, buf4, buf5, 16, 16,
XBLOCK=1, num_warps=2, num_stages=1)
buf6 = buf3
del buf3
triton_poi_fused__softmax_3[grid(256)](buf6, buf4, buf5, 256,
XBLOCK=256, num_warps=4, num_stages=1)
del buf4
del buf5
buf7 = buf2
del buf2
extern_kernels.bmm(reinterpret_tensor(primals_1, (4, 4, 16), (64,
16, 1), 0), buf6, out=buf7)
return buf7, primals_2, primals_3, reinterpret_tensor(primals_1, (4, 16,
4), (64, 1, 16), 0), buf6, buf8
class GlobalAttention_textNew(nn.Module):
def __init__(self, idf, cdf):
super(GlobalAttention_textNew, self).__init__()
self.conv_context = nn.Conv1d(cdf, idf, kernel_size=1, stride=1,
padding=0)
self.sm = nn.Softmax()
self.mask = None
def applyMask(self, mask):
self.mask = mask
def forward(self, input_0, input_1):
primals_3 = self.conv_context.weight
primals_4 = self.conv_context.bias
primals_1 = input_0
primals_2 = input_1
output = call([primals_1, primals_2, primals_3, primals_4])
return output[0]
|
Creling/DM-GAN
|
GlobalAttention_text
| false | 2,126 |
[
"MIT"
] | 0 |
ec2ce6d7fae4cf3ba2099b3db09926e544b2b759
|
https://github.com/Creling/DM-GAN/tree/ec2ce6d7fae4cf3ba2099b3db09926e544b2b759
|
ClassificationModel
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/cb/ccbgymnr2fvk43axzcuowohjalipdfn2nc4qqvidfjzuqhtxsj6g.py
# Unsorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
triton_poi_fused_0 = async_compile.triton('triton_poi_fused_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024, 16], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 1024
xnumel = 9
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = tl.full([XBLOCK, YBLOCK], True, tl.int1)
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = (yindex // 4)
tmp0 = tl.load(in_ptr0 + (x2 + (9*y3)), xmask, eviction_policy='evict_last')
tl.store(out_ptr0 + (y0 + (4*x2) + (36*y1)), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/j5/cj5nf2owtsdm2zwcezqxpyn63iwddjyadpotkhm2ua52inoqxdcl.py
# Unsorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
triton_poi_fused_1 = async_compile.triton('triton_poi_fused_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 16], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_1(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = (yindex // 4)
tmp0 = tl.load(in_ptr0 + (x2 + (16*y3)), xmask & ymask)
tl.store(out_ptr0 + (y0 + (4*x2) + (64*y1)), tmp0, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/co/ccosum7u5lx5fx5hf5opofiygxj2ntiq67yo5gfegevmhtkaru4r.py
# Unsorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
triton_poi_fused_2 = async_compile.triton('triton_poi_fused_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[65536, 16], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_2(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 65536
xnumel = 9
yoffset = (tl.program_id(1) + tl.program_id(2) * tl.num_programs(1)) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = tl.full([XBLOCK, YBLOCK], True, tl.int1)
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 256
y1 = (yindex // 256)
tmp0 = tl.load(in_ptr0 + (x2 + (9*y3)), xmask, eviction_policy='evict_last')
tl.store(out_ptr0 + (y0 + (256*x2) + (2304*y1)), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/34/c34needucqa3bw4wlsmzziq7hauxmwpalo4zmjx4tajlw2shfbsn.py
# Unsorted Source Nodes: [], Original ATen: []
# Source node to ATen node mapping:
triton_poi_fused_3 = async_compile.triton('triton_poi_fused_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[524288, 16], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_3(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 307200
xnumel = 9
yoffset = (tl.program_id(1) + tl.program_id(2) * tl.num_programs(1)) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = tl.full([XBLOCK, YBLOCK], True, tl.int1)
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 256
y1 = (yindex // 256)
tmp0 = tl.load(in_ptr0 + (x2 + (9*y3)), xmask, eviction_policy='evict_last')
tl.store(out_ptr0 + (y0 + (256*x2) + (2304*y1)), tmp0, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/wj/cwjii5g7vcokiqucazdgsrvnsqad3q7z4gbxiwezolbw7o6ilfmr.py
# Topologically Sorted Source Nodes: [out, out_1], Original ATen: [aten.convolution, aten.relu]
# Source node to ATen node mapping:
# out => convolution
# out_1 => relu
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [1, 1], [1, 1], False, [0, 0], 1), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%convolution,), kwargs = {})
triton_poi_fused_convolution_relu_4 = async_compile.triton('triton_poi_fused_convolution_relu_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16384],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_relu_4', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_relu_4(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16384
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 256
tmp0 = tl.load(in_out_ptr0 + (x2), None)
tmp1 = tl.load(in_ptr0 + (x0), None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + (x2), tmp4, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/a3/ca3f5giwoby7ivcx3wqrkq7uudlutkbfgjz34temhqtljnu65hoo.py
# Topologically Sorted Source Nodes: [out_8, contiguous], Original ATen: [aten.convolution, aten.clone]
# Source node to ATen node mapping:
# contiguous => clone
# out_8 => convolution_4
# Graph fragment:
# %convolution_4 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%relu_3, %primals_10, %primals_11, [1, 1], [1, 1], [1, 1], False, [0, 0], 1), kwargs = {})
# %clone : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%view,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_convolution_5 = async_compile.triton('triton_poi_fused_clone_convolution_5', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[131072],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_convolution_5', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_convolution_5(in_out_ptr0, in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 76800
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 1200
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.sigmoid(tmp2)
tl.store(in_out_ptr0 + (x2), tmp2, xmask)
tl.store(out_ptr0 + (x2), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11 = args
args.clear()
assert_size_stride(primals_1, (256, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (256, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_5, (256, ), (1, ))
assert_size_stride(primals_6, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_7, (256, ), (1, ))
assert_size_stride(primals_8, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_9, (256, ), (1, ))
assert_size_stride(primals_10, (1200, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_11, (1200, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((256, 4, 3, 3), (36, 1, 12, 4), torch.float32)
# Unsorted Source Nodes: [], Original ATen: []
stream0 = get_raw_stream(0)
triton_poi_fused_0.run(primals_1, buf0, 1024, 9, grid=grid(1024, 9), stream=stream0)
del primals_1
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 1, 16, 4), torch.float32)
# Unsorted Source Nodes: [], Original ATen: []
triton_poi_fused_1.run(primals_3, buf1, 16, 16, grid=grid(16, 16), stream=stream0)
del primals_3
buf2 = empty_strided_cuda((256, 256, 3, 3), (2304, 1, 768, 256), torch.float32)
# Unsorted Source Nodes: [], Original ATen: []
triton_poi_fused_2.run(primals_4, buf2, 65536, 9, grid=grid(65536, 9), stream=stream0)
del primals_4
buf3 = empty_strided_cuda((256, 256, 3, 3), (2304, 1, 768, 256), torch.float32)
# Unsorted Source Nodes: [], Original ATen: []
triton_poi_fused_2.run(primals_6, buf3, 65536, 9, grid=grid(65536, 9), stream=stream0)
del primals_6
buf4 = empty_strided_cuda((256, 256, 3, 3), (2304, 1, 768, 256), torch.float32)
# Unsorted Source Nodes: [], Original ATen: []
triton_poi_fused_2.run(primals_8, buf4, 65536, 9, grid=grid(65536, 9), stream=stream0)
del primals_8
buf5 = empty_strided_cuda((1200, 256, 3, 3), (2304, 1, 768, 256), torch.float32)
# Unsorted Source Nodes: [], Original ATen: []
triton_poi_fused_3.run(primals_10, buf5, 307200, 9, grid=grid(307200, 9), stream=stream0)
del primals_10
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
buf6 = extern_kernels.convolution(buf1, buf0, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf6, (4, 256, 4, 4), (4096, 1, 1024, 256))
buf7 = buf6; del buf6 # reuse
# Topologically Sorted Source Nodes: [out, out_1], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_4.run(buf7, primals_2, 16384, grid=grid(16384), stream=stream0)
del primals_2
# Topologically Sorted Source Nodes: [out_2], Original ATen: [aten.convolution]
buf8 = extern_kernels.convolution(buf7, buf2, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf8, (4, 256, 4, 4), (4096, 1, 1024, 256))
buf9 = buf8; del buf8 # reuse
# Topologically Sorted Source Nodes: [out_2, out_3], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_4.run(buf9, primals_5, 16384, grid=grid(16384), stream=stream0)
del primals_5
# Topologically Sorted Source Nodes: [out_4], Original ATen: [aten.convolution]
buf10 = extern_kernels.convolution(buf9, buf3, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf10, (4, 256, 4, 4), (4096, 1, 1024, 256))
buf11 = buf10; del buf10 # reuse
# Topologically Sorted Source Nodes: [out_4, out_5], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_4.run(buf11, primals_7, 16384, grid=grid(16384), stream=stream0)
del primals_7
# Topologically Sorted Source Nodes: [out_6], Original ATen: [aten.convolution]
buf12 = extern_kernels.convolution(buf11, buf4, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf12, (4, 256, 4, 4), (4096, 1, 1024, 256))
buf13 = buf12; del buf12 # reuse
# Topologically Sorted Source Nodes: [out_6, out_7], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_4.run(buf13, primals_9, 16384, grid=grid(16384), stream=stream0)
del primals_9
# Topologically Sorted Source Nodes: [out_8], Original ATen: [aten.convolution]
buf14 = extern_kernels.convolution(buf13, buf5, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf14, (4, 1200, 4, 4), (19200, 1, 4800, 1200))
buf15 = buf14; del buf14 # reuse
buf16 = empty_strided_cuda((4, 4, 4, 15, 80), (19200, 4800, 1200, 80, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_8, contiguous], Original ATen: [aten.convolution, aten.clone]
triton_poi_fused_clone_convolution_5.run(buf15, primals_11, buf16, 76800, grid=grid(76800), stream=stream0)
del primals_11
return (reinterpret_tensor(buf16, (4, 240, 80), (19200, 80, 1), 0), buf0, buf1, buf2, buf3, buf4, buf5, buf7, buf9, buf11, buf13, buf15, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((256, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((256, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((256, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((256, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((256, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((1200, 256, 3, 3), (2304, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((1200, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class ClassificationModel(nn.Module):
def __init__(self, num_features_in, num_anchors=15, num_classes=80,
prior=0.01, feature_size=256):
super(ClassificationModel, self).__init__()
self.num_classes = num_classes
self.num_anchors = num_anchors
self.conv1 = nn.Conv2d(num_features_in, feature_size, kernel_size=3,
padding=1)
self.act1 = nn.ReLU()
self.conv2 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act2 = nn.ReLU()
self.conv3 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act3 = nn.ReLU()
self.conv4 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act4 = nn.ReLU()
self.output = nn.Conv2d(feature_size, num_anchors * num_classes,
kernel_size=3, padding=1)
self.output_act = nn.Sigmoid()
def forward(self, x):
out = self.conv1(x)
out = self.act1(out)
out = self.conv2(out)
out = self.act2(out)
out = self.conv3(out)
out = self.act3(out)
out = self.conv4(out)
out = self.act4(out)
out = self.output(out)
out = self.output_act(out)
out1 = out.permute(0, 2, 3, 1)
batch_size, width, height, _channels = out1.shape
out2 = out1.view(batch_size, width, height, self.num_anchors, self.
num_classes)
return out2.contiguous().view(x.shape[0], -1, self.num_classes)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'num_features_in': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
xnumel = 9
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
tl.full([XBLOCK, YBLOCK], True, tl.int1)
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = yindex // 4
tmp0 = tl.load(in_ptr0 + (x2 + 9 * y3), xmask, eviction_policy='evict_last'
)
tl.store(out_ptr0 + (y0 + 4 * x2 + 36 * y1), tmp0, xmask)
@triton.jit
def triton_poi_fused_1(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = yindex // 4
tmp0 = tl.load(in_ptr0 + (x2 + 16 * y3), xmask & ymask)
tl.store(out_ptr0 + (y0 + 4 * x2 + 64 * y1), tmp0, xmask & ymask)
@triton.jit
def triton_poi_fused_2(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
xnumel = 9
yoffset = (tl.program_id(1) + tl.program_id(2) * tl.num_programs(1)
) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
tl.full([XBLOCK, YBLOCK], True, tl.int1)
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 256
y1 = yindex // 256
tmp0 = tl.load(in_ptr0 + (x2 + 9 * y3), xmask, eviction_policy='evict_last'
)
tl.store(out_ptr0 + (y0 + 256 * x2 + 2304 * y1), tmp0, xmask)
@triton.jit
def triton_poi_fused_3(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
xnumel = 9
yoffset = (tl.program_id(1) + tl.program_id(2) * tl.num_programs(1)
) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
tl.full([XBLOCK, YBLOCK], True, tl.int1)
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 256
y1 = yindex // 256
tmp0 = tl.load(in_ptr0 + (x2 + 9 * y3), xmask, eviction_policy='evict_last'
)
tl.store(out_ptr0 + (y0 + 256 * x2 + 2304 * y1), tmp0, xmask)
@triton.jit
def triton_poi_fused_convolution_relu_4(in_out_ptr0, in_ptr0, xnumel,
XBLOCK: tl.constexpr):
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
tl.full([XBLOCK], True, tl.int1)
x2 = xindex
x0 = xindex % 256
tmp0 = tl.load(in_out_ptr0 + x2, None)
tmp1 = tl.load(in_ptr0 + x0, None, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + x2, tmp4, None)
@triton.jit
def triton_poi_fused_clone_convolution_5(in_out_ptr0, in_ptr0, out_ptr0,
xnumel, XBLOCK: tl.constexpr):
xnumel = 76800
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 1200
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.sigmoid(tmp2)
tl.store(in_out_ptr0 + x2, tmp2, xmask)
tl.store(out_ptr0 + x2, tmp3, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11) = args
args.clear()
assert_size_stride(primals_1, (256, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (256,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_5, (256,), (1,))
assert_size_stride(primals_6, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_7, (256,), (1,))
assert_size_stride(primals_8, (256, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_9, (256,), (1,))
assert_size_stride(primals_10, (1200, 256, 3, 3), (2304, 9, 3, 1))
assert_size_stride(primals_11, (1200,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((256, 4, 3, 3), (36, 1, 12, 4), torch.float32
)
get_raw_stream(0)
triton_poi_fused_0[grid(1024, 9)](primals_1, buf0, 1024, 9, XBLOCK=
16, YBLOCK=64, num_warps=4, num_stages=1)
del primals_1
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 1, 16, 4), torch.float32)
triton_poi_fused_1[grid(16, 16)](primals_3, buf1, 16, 16, XBLOCK=16,
YBLOCK=16, num_warps=4, num_stages=1)
del primals_3
buf2 = empty_strided_cuda((256, 256, 3, 3), (2304, 1, 768, 256),
torch.float32)
triton_poi_fused_2[grid(65536, 9)](primals_4, buf2, 65536, 9,
XBLOCK=16, YBLOCK=64, num_warps=4, num_stages=1)
del primals_4
buf3 = empty_strided_cuda((256, 256, 3, 3), (2304, 1, 768, 256),
torch.float32)
triton_poi_fused_2[grid(65536, 9)](primals_6, buf3, 65536, 9,
XBLOCK=16, YBLOCK=64, num_warps=4, num_stages=1)
del primals_6
buf4 = empty_strided_cuda((256, 256, 3, 3), (2304, 1, 768, 256),
torch.float32)
triton_poi_fused_2[grid(65536, 9)](primals_8, buf4, 65536, 9,
XBLOCK=16, YBLOCK=64, num_warps=4, num_stages=1)
del primals_8
buf5 = empty_strided_cuda((1200, 256, 3, 3), (2304, 1, 768, 256),
torch.float32)
triton_poi_fused_3[grid(307200, 9)](primals_10, buf5, 307200, 9,
XBLOCK=16, YBLOCK=64, num_warps=4, num_stages=1)
del primals_10
buf6 = extern_kernels.convolution(buf1, buf0, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf6, (4, 256, 4, 4), (4096, 1, 1024, 256))
buf7 = buf6
del buf6
triton_poi_fused_convolution_relu_4[grid(16384)](buf7, primals_2,
16384, XBLOCK=256, num_warps=4, num_stages=1)
del primals_2
buf8 = extern_kernels.convolution(buf7, buf2, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf8, (4, 256, 4, 4), (4096, 1, 1024, 256))
buf9 = buf8
del buf8
triton_poi_fused_convolution_relu_4[grid(16384)](buf9, primals_5,
16384, XBLOCK=256, num_warps=4, num_stages=1)
del primals_5
buf10 = extern_kernels.convolution(buf9, buf3, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf10, (4, 256, 4, 4), (4096, 1, 1024, 256))
buf11 = buf10
del buf10
triton_poi_fused_convolution_relu_4[grid(16384)](buf11, primals_7,
16384, XBLOCK=256, num_warps=4, num_stages=1)
del primals_7
buf12 = extern_kernels.convolution(buf11, buf4, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf12, (4, 256, 4, 4), (4096, 1, 1024, 256))
buf13 = buf12
del buf12
triton_poi_fused_convolution_relu_4[grid(16384)](buf13, primals_9,
16384, XBLOCK=256, num_warps=4, num_stages=1)
del primals_9
buf14 = extern_kernels.convolution(buf13, buf5, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf14, (4, 1200, 4, 4), (19200, 1, 4800, 1200))
buf15 = buf14
del buf14
buf16 = empty_strided_cuda((4, 4, 4, 15, 80), (19200, 4800, 1200,
80, 1), torch.float32)
triton_poi_fused_clone_convolution_5[grid(76800)](buf15, primals_11,
buf16, 76800, XBLOCK=512, num_warps=8, num_stages=1)
del primals_11
return reinterpret_tensor(buf16, (4, 240, 80), (19200, 80, 1), 0
), buf0, buf1, buf2, buf3, buf4, buf5, buf7, buf9, buf11, buf13, buf15
class ClassificationModelNew(nn.Module):
def __init__(self, num_features_in, num_anchors=15, num_classes=80,
prior=0.01, feature_size=256):
super(ClassificationModelNew, self).__init__()
self.num_classes = num_classes
self.num_anchors = num_anchors
self.conv1 = nn.Conv2d(num_features_in, feature_size, kernel_size=3,
padding=1)
self.act1 = nn.ReLU()
self.conv2 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act2 = nn.ReLU()
self.conv3 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act3 = nn.ReLU()
self.conv4 = nn.Conv2d(feature_size, feature_size, kernel_size=3,
padding=1)
self.act4 = nn.ReLU()
self.output = nn.Conv2d(feature_size, num_anchors * num_classes,
kernel_size=3, padding=1)
self.output_act = nn.Sigmoid()
def forward(self, input_0):
primals_1 = self.conv1.weight
primals_2 = self.conv1.bias
primals_4 = self.conv2.weight
primals_5 = self.conv2.bias
primals_6 = self.conv3.weight
primals_7 = self.conv3.bias
primals_8 = self.conv4.weight
primals_9 = self.conv4.bias
primals_10 = self.output.weight
primals_11 = self.output.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11])
return output[0]
|
BradleyBrown19/CustomObjectDetector
|
ClassificationModel
| false | 2,127 |
[
"Apache-2.0"
] | 0 |
11c14ec6127c553ac365703c768b75dde33d9a4d
|
https://github.com/BradleyBrown19/CustomObjectDetector/tree/11c14ec6127c553ac365703c768b75dde33d9a4d
|
EMLLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/nf/cnfbmcj4qjpw42wcretgofguvl5ncchceie2terfp3l6x5zgs2fl.py
# Topologically Sorted Source Nodes: [eq, y_pred_1, ones_like, pt_1, sub, pow_1, mul_4, log, mul_5, mean, neg, eq_1, zeros_like, pt_0, pow_2, mul_6, sub_1, log_1, mul_7, mean_1, focal_loss, mul, intersection, mul_1, add, mul_2, sum_2, mul_3, sum_3, add_1, add_2, dice_loss, log_2, sub_3], Original ATen: [aten.eq, aten.clamp, aten.ones_like, aten.where, aten.rsub, aten.pow, aten.mul, aten.log, aten.mean, aten.neg, aten.zeros_like, aten.sub, aten.sum, aten.add, aten.div]
# Source node to ATen node mapping:
# add => add
# add_1 => add_1
# add_2 => add_2
# dice_loss => div
# eq => eq
# eq_1 => eq_1
# focal_loss => sub_2
# intersection => sum_1
# log => log
# log_1 => log_1
# log_2 => log_2
# mean => mean
# mean_1 => mean_1
# mul => mul
# mul_1 => mul_1
# mul_2 => mul_2
# mul_3 => mul_3
# mul_4 => mul_4
# mul_5 => mul_5
# mul_6 => mul_6
# mul_7 => mul_7
# neg => neg
# ones_like => full_default
# pow_1 => pow_1
# pow_2 => pow_2
# pt_0 => where_1
# pt_1 => where
# sub => sub
# sub_1 => sub_1
# sub_3 => sub_3
# sum_2 => sum_2
# sum_3 => sum_3
# y_pred_1 => clamp_min
# zeros_like => full_default_1
# Graph fragment:
# %eq : [num_users=1] = call_function[target=torch.ops.aten.eq.Scalar](args = (%view, 1), kwargs = {})
# %clamp_min : [num_users=2] = call_function[target=torch.ops.aten.clamp_min.default](args = (%view_1, 1e-07), kwargs = {})
# %full_default : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([256], 1), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %where : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%eq, %clamp_min, %full_default), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1.0, %where), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub, 1.1), kwargs = {})
# %mul_4 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%pow_1, 0.48), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%where,), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_4, %log), kwargs = {})
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%mul_5,), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%mean,), kwargs = {})
# %eq_1 : [num_users=1] = call_function[target=torch.ops.aten.eq.Scalar](args = (%view, 0), kwargs = {})
# %full_default_1 : [num_users=1] = call_function[target=torch.ops.aten.full.default](args = ([256], 0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %where_1 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%eq_1, %clamp_min, %full_default_1), kwargs = {})
# %pow_2 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%where_1, 1.1), kwargs = {})
# %mul_6 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%pow_2, 0.52), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1.0, %where_1), kwargs = {})
# %log_1 : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%sub_1,), kwargs = {})
# %mul_7 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mul_6, %log_1), kwargs = {})
# %mean_1 : [num_users=1] = call_function[target=torch.ops.aten.mean.default](args = (%mul_7,), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%neg, %mean_1), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view, %view_1), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%mul,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sum_1, 2.0), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, 1.0), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view, %view), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%mul_2,), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_1, %view_1), kwargs = {})
# %sum_3 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%mul_3,), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sum_2, %sum_3), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%add_1, 1.0), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%add, %add_2), kwargs = {})
# %log_2 : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%div,), kwargs = {})
# %sub_3 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sub_2, %log_2), kwargs = {})
triton_per_fused_add_clamp_div_eq_log_mean_mul_neg_ones_like_pow_rsub_sub_sum_where_zeros_like_0 = async_compile.triton('triton_per_fused_add_clamp_div_eq_log_mean_mul_neg_ones_like_pow_rsub_sub_sum_where_zeros_like_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_clamp_div_eq_log_mean_mul_neg_ones_like_pow_rsub_sub_sum_where_zeros_like_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 5, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_clamp_div_eq_log_mean_mul_neg_ones_like_pow_rsub_sub_sum_where_zeros_like_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp3 = tl.load(in_ptr1 + (r0), None)
tmp1 = 1.0
tmp2 = tmp0 == tmp1
tmp4 = 1e-07
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp6 = tl.where(tmp2, tmp5, tmp1)
tmp7 = tmp1 - tmp6
tmp8 = 1.1
tmp9 = libdevice.pow(tmp7, tmp8)
tmp10 = 0.48
tmp11 = tmp9 * tmp10
tmp12 = tl_math.log(tmp6)
tmp13 = tmp11 * tmp12
tmp14 = tl.broadcast_to(tmp13, [RBLOCK])
tmp16 = triton_helpers.promote_to_tensor(tl.sum(tmp14, 0))
tmp17 = 0.0
tmp18 = tmp0 == tmp17
tmp19 = tl.where(tmp18, tmp5, tmp17)
tmp20 = libdevice.pow(tmp19, tmp8)
tmp21 = 0.52
tmp22 = tmp20 * tmp21
tmp23 = tmp1 - tmp19
tmp24 = tl_math.log(tmp23)
tmp25 = tmp22 * tmp24
tmp26 = tl.broadcast_to(tmp25, [RBLOCK])
tmp28 = triton_helpers.promote_to_tensor(tl.sum(tmp26, 0))
tmp29 = tmp0 * tmp3
tmp30 = tl.broadcast_to(tmp29, [RBLOCK])
tmp32 = triton_helpers.promote_to_tensor(tl.sum(tmp30, 0))
tmp33 = tmp0 * tmp0
tmp34 = tl.broadcast_to(tmp33, [RBLOCK])
tmp36 = triton_helpers.promote_to_tensor(tl.sum(tmp34, 0))
tmp37 = tmp3 * tmp3
tmp38 = tl.broadcast_to(tmp37, [RBLOCK])
tmp40 = triton_helpers.promote_to_tensor(tl.sum(tmp38, 0))
tmp41 = 256.0
tmp42 = tmp16 / tmp41
tmp43 = -tmp42
tmp44 = tmp28 / tmp41
tmp45 = tmp43 - tmp44
tmp46 = 2.0
tmp47 = tmp32 * tmp46
tmp48 = tmp47 + tmp1
tmp49 = tmp36 + tmp40
tmp50 = tmp49 + tmp1
tmp51 = tmp48 / tmp50
tmp52 = tl_math.log(tmp51)
tmp53 = tmp45 - tmp52
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp53, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf5 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [eq, y_pred_1, ones_like, pt_1, sub, pow_1, mul_4, log, mul_5, mean, neg, eq_1, zeros_like, pt_0, pow_2, mul_6, sub_1, log_1, mul_7, mean_1, focal_loss, mul, intersection, mul_1, add, mul_2, sum_2, mul_3, sum_3, add_1, add_2, dice_loss, log_2, sub_3], Original ATen: [aten.eq, aten.clamp, aten.ones_like, aten.where, aten.rsub, aten.pow, aten.mul, aten.log, aten.mean, aten.neg, aten.zeros_like, aten.sub, aten.sum, aten.add, aten.div]
stream0 = get_raw_stream(0)
triton_per_fused_add_clamp_div_eq_log_mean_mul_neg_ones_like_pow_rsub_sub_sum_where_zeros_like_0.run(buf5, arg0_1, arg1_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf5, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
from torch import optim as optim
class EMLLoss(nn.Module):
def __init__(self):
super(EMLLoss, self).__init__()
def forward(self, y_pred, y_true):
gamma = 1.1
alpha = 0.48
smooth = 1.0
epsilon = 1e-07
y_true = y_true.view(-1)
y_pred = y_pred.view(-1)
intersection = (y_true * y_pred).sum()
dice_loss = (2.0 * intersection + smooth) / ((y_true * y_true).sum(
) + (y_pred * y_pred).sum() + smooth)
y_pred = torch.clamp(y_pred, epsilon)
pt_1 = torch.where(torch.eq(y_true, 1), y_pred, torch.ones_like(y_pred)
)
pt_0 = torch.where(torch.eq(y_true, 0), y_pred, torch.zeros_like(
y_pred))
focal_loss = -torch.mean(alpha * torch.pow(1.0 - pt_1, gamma) *
torch.log(pt_1)) - torch.mean((1 - alpha) * torch.pow(pt_0,
gamma) * torch.log(1.0 - pt_0))
return focal_loss - torch.log(dice_loss)
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
from torch import optim as optim
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_clamp_div_eq_log_mean_mul_neg_ones_like_pow_rsub_sub_sum_where_zeros_like_0(
in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp3 = tl.load(in_ptr1 + r0, None)
tmp1 = 1.0
tmp2 = tmp0 == tmp1
tmp4 = 1e-07
tmp5 = triton_helpers.maximum(tmp3, tmp4)
tmp6 = tl.where(tmp2, tmp5, tmp1)
tmp7 = tmp1 - tmp6
tmp8 = 1.1
tmp9 = libdevice.pow(tmp7, tmp8)
tmp10 = 0.48
tmp11 = tmp9 * tmp10
tmp12 = tl_math.log(tmp6)
tmp13 = tmp11 * tmp12
tmp14 = tl.broadcast_to(tmp13, [RBLOCK])
tmp16 = triton_helpers.promote_to_tensor(tl.sum(tmp14, 0))
tmp17 = 0.0
tmp18 = tmp0 == tmp17
tmp19 = tl.where(tmp18, tmp5, tmp17)
tmp20 = libdevice.pow(tmp19, tmp8)
tmp21 = 0.52
tmp22 = tmp20 * tmp21
tmp23 = tmp1 - tmp19
tmp24 = tl_math.log(tmp23)
tmp25 = tmp22 * tmp24
tmp26 = tl.broadcast_to(tmp25, [RBLOCK])
tmp28 = triton_helpers.promote_to_tensor(tl.sum(tmp26, 0))
tmp29 = tmp0 * tmp3
tmp30 = tl.broadcast_to(tmp29, [RBLOCK])
tmp32 = triton_helpers.promote_to_tensor(tl.sum(tmp30, 0))
tmp33 = tmp0 * tmp0
tmp34 = tl.broadcast_to(tmp33, [RBLOCK])
tmp36 = triton_helpers.promote_to_tensor(tl.sum(tmp34, 0))
tmp37 = tmp3 * tmp3
tmp38 = tl.broadcast_to(tmp37, [RBLOCK])
tmp40 = triton_helpers.promote_to_tensor(tl.sum(tmp38, 0))
tmp41 = 256.0
tmp42 = tmp16 / tmp41
tmp43 = -tmp42
tmp44 = tmp28 / tmp41
tmp45 = tmp43 - tmp44
tmp46 = 2.0
tmp47 = tmp32 * tmp46
tmp48 = tmp47 + tmp1
tmp49 = tmp36 + tmp40
tmp50 = tmp49 + tmp1
tmp51 = tmp48 / tmp50
tmp52 = tl_math.log(tmp51)
tmp53 = tmp45 - tmp52
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp53, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf5 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_add_clamp_div_eq_log_mean_mul_neg_ones_like_pow_rsub_sub_sum_where_zeros_like_0[
grid(1)](buf5, arg0_1, arg1_1, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf5,
class EMLLossNew(nn.Module):
def __init__(self):
super(EMLLossNew, self).__init__()
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
DarkoBomer/VCANet
|
EMLLoss
| false | 2,128 |
[
"MIT"
] | 0 |
1c76deb195a2dcb8aa4b40856d49eb6796de12bc
|
https://github.com/DarkoBomer/VCANet/tree/1c76deb195a2dcb8aa4b40856d49eb6796de12bc
|
LayerNorm
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/dg/cdgw6x7nju4bzp2wyuwgeanbco7zcjis6yiusovvnpz6zw3yjd3l.py
# Topologically Sorted Source Nodes: [u, sub], Original ATen: [aten.mean, aten.sub]
# Source node to ATen node mapping:
# sub => sub
# u => mean
# Graph fragment:
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%primals_1, [-1], True), kwargs = {})
# %sub : [num_users=2] = call_function[target=torch.ops.aten.sub.Tensor](args = (%primals_1, %mean), kwargs = {})
triton_poi_fused_mean_sub_0 = async_compile.triton('triton_poi_fused_mean_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mean_sub_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mean_sub_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = 4.0
tmp9 = tmp7 / tmp8
tmp10 = tmp0 - tmp9
tl.store(out_ptr0 + (x2), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/k3/ck3awyjmlyoxvkizg2opx6vtglv26uioox7nr33aabc2cmbcxgpr.py
# Topologically Sorted Source Nodes: [pow_1, s, add, sqrt, x, mul, add_1], Original ATen: [aten.pow, aten.mean, aten.add, aten.sqrt, aten.div, aten.mul]
# Source node to ATen node mapping:
# add => add
# add_1 => add_1
# mul => mul
# pow_1 => pow_1
# s => mean_1
# sqrt => sqrt
# x => div
# Graph fragment:
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub, 2), kwargs = {})
# %mean_1 : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%pow_1, [-1], True), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mean_1, 1e-12), kwargs = {})
# %sqrt : [num_users=1] = call_function[target=torch.ops.aten.sqrt.default](args = (%add,), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%sub, %sqrt), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_2, %div), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, %primals_3), kwargs = {})
triton_poi_fused_add_div_mean_mul_pow_sqrt_1 = async_compile.triton('triton_poi_fused_add_div_mean_mul_pow_sqrt_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_div_mean_mul_pow_sqrt_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 7, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_div_mean_mul_pow_sqrt_1(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x2), xmask)
tmp2 = tl.load(in_ptr1 + (4*x1), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr1 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr1 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp20 = tl.load(in_ptr2 + (x0), xmask, eviction_policy='evict_last')
tmp3 = tmp2 * tmp2
tmp5 = tmp4 * tmp4
tmp6 = tmp3 + tmp5
tmp8 = tmp7 * tmp7
tmp9 = tmp6 + tmp8
tmp11 = tmp10 * tmp10
tmp12 = tmp9 + tmp11
tmp13 = 4.0
tmp14 = tmp12 / tmp13
tmp15 = 1e-12
tmp16 = tmp14 + tmp15
tmp17 = libdevice.sqrt(tmp16)
tmp18 = tmp1 / tmp17
tmp19 = tmp0 * tmp18
tmp21 = tmp19 + tmp20
tl.store(out_ptr0 + (x2), tmp21, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [u, sub], Original ATen: [aten.mean, aten.sub]
stream0 = get_raw_stream(0)
triton_poi_fused_mean_sub_0.run(primals_1, buf0, 256, grid=grid(256), stream=stream0)
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [pow_1, s, add, sqrt, x, mul, add_1], Original ATen: [aten.pow, aten.mean, aten.add, aten.sqrt, aten.div, aten.mul]
triton_poi_fused_add_div_mean_mul_pow_sqrt_1.run(primals_2, buf0, primals_3, buf1, 256, grid=grid(256), stream=stream0)
del buf0
del primals_2
del primals_3
return (buf1, primals_1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class LayerNorm(nn.Module):
def __init__(self, hidden_size, eps=1e-12):
"""Construct a layernorm module in the TF style (epsilon inside the square root).
"""
super(LayerNorm, self).__init__()
self.weight = nn.Parameter(torch.ones(hidden_size))
self.bias = nn.Parameter(torch.zeros(hidden_size))
self.variance_epsilon = eps
def forward(self, x):
u = x.mean(-1, keepdim=True)
s = (x - u).pow(2).mean(-1, keepdim=True)
x = (x - u) / torch.sqrt(s + self.variance_epsilon)
return self.weight * x + self.bias
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'hidden_size': 4}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_mean_sub_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = 4.0
tmp9 = tmp7 / tmp8
tmp10 = tmp0 - tmp9
tl.store(out_ptr0 + x2, tmp10, xmask)
@triton.jit
def triton_poi_fused_add_div_mean_mul_pow_sqrt_1(in_ptr0, in_ptr1, in_ptr2,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x2, xmask)
tmp2 = tl.load(in_ptr1 + 4 * x1, xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr1 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr1 + (3 + 4 * x1), xmask, eviction_policy='evict_last'
)
tmp20 = tl.load(in_ptr2 + x0, xmask, eviction_policy='evict_last')
tmp3 = tmp2 * tmp2
tmp5 = tmp4 * tmp4
tmp6 = tmp3 + tmp5
tmp8 = tmp7 * tmp7
tmp9 = tmp6 + tmp8
tmp11 = tmp10 * tmp10
tmp12 = tmp9 + tmp11
tmp13 = 4.0
tmp14 = tmp12 / tmp13
tmp15 = 1e-12
tmp16 = tmp14 + tmp15
tmp17 = libdevice.sqrt(tmp16)
tmp18 = tmp1 / tmp17
tmp19 = tmp0 * tmp18
tmp21 = tmp19 + tmp20
tl.store(out_ptr0 + x2, tmp21, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_mean_sub_0[grid(256)](primals_1, buf0, 256, XBLOCK
=128, num_warps=4, num_stages=1)
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_add_div_mean_mul_pow_sqrt_1[grid(256)](primals_2,
buf0, primals_3, buf1, 256, XBLOCK=128, num_warps=4, num_stages=1)
del buf0
del primals_2
del primals_3
return buf1, primals_1
class LayerNormNew(nn.Module):
def __init__(self, hidden_size, eps=1e-12):
"""Construct a layernorm module in the TF style (epsilon inside the square root).
"""
super(LayerNormNew, self).__init__()
self.weight = nn.Parameter(torch.ones(hidden_size))
self.bias = nn.Parameter(torch.zeros(hidden_size))
self.variance_epsilon = eps
def forward(self, input_0):
primals_2 = self.weight
primals_3 = self.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
CaptainJa/demo-torch-gpt2
|
LayerNorm
| false | 2,129 |
[
"MIT"
] | 0 |
83d6074e8b321101e08c0aa5749c8eb988a5faa8
|
https://github.com/CaptainJa/demo-torch-gpt2/tree/83d6074e8b321101e08c0aa5749c8eb988a5faa8
|
ScoreLayer
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/zo/czobpmlyr5atbcpsuque6vcmk7nafmb3smtbzoqilz46drm7zbkm.py
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# x => convolution
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_0 = async_compile.triton('triton_poi_fused_convolution_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + (x0), xmask)
tmp1 = tl.load(in_ptr0 + (0))
tmp2 = tl.broadcast_to(tmp1, [XBLOCK])
tmp3 = tmp0 + tmp2
tl.store(in_out_ptr0 + (x0), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (1, 4, 1, 1), (4, 1, 1, 1))
assert_size_stride(primals_2, (1, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 1, 4, 4), (16, 16, 4, 1))
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [x], Original ATen: [aten.convolution]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_0.run(buf1, primals_2, 64, grid=grid(64), stream=stream0)
del primals_2
return (buf1, primals_1, primals_3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((1, 4, 1, 1), (4, 1, 1, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((1, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
import torch.nn.functional as F
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class ScoreLayer(nn.Module):
def __init__(self, k):
super(ScoreLayer, self).__init__()
self.score = nn.Conv2d(k, 1, 1, 1)
def forward(self, x, x_size=None):
x = self.score(x)
if x_size is not None:
x = F.interpolate(x, x_size[2:], mode='bilinear', align_corners
=True)
return x
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'k': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch import nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
@triton.jit
def triton_poi_fused_convolution_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_out_ptr0 + x0, xmask)
tmp1 = tl.load(in_ptr0 + 0)
tmp2 = tl.broadcast_to(tmp1, [XBLOCK])
tmp3 = tmp0 + tmp2
tl.store(in_out_ptr0 + x0, tmp3, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (1, 4, 1, 1), (4, 1, 1, 1))
assert_size_stride(primals_2, (1,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 1, 4, 4), (16, 16, 4, 1))
buf1 = buf0
del buf0
get_raw_stream(0)
triton_poi_fused_convolution_0[grid(64)](buf1, primals_2, 64,
XBLOCK=64, num_warps=1, num_stages=1)
del primals_2
return buf1, primals_1, primals_3
class ScoreLayerNew(nn.Module):
def __init__(self, k):
super(ScoreLayerNew, self).__init__()
self.score = nn.Conv2d(k, 1, 1, 1)
def forward(self, input_0):
primals_1 = self.score.weight
primals_2 = self.score.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
Dcasadoherraez/siamese-tracking
|
ScoreLayer
| false | 2,130 |
[
"MIT"
] | 0 |
ce3a2ee32fbe3e4a84a8352be22f929a8512dd25
|
https://github.com/Dcasadoherraez/siamese-tracking/tree/ce3a2ee32fbe3e4a84a8352be22f929a8512dd25
|
VectorQuantizer
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/x6/cx6vj6jd2qhcbwnwwajpsdipepno6iepsyrvmepfo457t522sl26.py
# Topologically Sorted Source Nodes: [latents, flat_latents], Original ATen: [aten.clone, aten.view]
# Source node to ATen node mapping:
# flat_latents => view
# latents => clone
# Graph fragment:
# %clone : [num_users=3] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
# %view : [num_users=2] = call_function[target=torch.ops.aten.reshape.default](args = (%clone, [-1, 4]), kwargs = {})
triton_poi_fused_clone_view_0 = async_compile.triton('triton_poi_fused_clone_view_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64, 4], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_view_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_view_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 64
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x1 = xindex
y0 = yindex
tmp0 = tl.load(in_ptr0 + ((16*x1) + (64*(y0 // 16)) + (y0 % 16)), xmask & ymask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x1 + (4*y0)), tmp0, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/oh/coh3kyu6rghphyqtfflzqlsbjfinc4c7cmryrm7sbhmrnnvqqu6w.py
# Topologically Sorted Source Nodes: [pow_1, sum_1, pow_2, sum_2, add, mul, dist], Original ATen: [aten.pow, aten.sum, aten.add, aten.mul, aten.sub]
# Source node to ATen node mapping:
# add => add
# dist => sub
# mul => mul
# pow_1 => pow_1
# pow_2 => pow_2
# sum_1 => sum_1
# sum_2 => sum_2
# Graph fragment:
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%view, 2), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%pow_1, [1], True), kwargs = {})
# %pow_2 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%primals_2, 2), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%pow_2, [1]), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sum_1, %sum_2), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mm, 2), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%add, %mul), kwargs = {})
triton_poi_fused_add_mul_pow_sub_sum_1 = async_compile.triton('triton_poi_fused_add_mul_pow_sub_sum_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_mul_pow_sub_sum_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 9, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_mul_pow_sub_sum_1(in_out_ptr0, in_ptr0, in_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 4)
x0 = xindex % 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr1 + (4*x0), xmask, eviction_policy='evict_last')
tmp13 = tl.load(in_ptr1 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp16 = tl.load(in_ptr1 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp19 = tl.load(in_ptr1 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp23 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tmp0 * tmp0
tmp3 = tmp2 * tmp2
tmp4 = tmp1 + tmp3
tmp6 = tmp5 * tmp5
tmp7 = tmp4 + tmp6
tmp9 = tmp8 * tmp8
tmp10 = tmp7 + tmp9
tmp12 = tmp11 * tmp11
tmp14 = tmp13 * tmp13
tmp15 = tmp12 + tmp14
tmp17 = tmp16 * tmp16
tmp18 = tmp15 + tmp17
tmp20 = tmp19 * tmp19
tmp21 = tmp18 + tmp20
tmp22 = tmp10 + tmp21
tmp24 = 2.0
tmp25 = tmp23 * tmp24
tmp26 = tmp22 - tmp25
tl.store(in_out_ptr0 + (x2), tmp26, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/3l/c3ltycq3kz4scgm57x763xs5lwirtcz6gwjv67cofz752mk5hx4y.py
# Topologically Sorted Source Nodes: [argmin], Original ATen: [aten.argmin]
# Source node to ATen node mapping:
# argmin => argmin
# Graph fragment:
# %argmin : [num_users=1] = call_function[target=torch.ops.aten.argmin.default](args = (%sub, 1), kwargs = {})
triton_poi_fused_argmin_2 = async_compile.triton('triton_poi_fused_argmin_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*i64', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_argmin_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_argmin_2(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (4*x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp17 = tl.load(in_ptr0 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp32 = tl.load(in_ptr0 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp2 = tmp0 < tmp1
tmp3 = tmp0 == tmp1
tmp4 = tmp0 != tmp0
tmp5 = tmp1 != tmp1
tmp6 = tmp4 > tmp5
tmp7 = tmp2 | tmp6
tmp8 = tmp4 & tmp5
tmp9 = tmp3 | tmp8
tmp10 = tl.full([1], 0, tl.int64)
tmp11 = tl.full([1], 1, tl.int64)
tmp12 = tmp10 < tmp11
tmp13 = tmp9 & tmp12
tmp14 = tmp7 | tmp13
tmp15 = tl.where(tmp14, tmp0, tmp1)
tmp16 = tl.where(tmp14, tmp10, tmp11)
tmp18 = tmp15 < tmp17
tmp19 = tmp15 == tmp17
tmp20 = tmp15 != tmp15
tmp21 = tmp17 != tmp17
tmp22 = tmp20 > tmp21
tmp23 = tmp18 | tmp22
tmp24 = tmp20 & tmp21
tmp25 = tmp19 | tmp24
tmp26 = tl.full([1], 2, tl.int64)
tmp27 = tmp16 < tmp26
tmp28 = tmp25 & tmp27
tmp29 = tmp23 | tmp28
tmp30 = tl.where(tmp29, tmp15, tmp17)
tmp31 = tl.where(tmp29, tmp16, tmp26)
tmp33 = tmp30 < tmp32
tmp34 = tmp30 == tmp32
tmp35 = tmp30 != tmp30
tmp36 = tmp32 != tmp32
tmp37 = tmp35 > tmp36
tmp38 = tmp33 | tmp37
tmp39 = tmp35 & tmp36
tmp40 = tmp34 | tmp39
tmp41 = tl.full([1], 3, tl.int64)
tmp42 = tmp31 < tmp41
tmp43 = tmp40 & tmp42
tmp44 = tmp38 | tmp43
tmp45 = tl.where(tmp44, tmp30, tmp32)
tmp46 = tl.where(tmp44, tmp31, tmp41)
tl.store(out_ptr0 + (x0), tmp46, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/rl/crlo3ugzwljr2rgpi3zcuc6lfaljqn4v44qgasneddceseggjqyz.py
# Topologically Sorted Source Nodes: [scatter_], Original ATen: [aten.scatter]
# Source node to ATen node mapping:
# scatter_ => scatter_upon_const_tensor
# Graph fragment:
# %scatter_upon_const_tensor : [num_users=2] = call_function[target=torch._inductor.fx_passes.post_grad.scatter_upon_const_tensor](args = (), kwargs = {shape: [64, 4], background_val: 0, dtype: torch.float32, dim: 1, selector: %unsqueeze, val: 1})
triton_poi_fused_scatter_3 = async_compile.triton('triton_poi_fused_scatter_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*i64', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_scatter_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_scatter_3(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = (xindex // 4)
x0 = xindex % 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp1 = x0
tmp2 = tmp0 == tmp1
tmp3 = 1.0
tmp4 = 0.0
tmp5 = tl.where(tmp2, tmp3, tmp4)
tl.store(out_ptr0 + (x2), tmp5, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/q2/cq24hmqtvfblft2slktho4yrwgljb7yc26un25ohqnsjv4htdt4u.py
# Topologically Sorted Source Nodes: [latents, commitment_loss, mul_1, vq_loss], Original ATen: [aten.clone, aten.mse_loss, aten.mul, aten.add]
# Source node to ATen node mapping:
# commitment_loss => mean, pow_3, sub_1
# latents => clone
# mul_1 => mul_1
# vq_loss => add_1
# Graph fragment:
# %clone : [num_users=3] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
# %sub_1 : [num_users=3] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_1, %clone), kwargs = {})
# %pow_3 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Scalar](args = (%sub_1, 2), kwargs = {})
# %mean : [num_users=2] = call_function[target=torch.ops.aten.mean.default](args = (%pow_3,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mean, 0.25), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, %mean), kwargs = {})
triton_per_fused_add_clone_mse_loss_mul_4 = async_compile.triton('triton_per_fused_add_clone_mse_loss_mul_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_clone_mse_loss_mul_4', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_clone_mse_loss_mul_4(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r3 = rindex
r0 = rindex % 4
r1 = (rindex // 4) % 16
r2 = (rindex // 64)
tmp0 = tl.load(in_ptr0 + (r3), None)
tmp1 = tl.load(in_ptr1 + (r1 + (16*r0) + (64*r2)), None, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp3 = tmp2 * tmp2
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tmp7 = 256.0
tmp8 = tmp6 / tmp7
tmp9 = 0.25
tmp10 = tmp8 * tmp9
tmp11 = tmp10 + tmp8
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp11, None)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/hw/chwygzi5nyxhprs3zdxgfmgjft5cozvbp3ndu6tgtrshdfvktxae.py
# Topologically Sorted Source Nodes: [contiguous_1], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# contiguous_1 => clone_1
# Graph fragment:
# %clone_1 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute_2,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_5 = async_compile.triton('triton_poi_fused_clone_5', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 16], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_5', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_5(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = (yindex // 4)
tmp0 = tl.load(in_ptr0 + (x2 + (16*y3)), xmask & ymask)
tmp1 = tl.load(in_ptr1 + (y0 + (4*x2) + (64*y1)), xmask & ymask)
tmp2 = tmp1 - tmp0
tmp3 = tmp0 + tmp2
tl.store(out_ptr0 + (x2 + (16*y3)), tmp3, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/hv/chvjnf47pob5gcg7s6gozmhfrxafd765t6zvezusswetka32p7n6.py
# Topologically Sorted Source Nodes: [latents, commitment_loss], Original ATen: [aten.clone, aten.mse_loss, aten.mse_loss_backward]
# Source node to ATen node mapping:
# commitment_loss => sub_1
# latents => clone
# Graph fragment:
# %clone : [num_users=3] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
# %sub_1 : [num_users=3] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_1, %clone), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub_1, 0.0078125), kwargs = {})
triton_poi_fused_clone_mse_loss_mse_loss_backward_6 = async_compile.triton('triton_poi_fused_clone_mse_loss_mse_loss_backward_6', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64, 4], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_mse_loss_mse_loss_backward_6', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_mse_loss_mse_loss_backward_6(in_out_ptr0, in_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 64
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 16
y1 = (yindex // 16)
tmp0 = tl.load(in_out_ptr0 + (x2 + (4*y3)), xmask & ymask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (y0 + (16*x2) + (64*y1)), xmask & ymask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp3 = 0.0078125
tmp4 = tmp2 * tmp3
tl.debug_barrier()
tl.store(in_out_ptr0 + (x2 + (4*y3)), tmp4, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [latents, flat_latents], Original ATen: [aten.clone, aten.view]
stream0 = get_raw_stream(0)
triton_poi_fused_clone_view_0.run(primals_1, buf0, 64, 4, grid=grid(64, 4), stream=stream0)
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul], Original ATen: [aten.mm]
extern_kernels.mm(buf0, reinterpret_tensor(primals_2, (4, 4), (1, 4), 0), out=buf1)
buf2 = buf1; del buf1 # reuse
# Topologically Sorted Source Nodes: [pow_1, sum_1, pow_2, sum_2, add, mul, dist], Original ATen: [aten.pow, aten.sum, aten.add, aten.mul, aten.sub]
triton_poi_fused_add_mul_pow_sub_sum_1.run(buf2, buf0, primals_2, 256, grid=grid(256), stream=stream0)
buf3 = empty_strided_cuda((64, ), (1, ), torch.int64)
# Topologically Sorted Source Nodes: [argmin], Original ATen: [aten.argmin]
triton_poi_fused_argmin_2.run(buf2, buf3, 64, grid=grid(64), stream=stream0)
buf4 = buf2; del buf2 # reuse
# Topologically Sorted Source Nodes: [scatter_], Original ATen: [aten.scatter]
triton_poi_fused_scatter_3.run(buf3, buf4, 256, grid=grid(256), stream=stream0)
del buf3
buf5 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [quantized_latents], Original ATen: [aten.mm]
extern_kernels.mm(buf4, primals_2, out=buf5)
del primals_2
buf6 = empty_strided_cuda((), (), torch.float32)
buf9 = buf6; del buf6 # reuse
# Topologically Sorted Source Nodes: [latents, commitment_loss, mul_1, vq_loss], Original ATen: [aten.clone, aten.mse_loss, aten.mul, aten.add]
triton_per_fused_add_clone_mse_loss_mul_4.run(buf9, buf5, primals_1, 1, 256, grid=grid(1), stream=stream0)
buf7 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [contiguous_1], Original ATen: [aten.clone]
triton_poi_fused_clone_5.run(primals_1, buf5, buf7, 16, 16, grid=grid(16, 16), stream=stream0)
buf8 = reinterpret_tensor(buf5, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf5 # reuse
# Topologically Sorted Source Nodes: [latents, commitment_loss], Original ATen: [aten.clone, aten.mse_loss, aten.mse_loss_backward]
triton_poi_fused_clone_mse_loss_mse_loss_backward_6.run(buf8, primals_1, 64, 4, grid=grid(64, 4), stream=stream0)
del primals_1
return (buf7, buf9, buf8, reinterpret_tensor(buf4, (4, 64), (1, 4), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import Tensor
from torch import nn
from torch.nn import functional as F
class VectorQuantizer(nn.Module):
"""
Reference:
[1] https://github.com/deepmind/sonnet/blob/v2/sonnet/src/nets/vqvae.py
"""
def __init__(self, num_embeddings: 'int', embedding_dim: 'int', beta:
'float'=0.25):
super(VectorQuantizer, self).__init__()
self.K = num_embeddings
self.D = embedding_dim
self.beta = beta
self.embedding = nn.Embedding(self.K, self.D)
self.embedding.weight.data.uniform_(-1 / self.K, 1 / self.K)
def forward(self, latents: 'Tensor') ->Tensor:
latents = latents.permute(0, 2, 3, 1).contiguous()
latents_shape = latents.shape
flat_latents = latents.view(-1, self.D)
dist = torch.sum(flat_latents ** 2, dim=1, keepdim=True) + torch.sum(
self.embedding.weight ** 2, dim=1) - 2 * torch.matmul(flat_latents,
self.embedding.weight.t())
encoding_inds = torch.argmin(dist, dim=1).unsqueeze(1)
device = latents.device
encoding_one_hot = torch.zeros(encoding_inds.size(0), self.K,
device=device)
encoding_one_hot.scatter_(1, encoding_inds, 1)
quantized_latents = torch.matmul(encoding_one_hot, self.embedding.
weight)
quantized_latents = quantized_latents.view(latents_shape)
commitment_loss = F.mse_loss(quantized_latents.detach(), latents)
embedding_loss = F.mse_loss(quantized_latents, latents.detach())
vq_loss = commitment_loss * self.beta + embedding_loss
quantized_latents = latents + (quantized_latents - latents).detach()
return quantized_latents.permute(0, 3, 1, 2).contiguous(), vq_loss
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'num_embeddings': 4, 'embedding_dim': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_clone_view_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK:
tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 64
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x1 = xindex
y0 = yindex
tmp0 = tl.load(in_ptr0 + (16 * x1 + 64 * (y0 // 16) + y0 % 16), xmask &
ymask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x1 + 4 * y0), tmp0, xmask & ymask)
@triton.jit
def triton_poi_fused_add_mul_pow_sub_sum_1(in_out_ptr0, in_ptr0, in_ptr1,
xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 4
x0 = xindex % 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr1 + 4 * x0, xmask, eviction_policy='evict_last')
tmp13 = tl.load(in_ptr1 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp16 = tl.load(in_ptr1 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp19 = tl.load(in_ptr1 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp23 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tmp0 * tmp0
tmp3 = tmp2 * tmp2
tmp4 = tmp1 + tmp3
tmp6 = tmp5 * tmp5
tmp7 = tmp4 + tmp6
tmp9 = tmp8 * tmp8
tmp10 = tmp7 + tmp9
tmp12 = tmp11 * tmp11
tmp14 = tmp13 * tmp13
tmp15 = tmp12 + tmp14
tmp17 = tmp16 * tmp16
tmp18 = tmp15 + tmp17
tmp20 = tmp19 * tmp19
tmp21 = tmp18 + tmp20
tmp22 = tmp10 + tmp21
tmp24 = 2.0
tmp25 = tmp23 * tmp24
tmp26 = tmp22 - tmp25
tl.store(in_out_ptr0 + x2, tmp26, xmask)
@triton.jit
def triton_poi_fused_argmin_2(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + 4 * x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (1 + 4 * x0), xmask, eviction_policy='evict_last')
tmp17 = tl.load(in_ptr0 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp32 = tl.load(in_ptr0 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp2 = tmp0 < tmp1
tmp3 = tmp0 == tmp1
tmp4 = tmp0 != tmp0
tmp5 = tmp1 != tmp1
tmp6 = tmp4 > tmp5
tmp7 = tmp2 | tmp6
tmp8 = tmp4 & tmp5
tmp9 = tmp3 | tmp8
tmp10 = tl.full([1], 0, tl.int64)
tmp11 = tl.full([1], 1, tl.int64)
tmp12 = tmp10 < tmp11
tmp13 = tmp9 & tmp12
tmp14 = tmp7 | tmp13
tmp15 = tl.where(tmp14, tmp0, tmp1)
tmp16 = tl.where(tmp14, tmp10, tmp11)
tmp18 = tmp15 < tmp17
tmp19 = tmp15 == tmp17
tmp20 = tmp15 != tmp15
tmp21 = tmp17 != tmp17
tmp22 = tmp20 > tmp21
tmp23 = tmp18 | tmp22
tmp24 = tmp20 & tmp21
tmp25 = tmp19 | tmp24
tmp26 = tl.full([1], 2, tl.int64)
tmp27 = tmp16 < tmp26
tmp28 = tmp25 & tmp27
tmp29 = tmp23 | tmp28
tmp30 = tl.where(tmp29, tmp15, tmp17)
tmp31 = tl.where(tmp29, tmp16, tmp26)
tmp33 = tmp30 < tmp32
tmp34 = tmp30 == tmp32
tmp35 = tmp30 != tmp30
tmp36 = tmp32 != tmp32
tmp37 = tmp35 > tmp36
tmp38 = tmp33 | tmp37
tmp39 = tmp35 & tmp36
tmp40 = tmp34 | tmp39
tmp41 = tl.full([1], 3, tl.int64)
tmp42 = tmp31 < tmp41
tmp43 = tmp40 & tmp42
tmp44 = tmp38 | tmp43
tl.where(tmp44, tmp30, tmp32)
tmp46 = tl.where(tmp44, tmp31, tmp41)
tl.store(out_ptr0 + x0, tmp46, xmask)
@triton.jit
def triton_poi_fused_scatter_3(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x1 = xindex // 4
x0 = xindex % 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp1 = x0
tmp2 = tmp0 == tmp1
tmp3 = 1.0
tmp4 = 0.0
tmp5 = tl.where(tmp2, tmp3, tmp4)
tl.store(out_ptr0 + x2, tmp5, xmask)
@triton.jit
def triton_per_fused_add_clone_mse_loss_mul_4(in_out_ptr0, in_ptr0, in_ptr1,
xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r3 = rindex
r0 = rindex % 4
r1 = rindex // 4 % 16
r2 = rindex // 64
tmp0 = tl.load(in_ptr0 + r3, None)
tmp1 = tl.load(in_ptr1 + (r1 + 16 * r0 + 64 * r2), None,
eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp3 = tmp2 * tmp2
tmp4 = tl.broadcast_to(tmp3, [RBLOCK])
tmp6 = triton_helpers.promote_to_tensor(tl.sum(tmp4, 0))
tmp7 = 256.0
tmp8 = tmp6 / tmp7
tmp9 = 0.25
tmp10 = tmp8 * tmp9
tmp11 = tmp10 + tmp8
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp11, None)
@triton.jit
def triton_poi_fused_clone_5(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel,
YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 16
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = yindex // 4
tmp0 = tl.load(in_ptr0 + (x2 + 16 * y3), xmask & ymask)
tmp1 = tl.load(in_ptr1 + (y0 + 4 * x2 + 64 * y1), xmask & ymask)
tmp2 = tmp1 - tmp0
tmp3 = tmp0 + tmp2
tl.store(out_ptr0 + (x2 + 16 * y3), tmp3, xmask & ymask)
@triton.jit
def triton_poi_fused_clone_mse_loss_mse_loss_backward_6(in_out_ptr0,
in_ptr0, ynumel, xnumel, YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 64
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 16
y1 = yindex // 16
tmp0 = tl.load(in_out_ptr0 + (x2 + 4 * y3), xmask & ymask,
eviction_policy='evict_last')
tmp1 = tl.load(in_ptr0 + (y0 + 16 * x2 + 64 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp3 = 0.0078125
tmp4 = tmp2 * tmp3
tl.debug_barrier()
tl.store(in_out_ptr0 + (x2 + 4 * y3), tmp4, xmask & ymask)
def call(args):
primals_1, primals_2 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_clone_view_0[grid(64, 4)](primals_1, buf0, 64, 4,
XBLOCK=4, YBLOCK=32, num_warps=4, num_stages=1)
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(buf0, reinterpret_tensor(primals_2, (4, 4), (1, 4
), 0), out=buf1)
buf2 = buf1
del buf1
triton_poi_fused_add_mul_pow_sub_sum_1[grid(256)](buf2, buf0,
primals_2, 256, XBLOCK=128, num_warps=4, num_stages=1)
buf3 = empty_strided_cuda((64,), (1,), torch.int64)
triton_poi_fused_argmin_2[grid(64)](buf2, buf3, 64, XBLOCK=64,
num_warps=1, num_stages=1)
buf4 = buf2
del buf2
triton_poi_fused_scatter_3[grid(256)](buf3, buf4, 256, XBLOCK=128,
num_warps=4, num_stages=1)
del buf3
buf5 = buf0
del buf0
extern_kernels.mm(buf4, primals_2, out=buf5)
del primals_2
buf6 = empty_strided_cuda((), (), torch.float32)
buf9 = buf6
del buf6
triton_per_fused_add_clone_mse_loss_mul_4[grid(1)](buf9, buf5,
primals_1, 1, 256, num_warps=2, num_stages=1)
buf7 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_clone_5[grid(16, 16)](primals_1, buf5, buf7, 16,
16, XBLOCK=16, YBLOCK=16, num_warps=4, num_stages=1)
buf8 = reinterpret_tensor(buf5, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf5
triton_poi_fused_clone_mse_loss_mse_loss_backward_6[grid(64, 4)](buf8,
primals_1, 64, 4, XBLOCK=4, YBLOCK=32, num_warps=4, num_stages=1)
del primals_1
return buf7, buf9, buf8, reinterpret_tensor(buf4, (4, 64), (1, 4), 0)
class VectorQuantizerNew(nn.Module):
"""
Reference:
[1] https://github.com/deepmind/sonnet/blob/v2/sonnet/src/nets/vqvae.py
"""
def __init__(self, num_embeddings: 'int', embedding_dim: 'int', beta:
'float'=0.25):
super(VectorQuantizerNew, self).__init__()
self.K = num_embeddings
self.D = embedding_dim
self.beta = beta
self.embedding = nn.Embedding(self.K, self.D)
self.embedding.weight.data.uniform_(-1 / self.K, 1 / self.K)
def forward(self, input_0):
primals_2 = self.embedding.weight
primals_1 = input_0
output = call([primals_1, primals_2])
return output[0], output[1]
|
ClaartjeBarkhof/PyTorch-VAE
|
VectorQuantizer
| false | 2,131 |
[
"Apache-2.0"
] | 0 |
a1ac49015c306b1cfc0d4d797669b17044f0a1eb
|
https://github.com/ClaartjeBarkhof/PyTorch-VAE/tree/a1ac49015c306b1cfc0d4d797669b17044f0a1eb
|
DeepHeadModule
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/td/ctdybbibnws4d7ukbk3fpn35zkgapxylowdhzwx7vgsllncbdrxa.py
# Topologically Sorted Source Nodes: [conv2d, relu], Original ATen: [aten.convolution, aten.relu]
# Source node to ATen node mapping:
# conv2d => convolution
# relu => relu
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [1, 1], [1, 1], False, [0, 0], 1), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%convolution,), kwargs = {})
triton_poi_fused_convolution_relu_0 = async_compile.triton('triton_poi_fused_convolution_relu_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_relu_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_relu_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + (x3), tmp4, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/32/c32v7egt4mupqssam3gmac2qgv3ujprjybthsgweflmot256qqw7.py
# Topologically Sorted Source Nodes: [conv2d_3], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv2d_3 => convolution_3
# Graph fragment:
# %convolution_3 : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%relu_2, %primals_8, %primals_9, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_1 = async_compile.triton('triton_poi_fused_convolution_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_7, (4, ), (1, ))
assert_size_stride(primals_8, (4, 4, 1, 1), (4, 1, 1, 1))
assert_size_stride(primals_9, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 4, 4), (64, 16, 4, 1))
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [conv2d, relu], Original ATen: [aten.convolution, aten.relu]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_relu_0.run(buf1, primals_2, 256, grid=grid(256), stream=stream0)
del primals_2
# Topologically Sorted Source Nodes: [conv2d_1], Original ATen: [aten.convolution]
buf2 = extern_kernels.convolution(buf1, primals_4, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 4, 4, 4), (64, 16, 4, 1))
buf3 = buf2; del buf2 # reuse
# Topologically Sorted Source Nodes: [conv2d_1, relu_1], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_0.run(buf3, primals_5, 256, grid=grid(256), stream=stream0)
del primals_5
# Topologically Sorted Source Nodes: [conv2d_2], Original ATen: [aten.convolution]
buf4 = extern_kernels.convolution(buf3, primals_6, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf4, (4, 4, 4, 4), (64, 16, 4, 1))
buf5 = buf4; del buf4 # reuse
# Topologically Sorted Source Nodes: [conv2d_2, relu_2], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_0.run(buf5, primals_7, 256, grid=grid(256), stream=stream0)
del primals_7
# Topologically Sorted Source Nodes: [conv2d_3], Original ATen: [aten.convolution]
buf6 = extern_kernels.convolution(buf5, primals_8, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf6, (4, 4, 4, 4), (64, 16, 4, 1))
buf7 = buf6; del buf6 # reuse
# Topologically Sorted Source Nodes: [conv2d_3], Original ATen: [aten.convolution]
triton_poi_fused_convolution_1.run(buf7, primals_9, 256, grid=grid(256), stream=stream0)
del primals_9
return (buf7, primals_1, primals_3, primals_4, primals_6, primals_8, buf1, buf3, buf5, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((4, 4, 1, 1), (4, 1, 1, 1), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class DeepHeadModule(nn.Module):
def __init__(self, input_channels, output_channels):
super(DeepHeadModule, self).__init__()
self._input_channels = input_channels
self._output_channels = output_channels
self._mid_channels = min(self._input_channels, 256)
self.conv1 = nn.Conv2d(self._input_channels, self._mid_channels,
kernel_size=3, dilation=1, stride=1, padding=1)
self.conv2 = nn.Conv2d(self._mid_channels, self._mid_channels,
kernel_size=3, dilation=1, stride=1, padding=1)
self.conv3 = nn.Conv2d(self._mid_channels, self._mid_channels,
kernel_size=3, dilation=1, stride=1, padding=1)
self.conv4 = nn.Conv2d(self._mid_channels, self._output_channels,
kernel_size=1, dilation=1, stride=1, padding=0)
def forward(self, x):
return self.conv4(F.relu(self.conv3(F.relu(self.conv2(F.relu(self.
conv1(x), inplace=True)), inplace=True)), inplace=True))
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'input_channels': 4, 'output_channels': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
@triton.jit
def triton_poi_fused_convolution_relu_0(in_out_ptr0, in_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 16 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + x3, tmp4, xmask)
@triton.jit
def triton_poi_fused_convolution_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 16 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_7, (4,), (1,))
assert_size_stride(primals_8, (4, 4, 1, 1), (4, 1, 1, 1))
assert_size_stride(primals_9, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 4, 4), (64, 16, 4, 1))
buf1 = buf0
del buf0
get_raw_stream(0)
triton_poi_fused_convolution_relu_0[grid(256)](buf1, primals_2, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_2
buf2 = extern_kernels.convolution(buf1, primals_4, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 4, 4, 4), (64, 16, 4, 1))
buf3 = buf2
del buf2
triton_poi_fused_convolution_relu_0[grid(256)](buf3, primals_5, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_5
buf4 = extern_kernels.convolution(buf3, primals_6, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf4, (4, 4, 4, 4), (64, 16, 4, 1))
buf5 = buf4
del buf4
triton_poi_fused_convolution_relu_0[grid(256)](buf5, primals_7, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_7
buf6 = extern_kernels.convolution(buf5, primals_8, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf6, (4, 4, 4, 4), (64, 16, 4, 1))
buf7 = buf6
del buf6
triton_poi_fused_convolution_1[grid(256)](buf7, primals_9, 256,
XBLOCK=128, num_warps=4, num_stages=1)
del primals_9
return (buf7, primals_1, primals_3, primals_4, primals_6, primals_8,
buf1, buf3, buf5)
class DeepHeadModuleNew(nn.Module):
def __init__(self, input_channels, output_channels):
super(DeepHeadModuleNew, self).__init__()
self._input_channels = input_channels
self._output_channels = output_channels
self._mid_channels = min(self._input_channels, 256)
self.conv1 = nn.Conv2d(self._input_channels, self._mid_channels,
kernel_size=3, dilation=1, stride=1, padding=1)
self.conv2 = nn.Conv2d(self._mid_channels, self._mid_channels,
kernel_size=3, dilation=1, stride=1, padding=1)
self.conv3 = nn.Conv2d(self._mid_channels, self._mid_channels,
kernel_size=3, dilation=1, stride=1, padding=1)
self.conv4 = nn.Conv2d(self._mid_channels, self._output_channels,
kernel_size=1, dilation=1, stride=1, padding=0)
def forward(self, input_0):
primals_1 = self.conv1.weight
primals_2 = self.conv1.bias
primals_4 = self.conv2.weight
primals_5 = self.conv2.bias
primals_6 = self.conv3.weight
primals_7 = self.conv3.bias
primals_8 = self.conv4.weight
primals_9 = self.conv4.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9])
return output[0]
|
DannyDannyDanny/DeepPrivacy
|
DeepHeadModule
| false | 2,132 |
[
"MIT"
] | 0 |
749e260bdcc28a0c12d526f24e4f5315d1b447ad
|
https://github.com/DannyDannyDanny/DeepPrivacy/tree/749e260bdcc28a0c12d526f24e4f5315d1b447ad
|
SelfAttentionLayer
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/dl/cdlnancxvhn4lkib675sggs2zc3c7shf2pdpnmegbvaaygwfzcc6.py
# Topologically Sorted Source Nodes: [wrapped_sqrt, softmax], Original ATen: [aten.sqrt, aten._softmax]
# Source node to ATen node mapping:
# softmax => exp
# wrapped_sqrt => full_default
# Graph fragment:
# %full_default : [num_users=2] = call_function[target=torch.ops.aten.full.default](args = ([], 2.0), kwargs = {dtype: torch.float64, layout: torch.strided, device: cpu, pin_memory: False})
# %scalar_tensor_default : [num_users=2] = call_function[target=torch.ops.aten.scalar_tensor.default](args = (1,), kwargs = {dtype: torch.float32, device: cuda:0, pin_memory: False})
# %ge_scalar : [num_users=1] = call_function[target=torch.ops.aten.ge.Scalar](args = (%full_default, 0), kwargs = {})
# %neg_default : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%scalar_tensor_default,), kwargs = {})
# %where_self : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%ge_scalar, %scalar_tensor_default, %neg_default), kwargs = {})
# %mul_tensor : [num_users=2] = call_function[target=torch.ops.aten.mul.Tensor](args = (%bmm, %where_self), kwargs = {})
# %amax_default : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%mul_tensor, [-1], True), kwargs = {})
# %sub_tensor : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%mul_tensor, %amax_default), kwargs = {})
# %mul_tensor_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%where_self, %full_default), kwargs = {})
# %div_tensor : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%sub_tensor, %mul_tensor_1), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%div_tensor,), kwargs = {})
triton_poi_fused__softmax_sqrt_0 = async_compile.triton('triton_poi_fused__softmax_sqrt_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_sqrt_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_sqrt_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp8 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp13 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp16 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp1 = tl.full([1], 2.0, tl.float64)
tmp2 = tl.full([1], 0.0, tl.float64)
tmp3 = tmp1 >= tmp2
tmp4 = 1.0
tmp5 = -1.0
tmp6 = tl.where(tmp3, tmp4, tmp5)
tmp7 = tmp0 * tmp6
tmp9 = tmp8 * tmp6
tmp11 = tmp10 * tmp6
tmp12 = triton_helpers.maximum(tmp9, tmp11)
tmp14 = tmp13 * tmp6
tmp15 = triton_helpers.maximum(tmp12, tmp14)
tmp17 = tmp16 * tmp6
tmp18 = triton_helpers.maximum(tmp15, tmp17)
tmp19 = tmp7 - tmp18
tmp20 = tmp6.to(tl.float64)
tmp21 = tmp20 * tmp1
tmp22 = tmp21.to(tl.float32)
tmp23 = tmp19 / tmp22
tmp24 = tl_math.exp(tmp23)
tl.store(out_ptr0 + (x2), tmp24, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/kj/ckjtlefzavjukjsytvkak6ek26zmzexpcbnlwelx4k5kascjxlf3.py
# Topologically Sorted Source Nodes: [softmax], Original ATen: [aten._softmax]
# Source node to ATen node mapping:
# softmax => div_1, sum_1
# Graph fragment:
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [-1], True), kwargs = {})
# %div_1 : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
triton_poi_fused__softmax_1 = async_compile.triton('triton_poi_fused__softmax_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + (x2), tmp8, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 4), (4, 1))
assert_size_stride(primals_7, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [K], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_3, (16, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_4
del primals_5
buf1 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [V], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_7, reinterpret_tensor(primals_3, (16, 4), (4, 1), 0), reinterpret_tensor(primals_6, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf1)
del primals_6
del primals_7
buf2 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [bmm], Original ATen: [aten.bmm]
extern_kernels.bmm(reinterpret_tensor(buf0, (4, 4, 4), (16, 4, 1), 0), reinterpret_tensor(buf1, (4, 4, 4), (16, 1, 4), 0), out=buf2)
buf3 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [wrapped_sqrt, softmax], Original ATen: [aten.sqrt, aten._softmax]
stream0 = get_raw_stream(0)
triton_poi_fused__softmax_sqrt_0.run(buf2, buf3, 64, grid=grid(64), stream=stream0)
buf4 = buf2; del buf2 # reuse
# Topologically Sorted Source Nodes: [softmax], Original ATen: [aten._softmax]
triton_poi_fused__softmax_1.run(buf3, buf4, 64, grid=grid(64), stream=stream0)
buf5 = buf3; del buf3 # reuse
# Topologically Sorted Source Nodes: [bmm_1], Original ATen: [aten.bmm]
extern_kernels.bmm(buf4, reinterpret_tensor(buf1, (4, 4, 4), (16, 4, 1), 0), out=buf5)
return (buf5, reinterpret_tensor(primals_3, (16, 4), (4, 1), 0), reinterpret_tensor(buf1, (4, 4, 4), (16, 1, 4), 0), buf4, reinterpret_tensor(buf0, (4, 4, 4), (16, 1, 4), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import numpy as np
import torch.nn as nn
class SelfAttentionLayer(nn.Module):
def __init__(self, d_x, d_k, d_v):
super().__init__()
self.d_x = d_x
self.d_k = d_k
self.d_v = d_v
self.w_q = nn.Linear(d_x, d_k)
self.w_k = nn.Linear(d_x, d_k)
self.w_v = nn.Linear(d_x, d_v)
def forward(self, x):
self.w_q(x)
K = self.w_k(x)
V = self.w_v(x)
logits = torch.bmm(K, V.permute(0, 2, 1)) / np.sqrt(self.d_k)
return torch.bmm(torch.softmax(logits, dim=-1), V)
def get_inputs():
return [torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'d_x': 4, 'd_k': 4, 'd_v': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused__softmax_sqrt_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp8 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last'
)
tmp13 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last'
)
tmp16 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last'
)
tmp1 = tl.full([1], 2.0, tl.float64)
tmp2 = tl.full([1], 0.0, tl.float64)
tmp3 = tmp1 >= tmp2
tmp4 = 1.0
tmp5 = -1.0
tmp6 = tl.where(tmp3, tmp4, tmp5)
tmp7 = tmp0 * tmp6
tmp9 = tmp8 * tmp6
tmp11 = tmp10 * tmp6
tmp12 = triton_helpers.maximum(tmp9, tmp11)
tmp14 = tmp13 * tmp6
tmp15 = triton_helpers.maximum(tmp12, tmp14)
tmp17 = tmp16 * tmp6
tmp18 = triton_helpers.maximum(tmp15, tmp17)
tmp19 = tmp7 - tmp18
tmp20 = tmp6.to(tl.float64)
tmp21 = tmp20 * tmp1
tmp22 = tmp21.to(tl.float32)
tmp23 = tmp19 / tmp22
tmp24 = tl_math.exp(tmp23)
tl.store(out_ptr0 + x2, tmp24, xmask)
@triton.jit
def triton_poi_fused__softmax_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr
):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp3 = tmp1 + tmp2
tmp5 = tmp3 + tmp4
tmp7 = tmp5 + tmp6
tmp8 = tmp0 / tmp7
tl.store(out_ptr0 + x2, tmp8, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7) = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 4), (4, 1))
assert_size_stride(primals_7, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_3, (16,
4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf0)
del primals_4
del primals_5
buf1 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_7, reinterpret_tensor(primals_3, (16,
4), (4, 1), 0), reinterpret_tensor(primals_6, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf1)
del primals_6
del primals_7
buf2 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
extern_kernels.bmm(reinterpret_tensor(buf0, (4, 4, 4), (16, 4, 1),
0), reinterpret_tensor(buf1, (4, 4, 4), (16, 1, 4), 0), out=buf2)
buf3 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused__softmax_sqrt_0[grid(64)](buf2, buf3, 64, XBLOCK=
64, num_warps=1, num_stages=1)
buf4 = buf2
del buf2
triton_poi_fused__softmax_1[grid(64)](buf3, buf4, 64, XBLOCK=64,
num_warps=1, num_stages=1)
buf5 = buf3
del buf3
extern_kernels.bmm(buf4, reinterpret_tensor(buf1, (4, 4, 4), (16, 4,
1), 0), out=buf5)
return buf5, reinterpret_tensor(primals_3, (16, 4), (4, 1), 0
), reinterpret_tensor(buf1, (4, 4, 4), (16, 1, 4), 0
), buf4, reinterpret_tensor(buf0, (4, 4, 4), (16, 1, 4), 0)
class SelfAttentionLayerNew(nn.Module):
def __init__(self, d_x, d_k, d_v):
super().__init__()
self.d_x = d_x
self.d_k = d_k
self.d_v = d_v
self.w_q = nn.Linear(d_x, d_k)
self.w_k = nn.Linear(d_x, d_k)
self.w_v = nn.Linear(d_x, d_v)
def forward(self, input_0):
primals_1 = self.w_q.weight
primals_2 = self.w_q.bias
primals_4 = self.w_k.weight
primals_5 = self.w_k.bias
primals_6 = self.w_v.weight
primals_7 = self.w_v.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7])
return output[0]
|
Darg-Iztech/quote-detection
|
SelfAttentionLayer
| false | 2,133 |
[
"MIT"
] | 0 |
14a4731139db859f9672f54400d78d77cca8a008
|
https://github.com/Darg-Iztech/quote-detection/tree/14a4731139db859f9672f54400d78d77cca8a008
|
AFTSimple
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/vp/cvpe7zgwwkmbwkwv4adsguenicnormo3kxnjqrteka6eezwlh6zy.py
# Topologically Sorted Source Nodes: [softmax, weights, Q_sig, Yt], Original ATen: [aten._softmax, aten.mul, aten.sigmoid]
# Source node to ATen node mapping:
# Q_sig => sigmoid
# Yt => mul_1
# softmax => amax, div, exp, sub, sum_1
# weights => mul
# Graph fragment:
# %amax : [num_users=2] = call_function[target=torch.ops.aten.amax.default](args = (%view_4, [-1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_4, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %sum_1 : [num_users=2] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [-1], True), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%div, %view_7), kwargs = {})
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%view_1,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sigmoid, %mul), kwargs = {})
triton_per_fused__softmax_mul_sigmoid_0 = async_compile.triton('triton_per_fused__softmax_mul_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 64],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: 'i32', 7: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused__softmax_mul_sigmoid_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 2, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused__softmax_mul_sigmoid_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, out_ptr2, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 64
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + (64*x0)), xmask, other=0.0)
tmp11 = tl.load(in_ptr1 + (r1 + (64*x0)), xmask, other=0.0)
tmp14 = tl.load(in_ptr2 + (r1 + (64*x0)), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, float("-inf"))
tmp4 = triton_helpers.max2(tmp3, 1)[:, None]
tmp5 = tmp0 - tmp4
tmp6 = tl_math.exp(tmp5)
tmp7 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp9 = tl.where(xmask, tmp7, 0)
tmp10 = tl.sum(tmp9, 1)[:, None]
tmp12 = tl.sigmoid(tmp11)
tmp13 = tmp6 / tmp10
tmp15 = tmp13 * tmp14
tmp16 = tmp12 * tmp15
tl.store(out_ptr2 + (r1 + (64*x0)), tmp16, xmask)
tl.store(out_ptr0 + (x0), tmp4, xmask)
tl.store(out_ptr1 + (x0), tmp10, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (64, 4), (4, 1))
assert_size_stride(primals_3, (64, ), (1, ))
assert_size_stride(primals_4, (64, 4), (4, 1))
assert_size_stride(primals_5, (64, ), (1, ))
assert_size_stride(primals_6, (64, 4), (4, 1))
assert_size_stride(primals_7, (64, ), (1, ))
assert_size_stride(primals_8, (4, 64), (64, 1))
assert_size_stride(primals_9, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_3, reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 64), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_2
del primals_3
buf1 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_1], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 64), (1, 4), 0), alpha=1, beta=1, out=buf1)
del primals_4
del primals_5
buf2 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_7, reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_6, (4, 64), (1, 4), 0), alpha=1, beta=1, out=buf2)
del primals_6
del primals_7
buf3 = empty_strided_cuda((4, 4, 1), (4, 1, 1), torch.float32)
buf4 = empty_strided_cuda((4, 4, 1), (4, 1, 1), torch.float32)
buf5 = empty_strided_cuda((4, 4, 64), (256, 64, 1), torch.float32)
# Topologically Sorted Source Nodes: [softmax, weights, Q_sig, Yt], Original ATen: [aten._softmax, aten.mul, aten.sigmoid]
stream0 = get_raw_stream(0)
triton_per_fused__softmax_mul_sigmoid_0.run(buf1, buf0, buf2, buf3, buf4, buf5, 16, 64, grid=grid(16), stream=stream0)
buf6 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [Yt_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_9, reinterpret_tensor(buf5, (16, 64), (64, 1), 0), reinterpret_tensor(primals_8, (64, 4), (1, 64), 0), alpha=1, beta=1, out=buf6)
del primals_9
return (reinterpret_tensor(buf6, (4, 4, 4), (16, 4, 1), 0), reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), buf0, buf1, buf2, buf3, buf4, reinterpret_tensor(buf5, (16, 64), (64, 1), 0), primals_8, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((64, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((64, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((64, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((4, 64), (64, 1), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
class AFTSimple(nn.Module):
def __init__(self, max_seqlen, dim, hidden_dim=64):
super().__init__()
"""
max_seqlen: the maximum number of timesteps (sequence length) to be fed in
dim: the embedding dimension of the tokens
hidden_dim: the hidden dimension used inside AFT Full
Number of Heads is 1 as done in the paper.
"""
self.dim = dim
self.hidden_dim = hidden_dim
self.to_q = nn.Linear(dim, hidden_dim)
self.to_k = nn.Linear(dim, hidden_dim)
self.to_v = nn.Linear(dim, hidden_dim)
self.project = nn.Linear(hidden_dim, dim)
def forward(self, x):
B, T, _ = x.shape
Q = self.to_q(x).view(B, T, self.hidden_dim)
K = self.to_k(x).view(B, T, self.hidden_dim)
V = self.to_v(x).view(B, T, self.hidden_dim)
"""
From the paper
"""
weights = torch.mul(torch.softmax(K, -1), V)
Q_sig = torch.sigmoid(Q)
Yt = torch.mul(Q_sig, weights)
Yt = Yt.view(B, T, self.hidden_dim)
Yt = self.project(Yt)
return Yt
def get_inputs():
return [torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'max_seqlen': 4, 'dim': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import math as tl_math
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_per_fused__softmax_mul_sigmoid_0(in_ptr0, in_ptr1, in_ptr2,
out_ptr0, out_ptr1, out_ptr2, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + 64 * x0), xmask, other=0.0)
tmp11 = tl.load(in_ptr1 + (r1 + 64 * x0), xmask, other=0.0)
tmp14 = tl.load(in_ptr2 + (r1 + 64 * x0), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, float('-inf'))
tmp4 = triton_helpers.max2(tmp3, 1)[:, None]
tmp5 = tmp0 - tmp4
tmp6 = tl_math.exp(tmp5)
tmp7 = tl.broadcast_to(tmp6, [XBLOCK, RBLOCK])
tmp9 = tl.where(xmask, tmp7, 0)
tmp10 = tl.sum(tmp9, 1)[:, None]
tmp12 = tl.sigmoid(tmp11)
tmp13 = tmp6 / tmp10
tmp15 = tmp13 * tmp14
tmp16 = tmp12 * tmp15
tl.store(out_ptr2 + (r1 + 64 * x0), tmp16, xmask)
tl.store(out_ptr0 + x0, tmp4, xmask)
tl.store(out_ptr1 + x0, tmp10, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (64, 4), (4, 1))
assert_size_stride(primals_3, (64,), (1,))
assert_size_stride(primals_4, (64, 4), (4, 1))
assert_size_stride(primals_5, (64,), (1,))
assert_size_stride(primals_6, (64, 4), (4, 1))
assert_size_stride(primals_7, (64,), (1,))
assert_size_stride(primals_8, (4, 64), (64, 1))
assert_size_stride(primals_9, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
extern_kernels.addmm(primals_3, reinterpret_tensor(primals_1, (16,
4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 64), (1, 4),
0), alpha=1, beta=1, out=buf0)
del primals_2
del primals_3
buf1 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_1, (16,
4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 64), (1, 4),
0), alpha=1, beta=1, out=buf1)
del primals_4
del primals_5
buf2 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
extern_kernels.addmm(primals_7, reinterpret_tensor(primals_1, (16,
4), (4, 1), 0), reinterpret_tensor(primals_6, (4, 64), (1, 4),
0), alpha=1, beta=1, out=buf2)
del primals_6
del primals_7
buf3 = empty_strided_cuda((4, 4, 1), (4, 1, 1), torch.float32)
buf4 = empty_strided_cuda((4, 4, 1), (4, 1, 1), torch.float32)
buf5 = empty_strided_cuda((4, 4, 64), (256, 64, 1), torch.float32)
get_raw_stream(0)
triton_per_fused__softmax_mul_sigmoid_0[grid(16)](buf1, buf0, buf2,
buf3, buf4, buf5, 16, 64, XBLOCK=1, num_warps=2, num_stages=1)
buf6 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_9, reinterpret_tensor(buf5, (16, 64),
(64, 1), 0), reinterpret_tensor(primals_8, (64, 4), (1, 64), 0),
alpha=1, beta=1, out=buf6)
del primals_9
return reinterpret_tensor(buf6, (4, 4, 4), (16, 4, 1), 0
), reinterpret_tensor(primals_1, (16, 4), (4, 1), 0
), buf0, buf1, buf2, buf3, buf4, reinterpret_tensor(buf5, (16, 64),
(64, 1), 0), primals_8
class AFTSimpleNew(nn.Module):
def __init__(self, max_seqlen, dim, hidden_dim=64):
super().__init__()
"""
max_seqlen: the maximum number of timesteps (sequence length) to be fed in
dim: the embedding dimension of the tokens
hidden_dim: the hidden dimension used inside AFT Full
Number of Heads is 1 as done in the paper.
"""
self.dim = dim
self.hidden_dim = hidden_dim
self.to_q = nn.Linear(dim, hidden_dim)
self.to_k = nn.Linear(dim, hidden_dim)
self.to_v = nn.Linear(dim, hidden_dim)
self.project = nn.Linear(hidden_dim, dim)
def forward(self, input_0):
primals_2 = self.to_q.weight
primals_3 = self.to_q.bias
primals_4 = self.to_k.weight
primals_5 = self.to_k.bias
primals_6 = self.to_v.weight
primals_7 = self.to_v.bias
primals_8 = self.project.weight
primals_9 = self.project.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9])
return output[0]
|
Datta0/aft-pytorch
|
AFTSimple
| false | 2,134 |
[
"MIT"
] | 0 |
a0ebad01ea6616b00bde319b0c5e63bea467c400
|
https://github.com/Datta0/aft-pytorch/tree/a0ebad01ea6616b00bde319b0c5e63bea467c400
|
AsymmetricLoss
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/3o/c3oppgv2z6rui2adtrud2og25lthom52d25txessl4yzaf7uj73z.py
# Topologically Sorted Source Nodes: [x_sigmoid, clamp_1, log, los_pos, sub_1, xs_neg, add, xs_neg_1, clamp_2, log_1, los_neg, loss, pt0, sub_2, pt1, pt, sub_4, mul_4, sub_3, mul_5, one_sided_gamma, one_sided_w, loss_1, sum_1, neg], Original ATen: [aten.sigmoid, aten.clamp, aten.log, aten.mul, aten.rsub, aten.add, aten.pow, aten.sum, aten.neg]
# Source node to ATen node mapping:
# add => add
# clamp_1 => clamp_max_1, clamp_min
# clamp_2 => clamp_max_2, clamp_min_1
# log => log
# log_1 => log_1
# los_neg => mul_1
# los_pos => mul
# loss => add_1
# loss_1 => mul_6
# mul_4 => mul_4
# mul_5 => mul_5
# neg => neg
# one_sided_gamma => add_3
# one_sided_w => pow_1
# pt => add_2
# pt0 => mul_2
# pt1 => mul_3
# sub_1 => sub_1
# sub_2 => sub_2
# sub_3 => sub_3
# sub_4 => sub_4
# sum_1 => sum_1
# x_sigmoid => sigmoid
# xs_neg => sub
# xs_neg_1 => clamp_max
# Graph fragment:
# %sigmoid : [num_users=3] = call_function[target=torch.ops.aten.sigmoid.default](args = (%arg0_1,), kwargs = {})
# %clamp_min : [num_users=1] = call_function[target=torch.ops.aten.clamp_min.default](args = (%sigmoid, 1e-08), kwargs = {})
# %clamp_max_1 : [num_users=1] = call_function[target=torch.ops.aten.clamp_max.default](args = (%clamp_min, 0.99999999), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%clamp_max_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg1_1, %log), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg1_1), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %sigmoid), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sub, 0.05), kwargs = {})
# %clamp_max : [num_users=2] = call_function[target=torch.ops.aten.clamp_max.default](args = (%add, 1), kwargs = {})
# %clamp_min_1 : [num_users=1] = call_function[target=torch.ops.aten.clamp_min.default](args = (%clamp_max, 1e-08), kwargs = {})
# %clamp_max_2 : [num_users=1] = call_function[target=torch.ops.aten.clamp_max.default](args = (%clamp_min_1, 0.99999999), kwargs = {})
# %log_1 : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%clamp_max_2,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub_1, %log_1), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, %mul_1), kwargs = {})
# %mul_2 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sigmoid, %arg1_1), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg1_1), kwargs = {})
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%clamp_max, %sub_2), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_2, %mul_3), kwargs = {})
# %sub_4 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %add_2), kwargs = {})
# %mul_4 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg1_1, 1), kwargs = {})
# %sub_3 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg1_1), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub_3, 4), kwargs = {})
# %add_3 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_4, %mul_5), kwargs = {})
# %pow_1 : [num_users=1] = call_function[target=torch.ops.aten.pow.Tensor_Tensor](args = (%sub_4, %add_3), kwargs = {})
# %mul_6 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%add_1, %pow_1), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%mul_6,), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%sum_1,), kwargs = {})
triton_per_fused_add_clamp_log_mul_neg_pow_rsub_sigmoid_sum_0 = async_compile.triton('triton_per_fused_add_clamp_log_mul_neg_pow_rsub_sigmoid_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {3: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 4), equal_to_1=(3,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_clamp_log_mul_neg_pow_rsub_sigmoid_sum_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_clamp_log_mul_neg_pow_rsub_sigmoid_sum_0(in_out_ptr0, in_ptr0, in_ptr1, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp1 = tl.load(in_ptr1 + (r0), None)
tmp2 = tl.sigmoid(tmp1)
tmp3 = 1e-08
tmp4 = triton_helpers.maximum(tmp2, tmp3)
tmp5 = 0.99999999
tmp6 = triton_helpers.minimum(tmp4, tmp5)
tmp7 = tl_math.log(tmp6)
tmp8 = tmp0 * tmp7
tmp9 = 1.0
tmp10 = tmp9 - tmp0
tmp11 = tmp9 - tmp2
tmp12 = 0.05
tmp13 = tmp11 + tmp12
tmp14 = triton_helpers.minimum(tmp13, tmp9)
tmp15 = triton_helpers.maximum(tmp14, tmp3)
tmp16 = triton_helpers.minimum(tmp15, tmp5)
tmp17 = tl_math.log(tmp16)
tmp18 = tmp10 * tmp17
tmp19 = tmp8 + tmp18
tmp20 = tmp2 * tmp0
tmp21 = tmp14 * tmp10
tmp22 = tmp20 + tmp21
tmp23 = tmp9 - tmp22
tmp24 = tmp0 * tmp9
tmp25 = 4.0
tmp26 = tmp10 * tmp25
tmp27 = tmp24 + tmp26
tmp28 = libdevice.pow(tmp23, tmp27)
tmp29 = tmp19 * tmp28
tmp30 = tl.broadcast_to(tmp29, [RBLOCK])
tmp32 = triton_helpers.promote_to_tensor(tl.sum(tmp30, 0))
tmp33 = -tmp32
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp33, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [x_sigmoid, clamp_1, log, los_pos, sub_1, xs_neg, add, xs_neg_1, clamp_2, log_1, los_neg, loss, pt0, sub_2, pt1, pt, sub_4, mul_4, sub_3, mul_5, one_sided_gamma, one_sided_w, loss_1, sum_1, neg], Original ATen: [aten.sigmoid, aten.clamp, aten.log, aten.mul, aten.rsub, aten.add, aten.pow, aten.sum, aten.neg]
stream0 = get_raw_stream(0)
triton_per_fused_add_clamp_log_mul_neg_pow_rsub_sigmoid_sum_0.run(buf1, arg1_1, arg0_1, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class AsymmetricLoss(nn.Module):
def __init__(self, gamma_neg=4, gamma_pos=1, clip=0.05, eps=1e-08,
disable_torch_grad_focal_loss=False):
super(AsymmetricLoss, self).__init__()
self.gamma_neg = gamma_neg
self.gamma_pos = gamma_pos
self.clip = clip
self.disable_torch_grad_focal_loss = disable_torch_grad_focal_loss
self.eps = eps
def forward(self, x, y):
""""
Parameters
----------
x: input logits
y: targets (multi-label binarized vector)
"""
x_sigmoid = torch.sigmoid(x)
xs_pos = x_sigmoid
xs_neg = 1 - x_sigmoid
if self.clip is not None and self.clip > 0:
xs_neg = (xs_neg + self.clip).clamp(max=1)
los_pos = y * torch.log(xs_pos.clamp(min=self.eps, max=1 - self.eps))
los_neg = (1 - y) * torch.log(xs_neg.clamp(min=self.eps, max=1 -
self.eps))
loss = los_pos + los_neg
if self.gamma_neg > 0 or self.gamma_pos > 0:
if self.disable_torch_grad_focal_loss:
torch._C.set_grad_enabled(False)
pt0 = xs_pos * y
pt1 = xs_neg * (1 - y)
pt = pt0 + pt1
one_sided_gamma = self.gamma_pos * y + self.gamma_neg * (1 - y)
one_sided_w = torch.pow(1 - pt, one_sided_gamma)
if self.disable_torch_grad_focal_loss:
torch._C.set_grad_enabled(True)
loss *= one_sided_w
return -loss.sum()
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_clamp_log_mul_neg_pow_rsub_sigmoid_sum_0(in_out_ptr0,
in_ptr0, in_ptr1, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp1 = tl.load(in_ptr1 + r0, None)
tmp2 = tl.sigmoid(tmp1)
tmp3 = 1e-08
tmp4 = triton_helpers.maximum(tmp2, tmp3)
tmp5 = 0.99999999
tmp6 = triton_helpers.minimum(tmp4, tmp5)
tmp7 = tl_math.log(tmp6)
tmp8 = tmp0 * tmp7
tmp9 = 1.0
tmp10 = tmp9 - tmp0
tmp11 = tmp9 - tmp2
tmp12 = 0.05
tmp13 = tmp11 + tmp12
tmp14 = triton_helpers.minimum(tmp13, tmp9)
tmp15 = triton_helpers.maximum(tmp14, tmp3)
tmp16 = triton_helpers.minimum(tmp15, tmp5)
tmp17 = tl_math.log(tmp16)
tmp18 = tmp10 * tmp17
tmp19 = tmp8 + tmp18
tmp20 = tmp2 * tmp0
tmp21 = tmp14 * tmp10
tmp22 = tmp20 + tmp21
tmp23 = tmp9 - tmp22
tmp24 = tmp0 * tmp9
tmp25 = 4.0
tmp26 = tmp10 * tmp25
tmp27 = tmp24 + tmp26
tmp28 = libdevice.pow(tmp23, tmp27)
tmp29 = tmp19 * tmp28
tmp30 = tl.broadcast_to(tmp29, [RBLOCK])
tmp32 = triton_helpers.promote_to_tensor(tl.sum(tmp30, 0))
tmp33 = -tmp32
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp33, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((), (), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_add_clamp_log_mul_neg_pow_rsub_sigmoid_sum_0[grid(1)](
buf1, arg1_1, arg0_1, 1, 256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf1,
class AsymmetricLossNew(nn.Module):
def __init__(self, gamma_neg=4, gamma_pos=1, clip=0.05, eps=1e-08,
disable_torch_grad_focal_loss=False):
super(AsymmetricLossNew, self).__init__()
self.gamma_neg = gamma_neg
self.gamma_pos = gamma_pos
self.clip = clip
self.disable_torch_grad_focal_loss = disable_torch_grad_focal_loss
self.eps = eps
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ChangeTheWorld20191008/query2labels
|
AsymmetricLoss
| false | 2,135 |
[
"MIT"
] | 0 |
cdca1f3519f75cc91ef2aa166c2534691016f04f
|
https://github.com/ChangeTheWorld20191008/query2labels/tree/cdca1f3519f75cc91ef2aa166c2534691016f04f
|
FiLM
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/es/ces44qnnsxil2dafm2xyy2gyquns7xgk6aon2uuwy4h5tpsyggbv.py
# Topologically Sorted Source Nodes: [add, mul, out], Original ATen: [aten.add, aten.mul]
# Source node to ATen node mapping:
# add => add
# mul => mul
# out => add_1
# Graph fragment:
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem, 1), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%add, %primals_4), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, %getitem_1), kwargs = {})
triton_poi_fused_add_mul_0 = async_compile.triton('triton_poi_fused_add_mul_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_mul_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_mul_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = (xindex // 4) % 16
x3 = (xindex // 256)
x4 = xindex % 256
x6 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + (8*x1) + (128*x3)), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (x0), xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr2 + (x4), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr0 + (4 + x0 + (8*x1) + (128*x3)), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr1 + (4 + x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = 1.0
tmp4 = tmp2 + tmp3
tmp6 = tmp4 * tmp5
tmp9 = tmp7 + tmp8
tmp10 = tmp6 + tmp9
tl.store(out_ptr0 + (x6), tmp10, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (8, 4), (4, 1))
assert_size_stride(primals_2, (8, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 8), (8, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 8), (1, 4), 0), out=buf0)
del primals_1
buf1 = empty_strided_cuda((4, 4, 4, 4, 4), (256, 64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [add, mul, out], Original ATen: [aten.add, aten.mul]
stream0 = get_raw_stream(0)
triton_poi_fused_add_mul_0.run(buf0, primals_2, primals_4, buf1, 1024, grid=grid(1024), stream=stream0)
del buf0
del primals_2
return (buf1, primals_4, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((8, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((8, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class FiLM(nn.Module):
""" Feature-wise Linear Modulation (FiLM) layer"""
def __init__(self, input_size, output_size, num_film_layers=1,
layer_norm=False):
"""
:param input_size: feature size of x_cond
:param output_size: feature size of x_to_film
:param layer_norm: true or false
"""
super(FiLM, self).__init__()
self.input_size = input_size
self.output_size = output_size
self.num_film_layers = num_film_layers
self.layer_norm = nn.LayerNorm(output_size) if layer_norm else None
film_output_size = self.output_size * num_film_layers * 2
self.gb_weights = nn.Linear(self.input_size, film_output_size)
self.gb_weights.bias.data.fill_(0)
def forward(self, x_cond, x_to_film):
gb = self.gb_weights(x_cond).unsqueeze(1)
gamma, beta = torch.chunk(gb, 2, dim=-1)
out = (1 + gamma) * x_to_film + beta
if self.layer_norm is not None:
out = self.layer_norm(out)
return out
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'input_size': 4, 'output_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_add_mul_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 1024
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x1 = xindex // 4 % 16
x3 = xindex // 256
x4 = xindex % 256
x6 = xindex
tmp0 = tl.load(in_ptr0 + (x0 + 8 * x1 + 128 * x3), xmask,
eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + x0, xmask, eviction_policy='evict_last')
tmp5 = tl.load(in_ptr2 + x4, xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr0 + (4 + x0 + 8 * x1 + 128 * x3), xmask,
eviction_policy='evict_last')
tmp8 = tl.load(in_ptr1 + (4 + x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = 1.0
tmp4 = tmp2 + tmp3
tmp6 = tmp4 * tmp5
tmp9 = tmp7 + tmp8
tmp10 = tmp6 + tmp9
tl.store(out_ptr0 + x6, tmp10, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (8, 4), (4, 1))
assert_size_stride(primals_2, (8,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 8), (8, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 8), (1, 4), 0), out=buf0)
del primals_1
buf1 = empty_strided_cuda((4, 4, 4, 4, 4), (256, 64, 16, 4, 1),
torch.float32)
get_raw_stream(0)
triton_poi_fused_add_mul_0[grid(1024)](buf0, primals_2, primals_4,
buf1, 1024, XBLOCK=256, num_warps=4, num_stages=1)
del buf0
del primals_2
return buf1, primals_4, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0)
class FiLMNew(nn.Module):
""" Feature-wise Linear Modulation (FiLM) layer"""
def __init__(self, input_size, output_size, num_film_layers=1,
layer_norm=False):
"""
:param input_size: feature size of x_cond
:param output_size: feature size of x_to_film
:param layer_norm: true or false
"""
super(FiLMNew, self).__init__()
self.input_size = input_size
self.output_size = output_size
self.num_film_layers = num_film_layers
self.layer_norm = nn.LayerNorm(output_size) if layer_norm else None
film_output_size = self.output_size * num_film_layers * 2
self.gb_weights = nn.Linear(self.input_size, film_output_size)
self.gb_weights.bias.data.fill_(0)
def forward(self, input_0, input_1):
primals_1 = self.gb_weights.weight
primals_2 = self.gb_weights.bias
primals_3 = input_0
primals_4 = input_1
output = call([primals_1, primals_2, primals_3, primals_4])
return output[0]
|
Daupler/CA-MTL
|
FiLM
| false | 2,136 |
[
"MIT"
] | 0 |
d417b039dee973e32f42ba5c1c346738cd29ab3c
|
https://github.com/Daupler/CA-MTL/tree/d417b039dee973e32f42ba5c1c346738cd29ab3c
|
AFTFull
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/c5/cc5hiyrqfmfxmipscxrurz47qz3x3e4v7b3qrmfw4clinzd5btca.py
# Topologically Sorted Source Nodes: [exp], Original ATen: [aten.exp]
# Source node to ATen node mapping:
# exp => exp
# Graph fragment:
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%unsqueeze,), kwargs = {})
triton_poi_fused_exp_0 = async_compile.triton('triton_poi_fused_exp_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_exp_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_exp_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = tl_math.exp(tmp0)
tl.store(out_ptr0 + (x0), tmp1, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/ct/cctsgn4jbttnem4cpsk4ma7nkks3cjt6ed3vf6o7kmyudmhhtegs.py
# Topologically Sorted Source Nodes: [temp], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# temp => clone
# Graph fragment:
# %clone : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute_3,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_1 = async_compile.triton('triton_poi_fused_clone_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 64], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_1(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 64
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = (yindex // 4)
tmp0 = tl.load(in_ptr0 + (x2 + (64*y3)), xmask & ymask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr1 + (x2 + (64*y3)), xmask & ymask, eviction_policy='evict_last')
tmp1 = tl_math.exp(tmp0)
tmp3 = tmp1 * tmp2
tl.store(out_ptr0 + (y0 + (4*x2) + (256*y1)), tmp3, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/a4/ca4q7myqhmy7hwzc4tjozpqaktxuuca5pemaz7fnjpsfntt7qv5w.py
# Topologically Sorted Source Nodes: [matmul_1], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# matmul_1 => clone_2
# Graph fragment:
# %clone_2 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute_6,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_2 = async_compile.triton('triton_poi_fused_clone_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256, 4], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_2(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 256
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 64
y1 = (yindex // 64)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (64*x2) + (256*y1)), xmask & ymask, eviction_policy='evict_last')
tmp1 = tl_math.exp(tmp0)
tl.store(out_ptr0 + (x2 + (4*y3)), tmp1, xmask & ymask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/v6/cv63i6zsdop24hcb7etspotmlequk5sybcjcn2344r7uw2gwuxkk.py
# Topologically Sorted Source Nodes: [Q_sig, temp, matmul_1, weighted, Yt], Original ATen: [aten.sigmoid, aten.clone, aten.div, aten.mul]
# Source node to ATen node mapping:
# Q_sig => sigmoid
# Yt => mul_1
# matmul_1 => clone_3
# temp => clone_1
# weighted => div
# Graph fragment:
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%view_1,), kwargs = {})
# %clone_1 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute_5,), kwargs = {memory_format: torch.contiguous_format})
# %clone_3 : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute_8,), kwargs = {memory_format: torch.contiguous_format})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%clone_1, %clone_3), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sigmoid, %div), kwargs = {})
triton_poi_fused_clone_div_mul_sigmoid_3 = async_compile.triton('triton_poi_fused_clone_div_mul_sigmoid_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16, 64], tile_hint=TileHint.DEFAULT,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_div_mul_sigmoid_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_div_mul_sigmoid_3(in_ptr0, in_ptr1, in_ptr2, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 16
xnumel = 64
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = (yindex // 4)
tmp0 = tl.load(in_ptr0 + (x2 + (64*y3)), xmask & ymask, eviction_policy='evict_last')
tmp2 = tl.load(in_ptr1 + (y0 + (4*x2) + (256*y1)), xmask & ymask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (y0 + (4*x2) + (256*y1)), xmask & ymask, eviction_policy='evict_last')
tmp1 = tl.sigmoid(tmp0)
tmp4 = tmp2 / tmp3
tmp5 = tmp1 * tmp4
tl.store(out_ptr0 + (x2 + (64*y3)), tmp5, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (64, 4), (4, 1))
assert_size_stride(primals_3, (64, ), (1, ))
assert_size_stride(primals_4, (64, 4), (4, 1))
assert_size_stride(primals_5, (64, ), (1, ))
assert_size_stride(primals_6, (64, 4), (4, 1))
assert_size_stride(primals_7, (64, ), (1, ))
assert_size_stride(primals_8, (4, 4), (4, 1))
assert_size_stride(primals_9, (4, 64), (64, 1))
assert_size_stride(primals_10, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_3, reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 64), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_2
del primals_3
buf1 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_1], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 64), (1, 4), 0), alpha=1, beta=1, out=buf1)
del primals_4
del primals_5
buf2 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_7, reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), reinterpret_tensor(primals_6, (4, 64), (1, 4), 0), alpha=1, beta=1, out=buf2)
del primals_6
del primals_7
buf3 = empty_strided_cuda((1, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [exp], Original ATen: [aten.exp]
stream0 = get_raw_stream(0)
triton_poi_fused_exp_0.run(primals_8, buf3, 16, grid=grid(16), stream=stream0)
del primals_8
buf4 = empty_strided_cuda((4, 64, 4), (256, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [temp], Original ATen: [aten.clone]
triton_poi_fused_clone_1.run(buf1, buf2, buf4, 16, 64, grid=grid(16, 64), stream=stream0)
buf5 = empty_strided_cuda((256, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [temp], Original ATen: [aten.mm]
extern_kernels.mm(reinterpret_tensor(buf4, (256, 4), (4, 1), 0), reinterpret_tensor(buf3, (4, 4), (1, 4), 0), out=buf5)
buf6 = empty_strided_cuda((4, 64, 4), (256, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul_1], Original ATen: [aten.clone]
triton_poi_fused_clone_2.run(buf1, buf6, 256, 4, grid=grid(256, 4), stream=stream0)
buf7 = empty_strided_cuda((256, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul_1], Original ATen: [aten.mm]
extern_kernels.mm(reinterpret_tensor(buf6, (256, 4), (4, 1), 0), reinterpret_tensor(buf3, (4, 4), (1, 4), 0), out=buf7)
buf8 = empty_strided_cuda((4, 4, 64), (256, 64, 1), torch.float32)
# Topologically Sorted Source Nodes: [Q_sig, temp, matmul_1, weighted, Yt], Original ATen: [aten.sigmoid, aten.clone, aten.div, aten.mul]
triton_poi_fused_clone_div_mul_sigmoid_3.run(buf0, buf5, buf7, buf8, 16, 64, grid=grid(16, 64), stream=stream0)
buf9 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [Yt_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_10, reinterpret_tensor(buf8, (16, 64), (64, 1), 0), reinterpret_tensor(primals_9, (64, 4), (1, 64), 0), alpha=1, beta=1, out=buf9)
del primals_10
return (reinterpret_tensor(buf9, (4, 4, 4), (16, 4, 1), 0), reinterpret_tensor(primals_1, (16, 4), (4, 1), 0), buf0, buf1, buf2, buf3, reinterpret_tensor(buf4, (256, 4), (4, 1), 0), buf5, reinterpret_tensor(buf6, (256, 4), (4, 1), 0), buf7, reinterpret_tensor(buf8, (16, 64), (64, 1), 0), primals_9, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((64, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((64, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((64, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((64, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((4, 64), (64, 1), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
class AFTFull(nn.Module):
def __init__(self, max_seqlen, dim, hidden_dim=64):
super().__init__()
"""
max_seqlen: the maximum number of timesteps (sequence length) to be fed in
dim: the embedding dimension of the tokens
hidden_dim: the hidden dimension used inside AFT Full
Number of heads is 1 as done in the paper
"""
self.dim = dim
self.hidden_dim = hidden_dim
self.to_q = nn.Linear(dim, hidden_dim)
self.to_k = nn.Linear(dim, hidden_dim)
self.to_v = nn.Linear(dim, hidden_dim)
self.project = nn.Linear(hidden_dim, dim)
self.wbias = nn.Parameter(torch.Tensor(max_seqlen, max_seqlen))
nn.init.xavier_uniform_(self.wbias)
def forward(self, x):
B, T, _ = x.shape
Q = self.to_q(x).view(B, T, self.hidden_dim)
K = self.to_k(x).view(B, T, self.hidden_dim)
V = self.to_v(x).view(B, T, self.hidden_dim)
temp_wbias = self.wbias[:T, :T].unsqueeze(0)
"""
From the paper
"""
Q_sig = torch.sigmoid(Q)
temp = torch.exp(temp_wbias) @ torch.mul(torch.exp(K), V)
weighted = temp / (torch.exp(temp_wbias) @ torch.exp(K))
Yt = torch.mul(Q_sig, weighted)
Yt = Yt.view(B, T, self.hidden_dim)
Yt = self.project(Yt)
return Yt
def get_inputs():
return [torch.rand([4, 4, 4])]
def get_init_inputs():
return [[], {'max_seqlen': 4, 'dim': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime.triton_helpers import math as tl_math
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_exp_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = tl_math.exp(tmp0)
tl.store(out_ptr0 + x0, tmp1, xmask)
@triton.jit
def triton_poi_fused_clone_1(in_ptr0, in_ptr1, out_ptr0, ynumel, xnumel,
YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 64
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = yindex // 4
tmp0 = tl.load(in_ptr0 + (x2 + 64 * y3), xmask & ymask, eviction_policy
='evict_last')
tmp2 = tl.load(in_ptr1 + (x2 + 64 * y3), xmask & ymask, eviction_policy
='evict_last')
tmp1 = tl_math.exp(tmp0)
tmp3 = tmp1 * tmp2
tl.store(out_ptr0 + (y0 + 4 * x2 + 256 * y1), tmp3, xmask & ymask)
@triton.jit
def triton_poi_fused_clone_2(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
ynumel = 256
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 64
y1 = yindex // 64
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 64 * x2 + 256 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp1 = tl_math.exp(tmp0)
tl.store(out_ptr0 + (x2 + 4 * y3), tmp1, xmask & ymask)
@triton.jit
def triton_poi_fused_clone_div_mul_sigmoid_3(in_ptr0, in_ptr1, in_ptr2,
out_ptr0, ynumel, xnumel, YBLOCK: tl.constexpr, XBLOCK: tl.constexpr):
ynumel = 16
xnumel = 64
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y3 = yindex
y0 = yindex % 4
y1 = yindex // 4
tmp0 = tl.load(in_ptr0 + (x2 + 64 * y3), xmask & ymask, eviction_policy
='evict_last')
tmp2 = tl.load(in_ptr1 + (y0 + 4 * x2 + 256 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + (y0 + 4 * x2 + 256 * y1), xmask & ymask,
eviction_policy='evict_last')
tmp1 = tl.sigmoid(tmp0)
tmp4 = tmp2 / tmp3
tmp5 = tmp1 * tmp4
tl.store(out_ptr0 + (x2 + 64 * y3), tmp5, xmask & ymask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (64, 4), (4, 1))
assert_size_stride(primals_3, (64,), (1,))
assert_size_stride(primals_4, (64, 4), (4, 1))
assert_size_stride(primals_5, (64,), (1,))
assert_size_stride(primals_6, (64, 4), (4, 1))
assert_size_stride(primals_7, (64,), (1,))
assert_size_stride(primals_8, (4, 4), (4, 1))
assert_size_stride(primals_9, (4, 64), (64, 1))
assert_size_stride(primals_10, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
extern_kernels.addmm(primals_3, reinterpret_tensor(primals_1, (16,
4), (4, 1), 0), reinterpret_tensor(primals_2, (4, 64), (1, 4),
0), alpha=1, beta=1, out=buf0)
del primals_2
del primals_3
buf1 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_1, (16,
4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 64), (1, 4),
0), alpha=1, beta=1, out=buf1)
del primals_4
del primals_5
buf2 = empty_strided_cuda((16, 64), (64, 1), torch.float32)
extern_kernels.addmm(primals_7, reinterpret_tensor(primals_1, (16,
4), (4, 1), 0), reinterpret_tensor(primals_6, (4, 64), (1, 4),
0), alpha=1, beta=1, out=buf2)
del primals_6
del primals_7
buf3 = empty_strided_cuda((1, 4, 4), (16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_exp_0[grid(16)](primals_8, buf3, 16, XBLOCK=16,
num_warps=1, num_stages=1)
del primals_8
buf4 = empty_strided_cuda((4, 64, 4), (256, 4, 1), torch.float32)
triton_poi_fused_clone_1[grid(16, 64)](buf1, buf2, buf4, 16, 64,
XBLOCK=64, YBLOCK=4, num_warps=4, num_stages=1)
buf5 = empty_strided_cuda((256, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf4, (256, 4), (4, 1), 0),
reinterpret_tensor(buf3, (4, 4), (1, 4), 0), out=buf5)
buf6 = empty_strided_cuda((4, 64, 4), (256, 4, 1), torch.float32)
triton_poi_fused_clone_2[grid(256, 4)](buf1, buf6, 256, 4, XBLOCK=4,
YBLOCK=256, num_warps=4, num_stages=1)
buf7 = empty_strided_cuda((256, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(buf6, (256, 4), (4, 1), 0),
reinterpret_tensor(buf3, (4, 4), (1, 4), 0), out=buf7)
buf8 = empty_strided_cuda((4, 4, 64), (256, 64, 1), torch.float32)
triton_poi_fused_clone_div_mul_sigmoid_3[grid(16, 64)](buf0, buf5,
buf7, buf8, 16, 64, XBLOCK=16, YBLOCK=16, num_warps=4, num_stages=1
)
buf9 = empty_strided_cuda((16, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_10, reinterpret_tensor(buf8, (16, 64),
(64, 1), 0), reinterpret_tensor(primals_9, (64, 4), (1, 64), 0),
alpha=1, beta=1, out=buf9)
del primals_10
return reinterpret_tensor(buf9, (4, 4, 4), (16, 4, 1), 0
), reinterpret_tensor(primals_1, (16, 4), (4, 1), 0
), buf0, buf1, buf2, buf3, reinterpret_tensor(buf4, (256, 4), (4, 1), 0
), buf5, reinterpret_tensor(buf6, (256, 4), (4, 1), 0
), buf7, reinterpret_tensor(buf8, (16, 64), (64, 1), 0), primals_9
class AFTFullNew(nn.Module):
def __init__(self, max_seqlen, dim, hidden_dim=64):
super().__init__()
"""
max_seqlen: the maximum number of timesteps (sequence length) to be fed in
dim: the embedding dimension of the tokens
hidden_dim: the hidden dimension used inside AFT Full
Number of heads is 1 as done in the paper
"""
self.dim = dim
self.hidden_dim = hidden_dim
self.to_q = nn.Linear(dim, hidden_dim)
self.to_k = nn.Linear(dim, hidden_dim)
self.to_v = nn.Linear(dim, hidden_dim)
self.project = nn.Linear(hidden_dim, dim)
self.wbias = nn.Parameter(torch.Tensor(max_seqlen, max_seqlen))
nn.init.xavier_uniform_(self.wbias)
def forward(self, input_0):
primals_8 = self.wbias
primals_2 = self.to_q.weight
primals_3 = self.to_q.bias
primals_4 = self.to_k.weight
primals_5 = self.to_k.bias
primals_6 = self.to_v.weight
primals_7 = self.to_v.bias
primals_9 = self.project.weight
primals_10 = self.project.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9, primals_10])
return output[0]
|
Datta0/aft-pytorch
|
AFTFull
| false | 2,138 |
[
"MIT"
] | 0 |
a0ebad01ea6616b00bde319b0c5e63bea467c400
|
https://github.com/Datta0/aft-pytorch/tree/a0ebad01ea6616b00bde319b0c5e63bea467c400
|
GroupWiseLinear
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/lv/clvhqra465e7rlmwkbu5xr6rfzlyh72yhs7d3zsjnfgsh2neujk4.py
# Topologically Sorted Source Nodes: [mul, x, x_1], Original ATen: [aten.mul, aten.sum, aten.add]
# Source node to ATen node mapping:
# mul => mul
# x => sum_1
# x_1 => add
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_1, %primals_2), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%mul, [-1]), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sum_1, %primals_3), kwargs = {})
triton_poi_fused_add_mul_sum_0 = async_compile.triton('triton_poi_fused_add_mul_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_mul_sum_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 9, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_mul_sum_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + (4*x0), xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + (4*x2), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (1 + (4*x2)), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr0 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr1 + (2 + (4*x2)), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr1 + (3 + (4*x2)), xmask, eviction_policy='evict_last')
tmp15 = tl.load(in_ptr2 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 * tmp1
tmp5 = tmp3 * tmp4
tmp6 = tmp2 + tmp5
tmp9 = tmp7 * tmp8
tmp10 = tmp6 + tmp9
tmp13 = tmp11 * tmp12
tmp14 = tmp10 + tmp13
tmp16 = tmp14 + tmp15
tl.store(out_ptr0 + (x2), tmp16, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (1, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_3, (1, 4), (4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [mul, x, x_1], Original ATen: [aten.mul, aten.sum, aten.add]
stream0 = get_raw_stream(0)
triton_poi_fused_add_mul_sum_0.run(primals_1, primals_2, primals_3, buf0, 64, grid=grid(64), stream=stream0)
del primals_1
del primals_3
return (buf0, primals_2, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((1, 4, 4), (16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((1, 4), (4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import math
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class GroupWiseLinear(nn.Module):
def __init__(self, num_class, hidden_dim, bias=True):
super().__init__()
self.num_class = num_class
self.hidden_dim = hidden_dim
self.bias = bias
self.W = nn.Parameter(torch.Tensor(1, num_class, hidden_dim))
if bias:
self.b = nn.Parameter(torch.Tensor(1, num_class))
self.reset_parameters()
def reset_parameters(self):
stdv = 1.0 / math.sqrt(self.W.size(2))
for i in range(self.num_class):
self.W[0][i].data.uniform_(-stdv, stdv)
if self.bias:
for i in range(self.num_class):
self.b[0][i].data.uniform_(-stdv, stdv)
def forward(self, x):
x = (self.W * x).sum(-1)
if self.bias:
x = x + self.b
return x
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'num_class': 4, 'hidden_dim': 4}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import math
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_add_mul_sum_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0,
xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 4
x2 = xindex
tmp0 = tl.load(in_ptr0 + 4 * x0, xmask, eviction_policy='evict_last')
tmp1 = tl.load(in_ptr1 + 4 * x2, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (1 + 4 * x0), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr1 + (1 + 4 * x2), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr0 + (2 + 4 * x0), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr1 + (2 + 4 * x2), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr0 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp12 = tl.load(in_ptr1 + (3 + 4 * x2), xmask, eviction_policy='evict_last'
)
tmp15 = tl.load(in_ptr2 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 * tmp1
tmp5 = tmp3 * tmp4
tmp6 = tmp2 + tmp5
tmp9 = tmp7 * tmp8
tmp10 = tmp6 + tmp9
tmp13 = tmp11 * tmp12
tmp14 = tmp10 + tmp13
tmp16 = tmp14 + tmp15
tl.store(out_ptr0 + x2, tmp16, xmask)
def call(args):
primals_1, primals_2, primals_3 = args
args.clear()
assert_size_stride(primals_1, (1, 4, 4), (16, 4, 1))
assert_size_stride(primals_2, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_3, (1, 4), (4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4), (16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_add_mul_sum_0[grid(64)](primals_1, primals_2,
primals_3, buf0, 64, XBLOCK=64, num_warps=1, num_stages=1)
del primals_1
del primals_3
return buf0, primals_2
class GroupWiseLinearNew(nn.Module):
def __init__(self, num_class, hidden_dim, bias=True):
super().__init__()
self.num_class = num_class
self.hidden_dim = hidden_dim
self.bias = bias
self.W = nn.Parameter(torch.Tensor(1, num_class, hidden_dim))
if bias:
self.b = nn.Parameter(torch.Tensor(1, num_class))
self.reset_parameters()
def reset_parameters(self):
stdv = 1.0 / math.sqrt(self.W.size(2))
for i in range(self.num_class):
self.W[0][i].data.uniform_(-stdv, stdv)
if self.bias:
for i in range(self.num_class):
self.b[0][i].data.uniform_(-stdv, stdv)
def forward(self, input_0):
primals_1 = self.W
primals_3 = self.b
primals_2 = input_0
output = call([primals_1, primals_2, primals_3])
return output[0]
|
ChangeTheWorld20191008/query2labels
|
GroupWiseLinear
| false | 2,139 |
[
"MIT"
] | 0 |
cdca1f3519f75cc91ef2aa166c2534691016f04f
|
https://github.com/ChangeTheWorld20191008/query2labels/tree/cdca1f3519f75cc91ef2aa166c2534691016f04f
|
ConcatSquashLinear
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/w2/cw2aqi7423xdfnyiz52ub43v4vckwb466eb4jrlbmqamapriavp7.py
# Topologically Sorted Source Nodes: [sigmoid, mul, add], Original ATen: [aten.sigmoid, aten.mul, aten.add]
# Source node to ATen node mapping:
# add => add
# mul => mul
# sigmoid => sigmoid
# Graph fragment:
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%addmm_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_1, %sigmoid), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, %mm), kwargs = {})
triton_poi_fused_add_mul_sigmoid_0 = async_compile.triton('triton_poi_fused_add_mul_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_mul_sigmoid_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_mul_sigmoid_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr1 + (x0), xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr2 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tl.sigmoid(tmp1)
tmp3 = tmp0 * tmp2
tmp5 = tmp3 + tmp4
tl.store(out_ptr0 + (x2), tmp5, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (1, 1), (1, 1))
assert_size_stride(primals_5, (4, 1), (1, 1))
assert_size_stride(primals_6, (4, ), (1, ))
assert_size_stride(primals_7, (4, 1), (1, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_2, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((1, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_1], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_6, primals_4, reinterpret_tensor(primals_5, (1, 4), (1, 1), 0), alpha=1, beta=1, out=buf1)
del primals_5
del primals_6
buf2 = empty_strided_cuda((1, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_2], Original ATen: [aten.mm]
extern_kernels.mm(primals_4, reinterpret_tensor(primals_7, (1, 4), (1, 1), 0), out=buf2)
del primals_7
buf3 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [sigmoid, mul, add], Original ATen: [aten.sigmoid, aten.mul, aten.add]
stream0 = get_raw_stream(0)
triton_poi_fused_add_mul_sigmoid_0.run(buf0, buf1, buf2, buf3, 256, grid=grid(256), stream=stream0)
del buf2
return (buf3, primals_4, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), buf0, buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((1, 1), (1, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, 1), (1, 1), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, 1), (1, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class ConcatSquashLinear(nn.Module):
def __init__(self, dim_in, dim_out):
super(ConcatSquashLinear, self).__init__()
self._layer = nn.Linear(dim_in, dim_out)
self._hyper_bias = nn.Linear(1, dim_out, bias=False)
self._hyper_gate = nn.Linear(1, dim_out)
def forward(self, t, x):
return self._layer(x) * torch.sigmoid(self._hyper_gate(t.view(1, 1))
) + self._hyper_bias(t.view(1, 1))
def get_inputs():
return [torch.rand([1, 1]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'dim_in': 4, 'dim_out': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_add_mul_sigmoid_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0,
xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr1 + x0, xmask, eviction_policy='evict_last')
tmp4 = tl.load(in_ptr2 + x0, xmask, eviction_policy='evict_last')
tmp2 = tl.sigmoid(tmp1)
tmp3 = tmp0 * tmp2
tmp5 = tmp3 + tmp4
tl.store(out_ptr0 + x2, tmp5, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7) = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (1, 1), (1, 1))
assert_size_stride(primals_5, (4, 1), (1, 1))
assert_size_stride(primals_6, (4,), (1,))
assert_size_stride(primals_7, (4, 1), (1, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_2, reinterpret_tensor(primals_3, (64,
4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((1, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_6, primals_4, reinterpret_tensor(
primals_5, (1, 4), (1, 1), 0), alpha=1, beta=1, out=buf1)
del primals_5
del primals_6
buf2 = empty_strided_cuda((1, 4), (4, 1), torch.float32)
extern_kernels.mm(primals_4, reinterpret_tensor(primals_7, (1, 4),
(1, 1), 0), out=buf2)
del primals_7
buf3 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_add_mul_sigmoid_0[grid(256)](buf0, buf1, buf2,
buf3, 256, XBLOCK=128, num_warps=4, num_stages=1)
del buf2
return buf3, primals_4, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0
), buf0, buf1
class ConcatSquashLinearNew(nn.Module):
def __init__(self, dim_in, dim_out):
super(ConcatSquashLinearNew, self).__init__()
self._layer = nn.Linear(dim_in, dim_out)
self._hyper_bias = nn.Linear(1, dim_out, bias=False)
self._hyper_gate = nn.Linear(1, dim_out)
def forward(self, input_0, input_1):
primals_1 = self._layer.weight
primals_2 = self._layer.bias
primals_5 = self._hyper_bias.weight
primals_7 = self._hyper_gate.weight
primals_6 = self._hyper_gate.bias
primals_4 = input_0
primals_3 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7])
return output[0]
|
D-hash-code/ffjord-rnode-finalweek-mnist
|
ConcatSquashLinear
| false | 2,140 |
[
"MIT"
] | 0 |
4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
https://github.com/D-hash-code/ffjord-rnode-finalweek-mnist/tree/4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
GatedConvTranspose
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/6k/c6kazydtzigopxuzedfthhmhnydldamntm2carnmlp5uv53z3g7p.py
# Topologically Sorted Source Nodes: [f, conv_transpose2d_1, g, mul], Original ATen: [aten.convolution, aten.sigmoid, aten.mul]
# Source node to ATen node mapping:
# conv_transpose2d_1 => convolution_1
# f => convolution
# g => sigmoid
# mul => mul
# Graph fragment:
# %convolution : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [0, 0], [1, 1], True, [0, 0], 1), kwargs = {})
# %convolution_1 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_4, %primals_5, [1, 1], [0, 0], [1, 1], True, [0, 0], 1), kwargs = {})
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%convolution_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%convolution, %sigmoid), kwargs = {})
triton_poi_fused_convolution_mul_sigmoid_0 = async_compile.triton('triton_poi_fused_convolution_mul_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[1024],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_mul_sigmoid_0', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_mul_sigmoid_0(in_out_ptr0, in_out_ptr1, in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 784
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 49) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_out_ptr1 + (x3), xmask)
tmp4 = tl.load(in_ptr1 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tl.sigmoid(tmp5)
tmp7 = tmp2 * tmp6
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
tl.store(in_out_ptr1 + (x3), tmp5, xmask)
tl.store(out_ptr0 + (x3), tmp7, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [f], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=True, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 7, 7), (196, 49, 7, 1))
# Topologically Sorted Source Nodes: [conv_transpose2d_1], Original ATen: [aten.convolution]
buf2 = extern_kernels.convolution(primals_3, primals_4, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=True, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 4, 7, 7), (196, 49, 7, 1))
buf1 = buf0; del buf0 # reuse
buf3 = buf2; del buf2 # reuse
buf4 = empty_strided_cuda((4, 4, 7, 7), (196, 49, 7, 1), torch.float32)
# Topologically Sorted Source Nodes: [f, conv_transpose2d_1, g, mul], Original ATen: [aten.convolution, aten.sigmoid, aten.mul]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_mul_sigmoid_0.run(buf1, buf3, primals_2, primals_5, buf4, 784, grid=grid(784), stream=stream0)
del primals_2
del primals_5
return (buf4, primals_1, primals_3, primals_4, buf1, buf3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class GatedConvTranspose(nn.Module):
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
padding=0, output_padding=0, groups=1):
super(GatedConvTranspose, self).__init__()
self.layer_f = nn.ConvTranspose2d(in_channels, out_channels,
kernel_size, stride=stride, padding=padding, output_padding=
output_padding, groups=groups)
self.layer_g = nn.ConvTranspose2d(in_channels, out_channels,
kernel_size, stride=stride, padding=padding, output_padding=
output_padding, groups=groups)
def forward(self, x):
f = self.layer_f(x)
g = torch.sigmoid(self.layer_g(x))
return f * g
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'in_channels': 4, 'out_channels': 4, 'kernel_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_convolution_mul_sigmoid_0(in_out_ptr0, in_out_ptr1,
in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 784
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 49 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_out_ptr1 + x3, xmask)
tmp4 = tl.load(in_ptr1 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tl.sigmoid(tmp5)
tmp7 = tmp2 * tmp6
tl.store(in_out_ptr0 + x3, tmp2, xmask)
tl.store(in_out_ptr1 + x3, tmp5, xmask)
tl.store(out_ptr0 + x3, tmp7, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_5, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=True,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 7, 7), (196, 49, 7, 1))
buf2 = extern_kernels.convolution(primals_3, primals_4, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=True,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 4, 7, 7), (196, 49, 7, 1))
buf1 = buf0
del buf0
buf3 = buf2
del buf2
buf4 = empty_strided_cuda((4, 4, 7, 7), (196, 49, 7, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_convolution_mul_sigmoid_0[grid(784)](buf1, buf3,
primals_2, primals_5, buf4, 784, XBLOCK=128, num_warps=4,
num_stages=1)
del primals_2
del primals_5
return buf4, primals_1, primals_3, primals_4, buf1, buf3
class GatedConvTransposeNew(nn.Module):
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
padding=0, output_padding=0, groups=1):
super(GatedConvTransposeNew, self).__init__()
self.layer_f = nn.ConvTranspose2d(in_channels, out_channels,
kernel_size, stride=stride, padding=padding, output_padding=
output_padding, groups=groups)
self.layer_g = nn.ConvTranspose2d(in_channels, out_channels,
kernel_size, stride=stride, padding=padding, output_padding=
output_padding, groups=groups)
def forward(self, input_0):
primals_1 = self.layer_f.weight
primals_2 = self.layer_f.bias
primals_3 = self.layer_g.weight
primals_5 = self.layer_g.bias
primals_4 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
D-hash-code/ffjord-rnode-finalweek-mnist
|
GatedConvTranspose
| false | 2,141 |
[
"MIT"
] | 0 |
4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
https://github.com/D-hash-code/ffjord-rnode-finalweek-mnist/tree/4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
SpaceToDepth
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/3u/c3ub52l73zdv4klgqzgxmtzrzxvztuyczv2jksnvrjr7erq7guxd.py
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten.clone]
# Source node to ATen node mapping:
# x_1 => clone
# Graph fragment:
# %clone : [num_users=1] = call_function[target=torch.ops.aten.clone.default](args = (%permute,), kwargs = {memory_format: torch.contiguous_format})
triton_poi_fused_clone_0 = async_compile.triton('triton_poi_fused_clone_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64, 4], tile_hint=TileHint.SQUARE,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_clone_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK : tl.constexpr, XBLOCK : tl.constexpr):
ynumel = 64
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 16
y1 = (yindex // 16)
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + (16*x2) + (64*y1)), xmask & ymask, eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + (4*y3)), tmp0, xmask & ymask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4, 1, 1), (64, 16, 4, 1, 1, 1), torch.float32)
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten.clone]
stream0 = get_raw_stream(0)
triton_poi_fused_clone_0.run(arg0_1, buf0, 64, 4, grid=grid(64, 4), stream=stream0)
del arg0_1
return (reinterpret_tensor(buf0, (4, 64, 1, 1), (64, 1, 1, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class SpaceToDepth(nn.Module):
def __init__(self, block_size=4):
super().__init__()
assert block_size == 4
self.bs = block_size
def forward(self, x):
N, C, H, W = x.size()
x = x.view(N, C, H // self.bs, self.bs, W // self.bs, self.bs)
x = x.permute(0, 3, 5, 1, 2, 4).contiguous()
x = x.view(N, C * self.bs ** 2, H // self.bs, W // self.bs)
return x
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_clone_0(in_ptr0, out_ptr0, ynumel, xnumel, YBLOCK: tl.
constexpr, XBLOCK: tl.constexpr):
ynumel = 64
xnumel = 4
yoffset = tl.program_id(1) * YBLOCK
yindex = yoffset + tl.arange(0, YBLOCK)[None, :]
ymask = yindex < ynumel
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
x2 = xindex
y0 = yindex % 16
y1 = yindex // 16
y3 = yindex
tmp0 = tl.load(in_ptr0 + (y0 + 16 * x2 + 64 * y1), xmask & ymask,
eviction_policy='evict_last')
tl.store(out_ptr0 + (x2 + 4 * y3), tmp0, xmask & ymask)
def call(args):
arg0_1, = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4, 1, 1), (64, 16, 4, 1, 1, 1),
torch.float32)
get_raw_stream(0)
triton_poi_fused_clone_0[grid(64, 4)](arg0_1, buf0, 64, 4, XBLOCK=4,
YBLOCK=32, num_warps=4, num_stages=1)
del arg0_1
return reinterpret_tensor(buf0, (4, 64, 1, 1), (64, 1, 1, 1), 0),
class SpaceToDepthNew(nn.Module):
def __init__(self, block_size=4):
super().__init__()
assert block_size == 4
self.bs = block_size
def forward(self, input_0):
arg0_1 = input_0
output = call([arg0_1])
return output[0]
|
ChangeTheWorld20191008/query2labels
|
SpaceToDepth
| false | 2,142 |
[
"MIT"
] | 0 |
cdca1f3519f75cc91ef2aa166c2534691016f04f
|
https://github.com/ChangeTheWorld20191008/query2labels/tree/cdca1f3519f75cc91ef2aa166c2534691016f04f
|
BlendLinear
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/fk/cfki6qg2njj4g7taj7ghaesj5brkn444q4jnoahj4egxmycjafqi.py
# Topologically Sorted Source Nodes: [sub, mul, add], Original ATen: [aten.sub, aten.mul, aten.add]
# Source node to ATen node mapping:
# add => add
# mul => mul
# sub => sub
# Graph fragment:
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%view_3, %view_1), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, %primals_6), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%view_1, %mul), kwargs = {})
triton_poi_fused_add_mul_sub_0 = async_compile.triton('triton_poi_fused_add_mul_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_mul_sub_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_mul_sub_0(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, in_ptr3, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + (x2), xmask)
tmp4 = tl.load(in_ptr2 + (x0), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr3 + (x2), xmask)
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tmp5 - tmp2
tmp8 = tmp6 * tmp7
tmp9 = tmp2 + tmp8
tl.store(in_out_ptr0 + (x2), tmp9, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), out=buf0)
del primals_1
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), out=buf1)
del primals_4
buf2 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf0 # reuse
# Topologically Sorted Source Nodes: [sub, mul, add], Original ATen: [aten.sub, aten.mul, aten.add]
stream0 = get_raw_stream(0)
triton_poi_fused_add_mul_sub_0.run(buf2, primals_2, buf1, primals_5, primals_6, 256, grid=grid(256), stream=stream0)
del buf1
del primals_2
del primals_5
return (buf2, primals_6, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class BlendLinear(nn.Module):
def __init__(self, dim_in, dim_out, layer_type=nn.Linear, **unused_kwargs):
super(BlendLinear, self).__init__()
self._layer0 = layer_type(dim_in, dim_out)
self._layer1 = layer_type(dim_in, dim_out)
def forward(self, t, x):
y0 = self._layer0(x)
y1 = self._layer1(x)
return y0 + (y1 - y0) * t
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'dim_in': 4, 'dim_out': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_add_mul_sub_0(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2,
in_ptr3, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + x2, xmask)
tmp4 = tl.load(in_ptr2 + x0, xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr3 + x2, xmask)
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tmp5 - tmp2
tmp8 = tmp6 * tmp7
tmp9 = tmp2 + tmp8
tl.store(in_out_ptr0 + x2, tmp9, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), out=buf0)
del primals_1
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), out=buf1)
del primals_4
buf2 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf0
get_raw_stream(0)
triton_poi_fused_add_mul_sub_0[grid(256)](buf2, primals_2, buf1,
primals_5, primals_6, 256, XBLOCK=128, num_warps=4, num_stages=1)
del buf1
del primals_2
del primals_5
return buf2, primals_6, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0)
class BlendLinearNew(nn.Module):
def __init__(self, dim_in, dim_out, layer_type=nn.Linear, **unused_kwargs):
super(BlendLinearNew, self).__init__()
self._layer0 = layer_type(dim_in, dim_out)
self._layer1 = layer_type(dim_in, dim_out)
def forward(self, input_0, input_1):
primals_1 = self._layer0.weight
primals_2 = self._layer0.bias
primals_4 = self._layer1.weight
primals_5 = self._layer1.bias
primals_3 = input_0
primals_6 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6])
return output[0]
|
D-hash-code/ffjord-rnode-finalweek-mnist
|
BlendLinear
| false | 2,143 |
[
"MIT"
] | 0 |
4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
https://github.com/D-hash-code/ffjord-rnode-finalweek-mnist/tree/4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
AsymmetricLossOptimized
|
# AOT ID: ['0_inference']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/mg/cmg5ja3sgkvvdxfwd5camevipmbnfq5nmbb2zt4mwgvk3wq4fvnt.py
# Topologically Sorted Source Nodes: [sigmoid, clamp, log, mul, sub, sub_1, add_, clamp_, clamp_1, log_1, mul_1, add__1, mul_2, sub_2, mul_3, sub_3, mul_4, mul_5, add, pow_1, imul, sum_1, neg, _loss, truediv_1, _loss_1], Original ATen: [aten.sigmoid, aten.clamp, aten.log, aten.mul, aten.rsub, aten.add, aten.sub, aten.pow, aten.sum, aten.neg, aten.div]
# Source node to ATen node mapping:
# _loss => div
# _loss_1 => mul_7
# add => add_2
# add_ => add
# add__1 => add_1
# clamp => clamp_min
# clamp_ => clamp_max
# clamp_1 => clamp_min_1
# imul => mul_6
# log => log
# log_1 => log_1
# mul => mul
# mul_1 => mul_1
# mul_2 => mul_2
# mul_3 => mul_3
# mul_4 => mul_4
# mul_5 => mul_5
# neg => neg
# pow_1 => pow_1
# sigmoid => sigmoid
# sub => sub
# sub_1 => sub_1
# sub_2 => sub_2
# sub_3 => sub_3
# sum_1 => sum_1
# truediv_1 => div_1
# Graph fragment:
# %sigmoid : [num_users=3] = call_function[target=torch.ops.aten.sigmoid.default](args = (%arg1_1,), kwargs = {})
# %clamp_min : [num_users=1] = call_function[target=torch.ops.aten.clamp_min.default](args = (%sigmoid, 1e-05), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%clamp_min,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg0_1, %log), kwargs = {})
# %sub : [num_users=4] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %arg0_1), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1.0, %sigmoid), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%sub_1, 0.05), kwargs = {})
# %clamp_max : [num_users=2] = call_function[target=torch.ops.aten.clamp_max.default](args = (%add, 1), kwargs = {})
# %clamp_min_1 : [num_users=1] = call_function[target=torch.ops.aten.clamp_min.default](args = (%clamp_max, 1e-05), kwargs = {})
# %log_1 : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%clamp_min_1,), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, %log_1), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, %mul_1), kwargs = {})
# %mul_2 : [num_users=2] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sigmoid, %arg0_1), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1, %mul_2), kwargs = {})
# %mul_3 : [num_users=2] = call_function[target=torch.ops.aten.mul.Tensor](args = (%clamp_max, %sub), kwargs = {})
# %sub_3 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sub_2, %mul_3), kwargs = {})
# %mul_4 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%arg0_1, 1), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, 4), kwargs = {})
# %add_2 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_4, %mul_5), kwargs = {})
# %pow_1 : [num_users=2] = call_function[target=torch.ops.aten.pow.Tensor_Tensor](args = (%sub_3, %add_2), kwargs = {})
# %mul_6 : [num_users=2] = call_function[target=torch.ops.aten.mul.Tensor](args = (%add_1, %pow_1), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.default](args = (%mul_6,), kwargs = {})
# %neg : [num_users=1] = call_function[target=torch.ops.aten.neg.default](args = (%sum_1,), kwargs = {})
# %div : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%neg, 4), kwargs = {})
# %div_1 : [num_users=1] = call_function[target=torch.ops.aten.div.Tensor](args = (%div, 4), kwargs = {})
# %mul_7 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%div_1, 1000), kwargs = {})
triton_per_fused_add_clamp_div_log_mul_neg_pow_rsub_sigmoid_sub_sum_0 = async_compile.triton('triton_per_fused_add_clamp_div_log_mul_neg_pow_rsub_sigmoid_sub_sum_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[1, 256],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*fp32', 8: 'i32', 9: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {8: 1}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 9), equal_to_1=(8,))]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_add_clamp_div_log_mul_neg_pow_rsub_sigmoid_sub_sum_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': True, 'num_load': 2, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_add_clamp_div_log_mul_neg_pow_rsub_sigmoid_sub_sum_0(in_out_ptr0, in_ptr0, in_ptr1, out_ptr0, out_ptr1, out_ptr2, out_ptr3, out_ptr4, xnumel, rnumel):
xnumel = 1
XBLOCK: tl.constexpr = 1
rnumel = 256
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = tl.full([1], xoffset, tl.int32)
xmask = tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
roffset = 0
rmask = tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + (r0), None)
tmp3 = tl.load(in_ptr1 + (r0), None)
tmp1 = 1.0
tmp2 = tmp1 - tmp0
tmp4 = tl.sigmoid(tmp3)
tmp5 = tmp4 * tmp0
tmp6 = tmp1 - tmp4
tmp7 = 0.05
tmp8 = tmp6 + tmp7
tmp9 = triton_helpers.minimum(tmp8, tmp1)
tmp10 = tmp9 * tmp2
tmp11 = tmp1 - tmp5
tmp12 = tmp11 - tmp10
tmp13 = tmp0 * tmp1
tmp14 = 4.0
tmp15 = tmp2 * tmp14
tmp16 = tmp13 + tmp15
tmp17 = libdevice.pow(tmp12, tmp16)
tmp18 = 1e-05
tmp19 = triton_helpers.maximum(tmp4, tmp18)
tmp20 = tl_math.log(tmp19)
tmp21 = tmp0 * tmp20
tmp22 = triton_helpers.maximum(tmp9, tmp18)
tmp23 = tl_math.log(tmp22)
tmp24 = tmp2 * tmp23
tmp25 = tmp21 + tmp24
tmp26 = tmp25 * tmp17
tmp27 = tl.broadcast_to(tmp26, [RBLOCK])
tmp29 = triton_helpers.promote_to_tensor(tl.sum(tmp27, 0))
tmp30 = -tmp29
tmp31 = 0.25
tmp32 = tmp30 * tmp31
tmp33 = tmp32 * tmp31
tmp34 = 1000.0
tmp35 = tmp33 * tmp34
tl.store(out_ptr0 + (tl.broadcast_to(r0, [RBLOCK])), tmp2, None)
tl.store(out_ptr1 + (tl.broadcast_to(r0, [RBLOCK])), tmp5, None)
tl.store(out_ptr2 + (tl.broadcast_to(r0, [RBLOCK])), tmp10, None)
tl.store(out_ptr3 + (tl.broadcast_to(r0, [RBLOCK])), tmp17, None)
tl.store(out_ptr4 + (tl.broadcast_to(r0, [RBLOCK])), tmp26, None)
tl.debug_barrier()
tl.store(in_out_ptr0 + (tl.full([1], 0, tl.int32)), tmp35, None)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf3 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf4 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf5 = empty_strided_cuda((), (), torch.float32)
buf6 = buf5; del buf5 # reuse
# Topologically Sorted Source Nodes: [sigmoid, clamp, log, mul, sub, sub_1, add_, clamp_, clamp_1, log_1, mul_1, add__1, mul_2, sub_2, mul_3, sub_3, mul_4, mul_5, add, pow_1, imul, sum_1, neg, _loss, truediv_1, _loss_1], Original ATen: [aten.sigmoid, aten.clamp, aten.log, aten.mul, aten.rsub, aten.add, aten.sub, aten.pow, aten.sum, aten.neg, aten.div]
stream0 = get_raw_stream(0)
triton_per_fused_add_clamp_div_log_mul_neg_pow_rsub_sigmoid_sub_sum_0.run(buf6, arg0_1, arg1_1, buf0, buf1, buf2, buf3, buf4, 1, 256, grid=grid(1), stream=stream0)
del arg0_1
del arg1_1
return (buf6, buf3, buf4, buf2, buf1, buf0, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
arg0_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
arg1_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([arg0_1, arg1_1])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class AsymmetricLossOptimized(nn.Module):
""" Notice - optimized version, minimizes memory allocation and gpu uploading,
favors inplace operations"""
def __init__(self, gamma_neg=4, gamma_pos=1, clip=0.05, eps=1e-05,
disable_torch_grad_focal_loss=False):
super(AsymmetricLossOptimized, self).__init__()
self.gamma_neg = gamma_neg
self.gamma_pos = gamma_pos
self.clip = clip
self.disable_torch_grad_focal_loss = disable_torch_grad_focal_loss
self.eps = eps
(self.targets) = (self.anti_targets) = (self.xs_pos) = (self.xs_neg
) = (self.asymmetric_w) = (self.loss) = None
def forward(self, x, y):
""""
Parameters
----------
x: input logits
y: targets (multi-label binarized vector)
"""
self.targets = y
self.anti_targets = 1 - y
self.xs_pos = torch.sigmoid(x)
self.xs_neg = 1.0 - self.xs_pos
if self.clip is not None and self.clip > 0:
self.xs_neg.add_(self.clip).clamp_(max=1)
self.loss = self.targets * torch.log(self.xs_pos.clamp(min=self.eps))
self.loss.add_(self.anti_targets * torch.log(self.xs_neg.clamp(min=
self.eps)))
if self.gamma_neg > 0 or self.gamma_pos > 0:
if self.disable_torch_grad_focal_loss:
with torch.no_grad():
self.xs_pos = self.xs_pos * self.targets
self.xs_neg = self.xs_neg * self.anti_targets
self.asymmetric_w = torch.pow(1 - self.xs_pos - self.
xs_neg, self.gamma_pos * self.targets + self.
gamma_neg * self.anti_targets)
self.loss *= self.asymmetric_w
else:
self.xs_pos = self.xs_pos * self.targets
self.xs_neg = self.xs_neg * self.anti_targets
self.asymmetric_w = torch.pow(1 - self.xs_pos - self.xs_neg,
self.gamma_pos * self.targets + self.gamma_neg * self.
anti_targets)
self.loss *= self.asymmetric_w
_loss = -self.loss.sum() / x.size(0)
_loss = _loss / y.size(1) * 1000
return _loss
def get_inputs():
return [torch.rand([4, 4, 4, 4]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {}]
|
import torch
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_per_fused_add_clamp_div_log_mul_neg_pow_rsub_sigmoid_sub_sum_0(
in_out_ptr0, in_ptr0, in_ptr1, out_ptr0, out_ptr1, out_ptr2, out_ptr3,
out_ptr4, xnumel, rnumel):
XBLOCK: tl.constexpr = 1
RBLOCK: tl.constexpr = 256
xoffset = tl.program_id(0) * XBLOCK
tl.full([1], xoffset, tl.int32)
tl.full([RBLOCK], True, tl.int1)
rindex = tl.arange(0, RBLOCK)[:]
tl.full([RBLOCK], True, tl.int1)
r0 = rindex
tmp0 = tl.load(in_ptr0 + r0, None)
tmp3 = tl.load(in_ptr1 + r0, None)
tmp1 = 1.0
tmp2 = tmp1 - tmp0
tmp4 = tl.sigmoid(tmp3)
tmp5 = tmp4 * tmp0
tmp6 = tmp1 - tmp4
tmp7 = 0.05
tmp8 = tmp6 + tmp7
tmp9 = triton_helpers.minimum(tmp8, tmp1)
tmp10 = tmp9 * tmp2
tmp11 = tmp1 - tmp5
tmp12 = tmp11 - tmp10
tmp13 = tmp0 * tmp1
tmp14 = 4.0
tmp15 = tmp2 * tmp14
tmp16 = tmp13 + tmp15
tmp17 = libdevice.pow(tmp12, tmp16)
tmp18 = 1e-05
tmp19 = triton_helpers.maximum(tmp4, tmp18)
tmp20 = tl_math.log(tmp19)
tmp21 = tmp0 * tmp20
tmp22 = triton_helpers.maximum(tmp9, tmp18)
tmp23 = tl_math.log(tmp22)
tmp24 = tmp2 * tmp23
tmp25 = tmp21 + tmp24
tmp26 = tmp25 * tmp17
tmp27 = tl.broadcast_to(tmp26, [RBLOCK])
tmp29 = triton_helpers.promote_to_tensor(tl.sum(tmp27, 0))
tmp30 = -tmp29
tmp31 = 0.25
tmp32 = tmp30 * tmp31
tmp33 = tmp32 * tmp31
tmp34 = 1000.0
tmp35 = tmp33 * tmp34
tl.store(out_ptr0 + tl.broadcast_to(r0, [RBLOCK]), tmp2, None)
tl.store(out_ptr1 + tl.broadcast_to(r0, [RBLOCK]), tmp5, None)
tl.store(out_ptr2 + tl.broadcast_to(r0, [RBLOCK]), tmp10, None)
tl.store(out_ptr3 + tl.broadcast_to(r0, [RBLOCK]), tmp17, None)
tl.store(out_ptr4 + tl.broadcast_to(r0, [RBLOCK]), tmp26, None)
tl.debug_barrier()
tl.store(in_out_ptr0 + tl.full([1], 0, tl.int32), tmp35, None)
def call(args):
arg0_1, arg1_1 = args
args.clear()
assert_size_stride(arg0_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(arg1_1, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf1 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf3 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf4 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf5 = empty_strided_cuda((), (), torch.float32)
buf6 = buf5
del buf5
get_raw_stream(0)
triton_per_fused_add_clamp_div_log_mul_neg_pow_rsub_sigmoid_sub_sum_0[
grid(1)](buf6, arg0_1, arg1_1, buf0, buf1, buf2, buf3, buf4, 1,
256, num_warps=2, num_stages=1)
del arg0_1
del arg1_1
return buf6, buf3, buf4, buf2, buf1, buf0
class AsymmetricLossOptimizedNew(nn.Module):
""" Notice - optimized version, minimizes memory allocation and gpu uploading,
favors inplace operations"""
def __init__(self, gamma_neg=4, gamma_pos=1, clip=0.05, eps=1e-05,
disable_torch_grad_focal_loss=False):
super(AsymmetricLossOptimizedNew, self).__init__()
self.gamma_neg = gamma_neg
self.gamma_pos = gamma_pos
self.clip = clip
self.disable_torch_grad_focal_loss = disable_torch_grad_focal_loss
self.eps = eps
(self.targets) = (self.anti_targets) = (self.xs_pos) = (self.xs_neg
) = (self.asymmetric_w) = (self.loss) = None
def forward(self, input_0, input_1):
arg0_1 = input_0
arg1_1 = input_1
output = call([arg0_1, arg1_1])
return output[0]
|
ChangeTheWorld20191008/query2labels
|
AsymmetricLossOptimized
| false | 2,144 |
[
"MIT"
] | 0 |
cdca1f3519f75cc91ef2aa166c2534691016f04f
|
https://github.com/ChangeTheWorld20191008/query2labels/tree/cdca1f3519f75cc91ef2aa166c2534691016f04f
|
SEModule
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/l3/cl35tzbhrd24dhunkbb6gjs54aklpyr46oikqhoylcgmkcmhujil.py
# Topologically Sorted Source Nodes: [mean], Original ATen: [aten.mean]
# Source node to ATen node mapping:
# mean => mean
# Graph fragment:
# %mean : [num_users=1] = call_function[target=torch.ops.aten.mean.dim](args = (%view, [-1]), kwargs = {})
triton_per_fused_mean_0 = async_compile.triton('triton_per_fused_mean_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[16, 16],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_mean_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 1, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_mean_0(in_out_ptr0, in_ptr0, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 16
rnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + (16*x0)), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, 0)
tmp4 = tl.sum(tmp3, 1)[:, None]
tmp5 = 16.0
tmp6 = tmp4 / tmp5
tl.debug_barrier()
tl.store(in_out_ptr0 + (x0), tmp6, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/o5/co5kpgkyaabh4nd7yz4gzpyl7x35mwdhgusbruykvtydzlq2lizg.py
# Topologically Sorted Source Nodes: [x_se2, x_se2_1], Original ATen: [aten.convolution, aten.relu]
# Source node to ATen node mapping:
# x_se2 => convolution
# x_se2_1 => relu
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%view_1, %primals_2, %primals_3, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%convolution,), kwargs = {})
triton_poi_fused_convolution_relu_1 = async_compile.triton('triton_poi_fused_convolution_relu_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_relu_1', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_relu_1(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + (x2), tmp4, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/k2/ck2mamkqpmuzem4n3p4ij6fmfpy2bcbblg6sx6wwslgqwuqq5ifh.py
# Topologically Sorted Source Nodes: [x_se_1], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# x_se_1 => convolution_1
# Graph fragment:
# %convolution_1 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%relu, %primals_4, %primals_5, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_2 = async_compile.triton('triton_poi_fused_convolution_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_2', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_2(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x2), tmp2, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/lp/clprvnh5p6cmadxtwzizwydrpjlwxohxixbw4ntucp6srbu6gtis.py
# Topologically Sorted Source Nodes: [x_se_2, mul], Original ATen: [aten.sigmoid, aten.mul]
# Source node to ATen node mapping:
# mul => mul
# x_se_2 => sigmoid
# Graph fragment:
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%convolution_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_1, %sigmoid), kwargs = {})
triton_poi_fused_mul_sigmoid_3 = async_compile.triton('triton_poi_fused_mul_sigmoid_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mul_sigmoid_3', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mul_sigmoid_3(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 16)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr1 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tl.sigmoid(tmp1)
tmp3 = tmp0 * tmp2
tl.store(out_ptr0 + (x2), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 1, 1), (4, 1, 1, 1))
assert_size_stride(primals_3, (4, ), (1, ))
assert_size_stride(primals_4, (4, 4, 1, 1), (4, 1, 1, 1))
assert_size_stride(primals_5, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
buf1 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [mean], Original ATen: [aten.mean]
stream0 = get_raw_stream(0)
triton_per_fused_mean_0.run(buf1, primals_1, 16, 16, grid=grid(16), stream=stream0)
# Topologically Sorted Source Nodes: [x_se2], Original ATen: [aten.convolution]
buf2 = extern_kernels.convolution(reinterpret_tensor(buf1, (4, 4, 1, 1), (4, 1, 0, 0), 0), primals_2, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 4, 1, 1), (4, 1, 1, 1))
buf3 = buf2; del buf2 # reuse
# Topologically Sorted Source Nodes: [x_se2, x_se2_1], Original ATen: [aten.convolution, aten.relu]
triton_poi_fused_convolution_relu_1.run(buf3, primals_3, 16, grid=grid(16), stream=stream0)
del primals_3
# Topologically Sorted Source Nodes: [x_se_1], Original ATen: [aten.convolution]
buf4 = extern_kernels.convolution(buf3, primals_4, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf4, (4, 4, 1, 1), (4, 1, 1, 1))
buf5 = buf4; del buf4 # reuse
# Topologically Sorted Source Nodes: [x_se_1], Original ATen: [aten.convolution]
triton_poi_fused_convolution_2.run(buf5, primals_5, 16, grid=grid(16), stream=stream0)
del primals_5
buf6 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x_se_2, mul], Original ATen: [aten.sigmoid, aten.mul]
triton_poi_fused_mul_sigmoid_3.run(primals_1, buf5, buf6, 256, grid=grid(256), stream=stream0)
return (buf6, primals_1, primals_2, primals_4, reinterpret_tensor(buf1, (4, 4, 1, 1), (4, 1, 1, 1), 0), buf3, buf5, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 1, 1), (4, 1, 1, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4, 1, 1), (4, 1, 1, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
class FastAvgPool2d(nn.Module):
def __init__(self, flatten=False):
super(FastAvgPool2d, self).__init__()
self.flatten = flatten
def forward(self, x):
if self.flatten:
in_size = x.size()
return x.view((in_size[0], in_size[1], -1)).mean(dim=2)
else:
return x.view(x.size(0), x.size(1), -1).mean(-1).view(x.size(0),
x.size(1), 1, 1)
class SEModule(nn.Module):
def __init__(self, channels, reduction_channels, inplace=True):
super(SEModule, self).__init__()
self.avg_pool = FastAvgPool2d()
self.fc1 = nn.Conv2d(channels, reduction_channels, kernel_size=1,
padding=0, bias=True)
self.relu = nn.ReLU(inplace=inplace)
self.fc2 = nn.Conv2d(reduction_channels, channels, kernel_size=1,
padding=0, bias=True)
self.activation = nn.Sigmoid()
def forward(self, x):
x_se = self.avg_pool(x)
x_se2 = self.fc1(x_se)
x_se2 = self.relu(x_se2)
x_se = self.fc2(x_se2)
x_se = self.activation(x_se)
return x * x_se
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'channels': 4, 'reduction_channels': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
import torch.nn as nn
import torch.nn.parallel
import torch.optim
import torch.utils.data
import torch.utils.data.distributed
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_per_fused_mean_0(in_out_ptr0, in_ptr0, xnumel, rnumel, XBLOCK:
tl.constexpr):
xnumel = 16
RBLOCK: tl.constexpr = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + 16 * x0), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, 0)
tmp4 = tl.sum(tmp3, 1)[:, None]
tmp5 = 16.0
tmp6 = tmp4 / tmp5
tl.debug_barrier()
tl.store(in_out_ptr0 + x0, tmp6, xmask)
@triton.jit
def triton_poi_fused_convolution_relu_1(in_out_ptr0, in_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.full([1], 0, tl.int32)
tmp4 = triton_helpers.maximum(tmp3, tmp2)
tl.store(in_out_ptr0 + x2, tmp4, xmask)
@triton.jit
def triton_poi_fused_convolution_2(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x2, tmp2, xmask)
@triton.jit
def triton_poi_fused_mul_sigmoid_3(in_ptr0, in_ptr1, out_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 16
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr1 + x1, xmask, eviction_policy='evict_last')
tmp2 = tl.sigmoid(tmp1)
tmp3 = tmp0 * tmp2
tl.store(out_ptr0 + x2, tmp3, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 1, 1), (4, 1, 1, 1))
assert_size_stride(primals_3, (4,), (1,))
assert_size_stride(primals_4, (4, 4, 1, 1), (4, 1, 1, 1))
assert_size_stride(primals_5, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
buf1 = buf0
del buf0
get_raw_stream(0)
triton_per_fused_mean_0[grid(16)](buf1, primals_1, 16, 16, XBLOCK=1,
num_warps=2, num_stages=1)
buf2 = extern_kernels.convolution(reinterpret_tensor(buf1, (4, 4, 1,
1), (4, 1, 0, 0), 0), primals_2, stride=(1, 1), padding=(0, 0),
dilation=(1, 1), transposed=False, output_padding=(0, 0),
groups=1, bias=None)
assert_size_stride(buf2, (4, 4, 1, 1), (4, 1, 1, 1))
buf3 = buf2
del buf2
triton_poi_fused_convolution_relu_1[grid(16)](buf3, primals_3, 16,
XBLOCK=16, num_warps=1, num_stages=1)
del primals_3
buf4 = extern_kernels.convolution(buf3, primals_4, stride=(1, 1),
padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf4, (4, 4, 1, 1), (4, 1, 1, 1))
buf5 = buf4
del buf4
triton_poi_fused_convolution_2[grid(16)](buf5, primals_5, 16,
XBLOCK=16, num_warps=1, num_stages=1)
del primals_5
buf6 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_mul_sigmoid_3[grid(256)](primals_1, buf5, buf6,
256, XBLOCK=128, num_warps=4, num_stages=1)
return buf6, primals_1, primals_2, primals_4, reinterpret_tensor(buf1,
(4, 4, 1, 1), (4, 1, 1, 1), 0), buf3, buf5
class FastAvgPool2d(nn.Module):
def __init__(self, flatten=False):
super(FastAvgPool2d, self).__init__()
self.flatten = flatten
def forward(self, x):
if self.flatten:
in_size = x.size()
return x.view((in_size[0], in_size[1], -1)).mean(dim=2)
else:
return x.view(x.size(0), x.size(1), -1).mean(-1).view(x.size(0),
x.size(1), 1, 1)
class SEModuleNew(nn.Module):
def __init__(self, channels, reduction_channels, inplace=True):
super(SEModuleNew, self).__init__()
self.avg_pool = FastAvgPool2d()
self.fc1 = nn.Conv2d(channels, reduction_channels, kernel_size=1,
padding=0, bias=True)
self.relu = nn.ReLU(inplace=inplace)
self.fc2 = nn.Conv2d(reduction_channels, channels, kernel_size=1,
padding=0, bias=True)
self.activation = nn.Sigmoid()
def forward(self, input_0):
primals_2 = self.fc1.weight
primals_3 = self.fc1.bias
primals_4 = self.fc2.weight
primals_5 = self.fc2.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
ChangeTheWorld20191008/query2labels
|
SEModule
| false | 2,145 |
[
"MIT"
] | 0 |
cdca1f3519f75cc91ef2aa166c2534691016f04f
|
https://github.com/ChangeTheWorld20191008/query2labels/tree/cdca1f3519f75cc91ef2aa166c2534691016f04f
|
BasicBlock
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/wd/cwdc75bzdixqjtzarkbcxze6jwzufryjpat4f3mbqxnzuklbuuxw.py
# Topologically Sorted Source Nodes: [out_1], Original ATen: [aten.native_group_norm]
# Source node to ATen node mapping:
# out_1 => add, rsqrt, var_mean
# Graph fragment:
# %var_mean : [num_users=2] = call_function[target=torch.ops.aten.var_mean.correction](args = (%view, [2, 3]), kwargs = {correction: 0, keepdim: True})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%getitem, 0.0001), kwargs = {})
# %rsqrt : [num_users=2] = call_function[target=torch.ops.aten.rsqrt.default](args = (%add,), kwargs = {})
triton_per_fused_native_group_norm_0 = async_compile.triton('triton_per_fused_native_group_norm_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.persistent_reduction(
size_hints=[8, 32],
reduction_hint=ReductionHint.INNER,
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_per_fused_native_group_norm_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 4, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False}
)
@triton.jit
def triton_per_fused_native_group_norm_0(in_ptr0, out_ptr0, out_ptr1, out_ptr2, xnumel, rnumel, XBLOCK : tl.constexpr):
xnumel = 8
rnumel = 32
RBLOCK: tl.constexpr = 32
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
roffset = 0
rmask = tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + (32*x0)), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tmp3 = tl.where(xmask, tmp1, 0)
tmp4 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp6 = tl.where(xmask, tmp4, 0)
tmp7 = tl.sum(tmp6, 1)[:, None]
tmp8 = tl.full([XBLOCK, 1], 32, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp1 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [XBLOCK, RBLOCK])
tmp15 = tl.where(xmask, tmp13, 0)
tmp16 = tl.sum(tmp15, 1)[:, None]
tmp17 = 32.0
tmp18 = tmp16 / tmp17
tmp19 = 0.0001
tmp20 = tmp18 + tmp19
tmp21 = libdevice.rsqrt(tmp20)
tl.store(out_ptr2 + (x0), tmp21, xmask)
tl.store(out_ptr0 + (x0), tmp10, xmask)
tl.store(out_ptr1 + (x0), tmp16, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/fh/cfh6pud2lmejfzlfcsbg3xpj6hy3yssbhoyvgzu4xj3z7teollra.py
# Topologically Sorted Source Nodes: [out_1, out_2], Original ATen: [aten.native_group_norm, aten.relu]
# Source node to ATen node mapping:
# out_1 => add_1, mul_1
# out_2 => relu
# Graph fragment:
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_1, %unsqueeze_5), kwargs = {})
# %add_1 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_1, %unsqueeze_2), kwargs = {})
# %relu : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%add_1,), kwargs = {})
triton_poi_fused_native_group_norm_relu_1 = async_compile.triton('triton_poi_fused_native_group_norm_relu_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_native_group_norm_relu_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_native_group_norm_relu_1(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x4 = (xindex // 16)
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr1 + ((x4 // 2)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + ((x4 // 2)), xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr3 + (x1), xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr4 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = 32.0
tmp5 = tmp3 / tmp4
tmp6 = 0.0001
tmp7 = tmp5 + tmp6
tmp8 = libdevice.rsqrt(tmp7)
tmp9 = tmp2 * tmp8
tmp11 = tmp9 * tmp10
tmp13 = tmp11 + tmp12
tmp14 = tl.full([1], 0, tl.int32)
tmp15 = triton_helpers.maximum(tmp14, tmp13)
tl.store(out_ptr0 + (x3), tmp15, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/an/can2ugv2pect72d2sdxuzgit2owstg2msehowjuz235bvx4rqo2x.py
# Topologically Sorted Source Nodes: [out_4, out_5, out_6], Original ATen: [aten.native_group_norm, aten.add, aten.relu, aten.threshold_backward]
# Source node to ATen node mapping:
# out_4 => add_3, mul_3
# out_5 => add_4
# out_6 => relu_1
# Graph fragment:
# %mul_3 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_3, %unsqueeze_11), kwargs = {})
# %add_3 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul_3, %unsqueeze_8), kwargs = {})
# %add_4 : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%add_3, %primals_1), kwargs = {})
# %relu_1 : [num_users=2] = call_function[target=torch.ops.aten.relu.default](args = (%add_4,), kwargs = {})
# %le : [num_users=1] = call_function[target=torch.ops.aten.le.Scalar](args = (%relu_1, 0), kwargs = {})
triton_poi_fused_add_native_group_norm_relu_threshold_backward_2 = async_compile.triton('triton_poi_fused_add_native_group_norm_relu_threshold_backward_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: '*fp32', 6: '*fp32', 7: '*i1', 8: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_native_group_norm_relu_threshold_backward_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 6, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_native_group_norm_relu_threshold_backward_2(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, in_ptr5, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x4 = (xindex // 16)
x1 = (xindex // 16) % 4
tmp0 = tl.load(in_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr1 + ((x4 // 2)), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + ((x4 // 2)), xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr3 + (x1), xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr4 + (x1), xmask, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr5 + (x3), xmask)
tmp2 = tmp0 - tmp1
tmp4 = 32.0
tmp5 = tmp3 / tmp4
tmp6 = 0.0001
tmp7 = tmp5 + tmp6
tmp8 = libdevice.rsqrt(tmp7)
tmp9 = tmp2 * tmp8
tmp11 = tmp9 * tmp10
tmp13 = tmp11 + tmp12
tmp15 = tmp13 + tmp14
tmp16 = tl.full([1], 0, tl.int32)
tmp17 = triton_helpers.maximum(tmp16, tmp15)
tmp18 = 0.0
tmp19 = tmp17 <= tmp18
tl.store(out_ptr0 + (x3), tmp17, xmask)
tl.store(out_ptr1 + (x3), tmp19, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_3, (4, ), (1, ))
assert_size_stride(primals_4, (4, ), (1, ))
assert_size_stride(primals_5, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_6, (4, ), (1, ))
assert_size_stride(primals_7, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [out], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_1, primals_2, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 4, 4), (64, 16, 4, 1))
buf1 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
buf2 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
buf4 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
# Topologically Sorted Source Nodes: [out_1], Original ATen: [aten.native_group_norm]
stream0 = get_raw_stream(0)
triton_per_fused_native_group_norm_0.run(buf0, buf1, buf2, buf4, 8, 32, grid=grid(8), stream=stream0)
buf5 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_1, out_2], Original ATen: [aten.native_group_norm, aten.relu]
triton_poi_fused_native_group_norm_relu_1.run(buf0, buf1, buf2, primals_3, primals_4, buf5, 256, grid=grid(256), stream=stream0)
del primals_4
# Topologically Sorted Source Nodes: [out_3], Original ATen: [aten.convolution]
buf6 = extern_kernels.convolution(buf5, primals_5, stride=(1, 1), padding=(1, 1), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf6, (4, 4, 4, 4), (64, 16, 4, 1))
buf7 = buf2; del buf2 # reuse
buf8 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
buf10 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
# Topologically Sorted Source Nodes: [out_4], Original ATen: [aten.native_group_norm]
triton_per_fused_native_group_norm_0.run(buf6, buf7, buf8, buf10, 8, 32, grid=grid(8), stream=stream0)
buf11 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf12 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
# Topologically Sorted Source Nodes: [out_4, out_5, out_6], Original ATen: [aten.native_group_norm, aten.add, aten.relu, aten.threshold_backward]
triton_poi_fused_add_native_group_norm_relu_threshold_backward_2.run(buf6, buf7, buf8, primals_6, primals_7, primals_1, buf11, buf12, 256, grid=grid(256), stream=stream0)
del buf8
del primals_7
return (buf11, primals_1, primals_2, primals_3, primals_5, primals_6, buf0, reinterpret_tensor(buf1, (4, 2), (2, 1), 0), reinterpret_tensor(buf4, (4, 2), (2, 1), 0), buf5, buf6, reinterpret_tensor(buf7, (4, 2), (2, 1), 0), reinterpret_tensor(buf10, (4, 2), (2, 1), 0), buf12, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class BasicBlock(nn.Module):
expansion = 1
def __init__(self, dim):
super(BasicBlock, self).__init__()
self.conv1 = nn.Conv2d(dim, dim, kernel_size=3, padding=1, bias=False)
self.bn1 = nn.GroupNorm(2, dim, eps=0.0001)
self.relu = nn.ReLU(inplace=True)
self.conv2 = nn.Conv2d(dim, dim, kernel_size=3, padding=1, bias=False)
self.bn2 = nn.GroupNorm(2, dim, eps=0.0001)
def forward(self, x):
residual = x
out = self.conv1(x)
out = self.bn1(out)
out = self.relu(out)
out = self.conv2(out)
out = self.bn2(out)
out += residual
out = self.relu(out)
return out
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'dim': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_per_fused_native_group_norm_0(in_ptr0, out_ptr0, out_ptr1,
out_ptr2, xnumel, rnumel, XBLOCK: tl.constexpr):
xnumel = 8
RBLOCK: tl.constexpr = 32
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:, None]
xmask = xindex < xnumel
rindex = tl.arange(0, RBLOCK)[None, :]
tl.full([XBLOCK, RBLOCK], True, tl.int1)
r1 = rindex
x0 = xindex
tmp0 = tl.load(in_ptr0 + (r1 + 32 * x0), xmask, other=0.0)
tmp1 = tl.broadcast_to(tmp0, [XBLOCK, RBLOCK])
tl.where(xmask, tmp1, 0)
tmp4 = tl.broadcast_to(tmp1, [XBLOCK, RBLOCK])
tmp6 = tl.where(xmask, tmp4, 0)
tmp7 = tl.sum(tmp6, 1)[:, None]
tmp8 = tl.full([XBLOCK, 1], 32, tl.int32)
tmp9 = tmp8.to(tl.float32)
tmp10 = tmp7 / tmp9
tmp11 = tmp1 - tmp10
tmp12 = tmp11 * tmp11
tmp13 = tl.broadcast_to(tmp12, [XBLOCK, RBLOCK])
tmp15 = tl.where(xmask, tmp13, 0)
tmp16 = tl.sum(tmp15, 1)[:, None]
tmp17 = 32.0
tmp18 = tmp16 / tmp17
tmp19 = 0.0001
tmp20 = tmp18 + tmp19
tmp21 = libdevice.rsqrt(tmp20)
tl.store(out_ptr2 + x0, tmp21, xmask)
tl.store(out_ptr0 + x0, tmp10, xmask)
tl.store(out_ptr1 + x0, tmp16, xmask)
@triton.jit
def triton_poi_fused_native_group_norm_relu_1(in_ptr0, in_ptr1, in_ptr2,
in_ptr3, in_ptr4, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x4 = xindex // 16
x1 = xindex // 16 % 4
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr1 + x4 // 2, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + x4 // 2, xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr3 + x1, xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr4 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 - tmp1
tmp4 = 32.0
tmp5 = tmp3 / tmp4
tmp6 = 0.0001
tmp7 = tmp5 + tmp6
tmp8 = libdevice.rsqrt(tmp7)
tmp9 = tmp2 * tmp8
tmp11 = tmp9 * tmp10
tmp13 = tmp11 + tmp12
tmp14 = tl.full([1], 0, tl.int32)
tmp15 = triton_helpers.maximum(tmp14, tmp13)
tl.store(out_ptr0 + x3, tmp15, xmask)
@triton.jit
def triton_poi_fused_add_native_group_norm_relu_threshold_backward_2(in_ptr0,
in_ptr1, in_ptr2, in_ptr3, in_ptr4, in_ptr5, out_ptr0, out_ptr1, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x4 = xindex // 16
x1 = xindex // 16 % 4
tmp0 = tl.load(in_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr1 + x4 // 2, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr2 + x4 // 2, xmask, eviction_policy='evict_last')
tmp10 = tl.load(in_ptr3 + x1, xmask, eviction_policy='evict_last')
tmp12 = tl.load(in_ptr4 + x1, xmask, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr5 + x3, xmask)
tmp2 = tmp0 - tmp1
tmp4 = 32.0
tmp5 = tmp3 / tmp4
tmp6 = 0.0001
tmp7 = tmp5 + tmp6
tmp8 = libdevice.rsqrt(tmp7)
tmp9 = tmp2 * tmp8
tmp11 = tmp9 * tmp10
tmp13 = tmp11 + tmp12
tmp15 = tmp13 + tmp14
tmp16 = tl.full([1], 0, tl.int32)
tmp17 = triton_helpers.maximum(tmp16, tmp15)
tmp18 = 0.0
tmp19 = tmp17 <= tmp18
tl.store(out_ptr0 + x3, tmp17, xmask)
tl.store(out_ptr1 + x3, tmp19, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7) = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_3, (4,), (1,))
assert_size_stride(primals_4, (4,), (1,))
assert_size_stride(primals_5, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_6, (4,), (1,))
assert_size_stride(primals_7, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_1, primals_2, stride=(1,
1), padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 4, 4), (64, 16, 4, 1))
buf1 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
buf2 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
buf4 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
get_raw_stream(0)
triton_per_fused_native_group_norm_0[grid(8)](buf0, buf1, buf2,
buf4, 8, 32, XBLOCK=8, num_warps=2, num_stages=1)
buf5 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
triton_poi_fused_native_group_norm_relu_1[grid(256)](buf0, buf1,
buf2, primals_3, primals_4, buf5, 256, XBLOCK=128, num_warps=4,
num_stages=1)
del primals_4
buf6 = extern_kernels.convolution(buf5, primals_5, stride=(1, 1),
padding=(1, 1), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf6, (4, 4, 4, 4), (64, 16, 4, 1))
buf7 = buf2
del buf2
buf8 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
buf10 = empty_strided_cuda((4, 2, 1, 1), (2, 1, 8, 8), torch.float32)
triton_per_fused_native_group_norm_0[grid(8)](buf6, buf7, buf8,
buf10, 8, 32, XBLOCK=8, num_warps=2, num_stages=1)
buf11 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
buf12 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.bool)
triton_poi_fused_add_native_group_norm_relu_threshold_backward_2[grid
(256)](buf6, buf7, buf8, primals_6, primals_7, primals_1, buf11,
buf12, 256, XBLOCK=128, num_warps=4, num_stages=1)
del buf8
del primals_7
return (buf11, primals_1, primals_2, primals_3, primals_5, primals_6,
buf0, reinterpret_tensor(buf1, (4, 2), (2, 1), 0),
reinterpret_tensor(buf4, (4, 2), (2, 1), 0), buf5, buf6,
reinterpret_tensor(buf7, (4, 2), (2, 1), 0), reinterpret_tensor(
buf10, (4, 2), (2, 1), 0), buf12)
class BasicBlockNew(nn.Module):
expansion = 1
def __init__(self, dim):
super(BasicBlockNew, self).__init__()
self.conv1 = nn.Conv2d(dim, dim, kernel_size=3, padding=1, bias=False)
self.bn1 = nn.GroupNorm(2, dim, eps=0.0001)
self.relu = nn.ReLU(inplace=True)
self.conv2 = nn.Conv2d(dim, dim, kernel_size=3, padding=1, bias=False)
self.bn2 = nn.GroupNorm(2, dim, eps=0.0001)
def forward(self, input_0):
primals_2 = self.conv1.weight
primals_3 = self.bn1.weight
primals_4 = self.bn1.bias
primals_5 = self.conv2.weight
primals_6 = self.bn2.weight
primals_7 = self.bn2.bias
primals_1 = input_0
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7])
return output[0]
|
D-hash-code/ffjord-rnode-finalweek-mnist
|
BasicBlock
| false | 2,146 |
[
"MIT"
] | 0 |
4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
https://github.com/D-hash-code/ffjord-rnode-finalweek-mnist/tree/4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
Net
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/jq/cjqaq2meov3vkcgfealq7w4w35tw2oemvmhneuxmigeoumva22p7.py
# Topologically Sorted Source Nodes: [out_1], Original ATen: [aten.sigmoid]
# Source node to ATen node mapping:
# out_1 => sigmoid
# Graph fragment:
# %sigmoid : [num_users=2] = call_function[target=torch.ops.aten.sigmoid.default](args = (%view_1,), kwargs = {})
triton_poi_fused_sigmoid_0 = async_compile.triton('triton_poi_fused_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_sigmoid_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_sigmoid_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.sigmoid(tmp2)
tl.store(in_out_ptr0 + (x2), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [], Original ATen: []
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0); del buf0 # reuse
# Topologically Sorted Source Nodes: [out_1], Original ATen: [aten.sigmoid]
stream0 = get_raw_stream(0)
triton_poi_fused_sigmoid_0.run(buf1, primals_2, 256, grid=grid(256), stream=stream0)
del primals_2
buf2 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [out_2], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_5, reinterpret_tensor(buf1, (64, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf2)
del primals_5
return (reinterpret_tensor(buf2, (4, 4, 4, 4), (64, 16, 4, 1), 0), reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), buf1, primals_4, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.utils.data
class Net(nn.Module):
def __init__(self, input_size, hidden_size, num_out):
super(Net, self).__init__()
self.fc1 = nn.Linear(input_size, hidden_size)
self.sigmoid = nn.Sigmoid()
self.fc2 = nn.Linear(hidden_size, num_out)
def forward(self, x):
out = self.fc1(x)
out = self.sigmoid(out)
out = self.fc2(out)
return out
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'input_size': 4, 'hidden_size': 4, 'num_out': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
import torch.utils.data
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_sigmoid_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp3 = tl.sigmoid(tmp2)
tl.store(in_out_ptr0 + x2, tmp3, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.mm(reinterpret_tensor(primals_3, (64, 4), (4, 1), 0),
reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), out=buf0)
del primals_1
buf1 = reinterpret_tensor(buf0, (4, 4, 4, 4), (64, 16, 4, 1), 0)
del buf0
get_raw_stream(0)
triton_poi_fused_sigmoid_0[grid(256)](buf1, primals_2, 256, XBLOCK=
128, num_warps=4, num_stages=1)
del primals_2
buf2 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_5, reinterpret_tensor(buf1, (64, 4), (
4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0),
alpha=1, beta=1, out=buf2)
del primals_5
return reinterpret_tensor(buf2, (4, 4, 4, 4), (64, 16, 4, 1), 0
), reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), buf1, primals_4
class NetNew(nn.Module):
def __init__(self, input_size, hidden_size, num_out):
super(NetNew, self).__init__()
self.fc1 = nn.Linear(input_size, hidden_size)
self.sigmoid = nn.Sigmoid()
self.fc2 = nn.Linear(hidden_size, num_out)
def forward(self, input_0):
primals_1 = self.fc1.weight
primals_2 = self.fc1.bias
primals_4 = self.fc2.weight
primals_5 = self.fc2.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
DerekGloudemans/3D-detector-trials
|
Net
| false | 2,147 |
[
"MIT"
] | 0 |
480274567eaa84c5c883260ef62f150c7a23ffd3
|
https://github.com/DerekGloudemans/3D-detector-trials/tree/480274567eaa84c5c883260ef62f150c7a23ffd3
|
GatedConv
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/3e/c3eee7neqslxkoihqpsmtjcjpjfrwf663xmas4li4f3utsnbc6cs.py
# Topologically Sorted Source Nodes: [f, conv2d_1, g, mul], Original ATen: [aten.convolution, aten.sigmoid, aten.mul]
# Source node to ATen node mapping:
# conv2d_1 => convolution_1
# f => convolution
# g => sigmoid
# mul => mul
# Graph fragment:
# %convolution : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %convolution_1 : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_4, %primals_5, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%convolution_1,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%convolution, %sigmoid), kwargs = {})
triton_poi_fused_convolution_mul_sigmoid_0 = async_compile.triton('triton_poi_fused_convolution_mul_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_mul_sigmoid_0', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1'], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_mul_sigmoid_0(in_out_ptr0, in_out_ptr1, in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (x0), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_out_ptr1 + (x2), xmask)
tmp4 = tl.load(in_ptr1 + (x0), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tl.sigmoid(tmp5)
tmp7 = tmp2 * tmp6
tl.store(in_out_ptr0 + (x2), tmp2, xmask)
tl.store(in_out_ptr1 + (x2), tmp5, xmask)
tl.store(out_ptr0 + (x2), tmp7, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [f], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 1, 1), (4, 1, 1, 1))
# Topologically Sorted Source Nodes: [conv2d_1], Original ATen: [aten.convolution]
buf2 = extern_kernels.convolution(primals_3, primals_4, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 4, 1, 1), (4, 1, 1, 1))
buf1 = buf0; del buf0 # reuse
buf3 = buf2; del buf2 # reuse
buf4 = empty_strided_cuda((4, 4, 1, 1), (4, 1, 1, 1), torch.float32)
# Topologically Sorted Source Nodes: [f, conv2d_1, g, mul], Original ATen: [aten.convolution, aten.sigmoid, aten.mul]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_mul_sigmoid_0.run(buf1, buf3, primals_2, primals_5, buf4, 16, grid=grid(16), stream=stream0)
del primals_2
del primals_5
return (buf4, primals_1, primals_3, primals_4, buf1, buf3, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class GatedConv(nn.Module):
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
padding=0, groups=1):
super(GatedConv, self).__init__()
self.layer_f = nn.Conv2d(in_channels, out_channels, kernel_size,
stride=stride, padding=padding, dilation=1, groups=groups)
self.layer_g = nn.Conv2d(in_channels, out_channels, kernel_size,
stride=stride, padding=padding, dilation=1, groups=groups)
def forward(self, x):
f = self.layer_f(x)
g = torch.sigmoid(self.layer_g(x))
return f * g
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'in_channels': 4, 'out_channels': 4, 'kernel_size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
@triton.jit
def triton_poi_fused_convolution_mul_sigmoid_0(in_out_ptr0, in_out_ptr1,
in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x0 = xindex % 4
tmp0 = tl.load(in_out_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + x0, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_out_ptr1 + x2, xmask)
tmp4 = tl.load(in_ptr1 + x0, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tl.sigmoid(tmp5)
tmp7 = tmp2 * tmp6
tl.store(in_out_ptr0 + x2, tmp2, xmask)
tl.store(in_out_ptr1 + x2, tmp5, xmask)
tl.store(out_ptr0 + x2, tmp7, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_5, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 1, 1), (4, 1, 1, 1))
buf2 = extern_kernels.convolution(primals_3, primals_4, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf2, (4, 4, 1, 1), (4, 1, 1, 1))
buf1 = buf0
del buf0
buf3 = buf2
del buf2
buf4 = empty_strided_cuda((4, 4, 1, 1), (4, 1, 1, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_convolution_mul_sigmoid_0[grid(16)](buf1, buf3,
primals_2, primals_5, buf4, 16, XBLOCK=16, num_warps=1,
num_stages=1)
del primals_2
del primals_5
return buf4, primals_1, primals_3, primals_4, buf1, buf3
class GatedConvNew(nn.Module):
def __init__(self, in_channels, out_channels, kernel_size, stride=1,
padding=0, groups=1):
super(GatedConvNew, self).__init__()
self.layer_f = nn.Conv2d(in_channels, out_channels, kernel_size,
stride=stride, padding=padding, dilation=1, groups=groups)
self.layer_g = nn.Conv2d(in_channels, out_channels, kernel_size,
stride=stride, padding=padding, dilation=1, groups=groups)
def forward(self, input_0):
primals_1 = self.layer_f.weight
primals_2 = self.layer_f.bias
primals_3 = self.layer_g.weight
primals_5 = self.layer_g.bias
primals_4 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
D-hash-code/ffjord-rnode-finalweek-mnist
|
GatedConv
| false | 2,148 |
[
"MIT"
] | 0 |
4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
https://github.com/D-hash-code/ffjord-rnode-finalweek-mnist/tree/4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
HyperConv2d
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/cu/ccutvo2v4333pq6xhrg2zryqqwthm7dmmuqprvva2xdwiodpz5jn.py
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
# Source node to ATen node mapping:
# conv2d => convolution
# Graph fragment:
# %convolution : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_4, %view_2, %slice_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
triton_poi_fused_convolution_0 = async_compile.triton('triton_poi_fused_convolution_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_convolution_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_convolution_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 4) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + (x3), tmp2, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (1, 1), (1, 1))
assert_size_stride(primals_2, (148, 1), (1, 1))
assert_size_stride(primals_3, (148, ), (1, ))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((1, 148), (148, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_3, primals_1, reinterpret_tensor(primals_2, (1, 148), (1, 1), 0), alpha=1, beta=1, out=buf0)
del primals_2
del primals_3
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
buf1 = extern_kernels.convolution(primals_4, reinterpret_tensor(buf0, (4, 4, 3, 3), (36, 9, 3, 1), 0), stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf1, (4, 4, 2, 2), (16, 4, 2, 1))
buf2 = buf1; del buf1 # reuse
# Topologically Sorted Source Nodes: [conv2d], Original ATen: [aten.convolution]
stream0 = get_raw_stream(0)
triton_poi_fused_convolution_0.run(buf2, buf0, 64, grid=grid(64), stream=stream0)
return (buf2, primals_1, primals_4, reinterpret_tensor(buf0, (4, 4, 3, 3), (36, 9, 3, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((1, 1), (1, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((148, 1), (1, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((148, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
def weights_init(m):
classname = m.__class__.__name__
if classname.find('Linear') != -1 or classname.find('Conv') != -1:
nn.init.constant_(m.weight, 0)
nn.init.normal_(m.bias, 0, 0.01)
class HyperConv2d(nn.Module):
def __init__(self, dim_in, dim_out, ksize=3, stride=1, padding=0,
dilation=1, groups=1, bias=True, transpose=False):
super(HyperConv2d, self).__init__()
assert dim_in % groups == 0 and dim_out % groups == 0, 'dim_in and dim_out must both be divisible by groups.'
self.dim_in = dim_in
self.dim_out = dim_out
self.ksize = ksize
self.stride = stride
self.padding = padding
self.dilation = dilation
self.groups = groups
self.bias = bias
self.transpose = transpose
self.params_dim = int(dim_in * dim_out * ksize * ksize / groups)
if self.bias:
self.params_dim += dim_out
self._hypernet = nn.Linear(1, self.params_dim)
self.conv_fn = F.conv_transpose2d if transpose else F.conv2d
self._hypernet.apply(weights_init)
def forward(self, t, x):
params = self._hypernet(t.view(1, 1)).view(-1)
weight_size = int(self.dim_in * self.dim_out * self.ksize * self.
ksize / self.groups)
if self.transpose:
weight = params[:weight_size].view(self.dim_in, self.dim_out //
self.groups, self.ksize, self.ksize)
else:
weight = params[:weight_size].view(self.dim_out, self.dim_in //
self.groups, self.ksize, self.ksize)
bias = params[:self.dim_out].view(self.dim_out) if self.bias else None
return self.conv_fn(x, weight=weight, bias=bias, stride=self.stride,
padding=self.padding, groups=self.groups, dilation=self.dilation)
def get_inputs():
return [torch.rand([1, 1]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'dim_in': 4, 'dim_out': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_convolution_0(in_out_ptr0, in_ptr0, xnumel, XBLOCK: tl
.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 4 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp2 = tmp0 + tmp1
tl.store(in_out_ptr0 + x3, tmp2, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4 = args
args.clear()
assert_size_stride(primals_1, (1, 1), (1, 1))
assert_size_stride(primals_2, (148, 1), (1, 1))
assert_size_stride(primals_3, (148,), (1,))
assert_size_stride(primals_4, (4, 4, 4, 4), (64, 16, 4, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((1, 148), (148, 1), torch.float32)
extern_kernels.addmm(primals_3, primals_1, reinterpret_tensor(
primals_2, (1, 148), (1, 1), 0), alpha=1, beta=1, out=buf0)
del primals_2
del primals_3
buf1 = extern_kernels.convolution(primals_4, reinterpret_tensor(
buf0, (4, 4, 3, 3), (36, 9, 3, 1), 0), stride=(1, 1), padding=(
0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0),
groups=1, bias=None)
assert_size_stride(buf1, (4, 4, 2, 2), (16, 4, 2, 1))
buf2 = buf1
del buf1
get_raw_stream(0)
triton_poi_fused_convolution_0[grid(64)](buf2, buf0, 64, XBLOCK=64,
num_warps=1, num_stages=1)
return buf2, primals_1, primals_4, reinterpret_tensor(buf0, (4, 4, 3, 3
), (36, 9, 3, 1), 0)
def weights_init(m):
classname = m.__class__.__name__
if classname.find('Linear') != -1 or classname.find('Conv') != -1:
nn.init.constant_(m.weight, 0)
nn.init.normal_(m.bias, 0, 0.01)
class HyperConv2dNew(nn.Module):
def __init__(self, dim_in, dim_out, ksize=3, stride=1, padding=0,
dilation=1, groups=1, bias=True, transpose=False):
super(HyperConv2dNew, self).__init__()
assert dim_in % groups == 0 and dim_out % groups == 0, 'dim_in and dim_out must both be divisible by groups.'
self.dim_in = dim_in
self.dim_out = dim_out
self.ksize = ksize
self.stride = stride
self.padding = padding
self.dilation = dilation
self.groups = groups
self.bias = bias
self.transpose = transpose
self.params_dim = int(dim_in * dim_out * ksize * ksize / groups)
if self.bias:
self.params_dim += dim_out
self._hypernet = nn.Linear(1, self.params_dim)
self.conv_fn = F.conv_transpose2d if transpose else F.conv2d
self._hypernet.apply(weights_init)
def forward(self, input_0, input_1):
primals_2 = self._hypernet.weight
primals_3 = self._hypernet.bias
primals_1 = input_0
primals_4 = input_1
output = call([primals_1, primals_2, primals_3, primals_4])
return output[0]
|
D-hash-code/ffjord-rnode-finalweek-mnist
|
HyperConv2d
| false | 2,149 |
[
"MIT"
] | 0 |
4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
https://github.com/D-hash-code/ffjord-rnode-finalweek-mnist/tree/4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
BlendConv2d
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ds/cdsny3rdh32tqyjkeifiz77mt6yoehbkwlrxx6goqlqvlxxbtmip.py
# Topologically Sorted Source Nodes: [y0, y1, sub, mul, add], Original ATen: [aten.convolution, aten.sub, aten.mul, aten.add]
# Source node to ATen node mapping:
# add => add
# mul => mul
# sub => sub
# y0 => convolution
# y1 => convolution_1
# Graph fragment:
# %convolution : [num_users=2] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_1, %primals_2, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %convolution_1 : [num_users=1] = call_function[target=torch.ops.aten.convolution.default](args = (%primals_3, %primals_4, %primals_5, [1, 1], [0, 0], [1, 1], False, [0, 0], 1), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%convolution_1, %convolution), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%sub, %primals_6), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%convolution, %mul), kwargs = {})
triton_poi_fused_add_convolution_mul_sub_0 = async_compile.triton('triton_poi_fused_add_convolution_mul_sub_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_convolution_mul_sub_0', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_convolution_mul_sub_0(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, in_ptr3, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = (xindex // 4) % 4
tmp0 = tl.load(in_out_ptr0 + (x3), xmask)
tmp1 = tl.load(in_ptr0 + (x1), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + (x3), xmask)
tmp4 = tl.load(in_ptr2 + (x1), xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr3 + (x3), xmask)
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tmp5 - tmp2
tmp8 = tmp6 * tmp7
tmp9 = tmp2 + tmp8
tl.store(in_out_ptr0 + (x3), tmp9, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_5, (4, ), (1, ))
assert_size_stride(primals_6, (4, 4, 2, 2), (16, 4, 2, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
# Topologically Sorted Source Nodes: [y0], Original ATen: [aten.convolution]
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 2, 2), (16, 4, 2, 1))
# Topologically Sorted Source Nodes: [y1], Original ATen: [aten.convolution]
buf1 = extern_kernels.convolution(primals_3, primals_4, stride=(1, 1), padding=(0, 0), dilation=(1, 1), transposed=False, output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf1, (4, 4, 2, 2), (16, 4, 2, 1))
buf2 = buf0; del buf0 # reuse
# Topologically Sorted Source Nodes: [y0, y1, sub, mul, add], Original ATen: [aten.convolution, aten.sub, aten.mul, aten.add]
stream0 = get_raw_stream(0)
triton_poi_fused_add_convolution_mul_sub_0.run(buf2, primals_2, buf1, primals_5, primals_6, 64, grid=grid(64), stream=stream0)
del buf1
del primals_2
del primals_5
return (buf2, primals_1, primals_3, primals_4, primals_6, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4, 3, 3), (36, 9, 3, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((4, 4, 2, 2), (16, 4, 2, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class BlendConv2d(nn.Module):
def __init__(self, dim_in, dim_out, ksize=3, stride=1, padding=0,
dilation=1, groups=1, bias=True, transpose=False, **unused_kwargs):
super(BlendConv2d, self).__init__()
module = nn.ConvTranspose2d if transpose else nn.Conv2d
self._layer0 = module(dim_in, dim_out, kernel_size=ksize, stride=
stride, padding=padding, dilation=dilation, groups=groups, bias
=bias)
self._layer1 = module(dim_in, dim_out, kernel_size=ksize, stride=
stride, padding=padding, dilation=dilation, groups=groups, bias
=bias)
def forward(self, t, x):
y0 = self._layer0(x)
y1 = self._layer1(x)
return y0 + (y1 - y0) * t
def get_inputs():
return [torch.rand([4, 4, 2, 2]), torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'dim_in': 4, 'dim_out': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
@triton.jit
def triton_poi_fused_add_convolution_mul_sub_0(in_out_ptr0, in_ptr0,
in_ptr1, in_ptr2, in_ptr3, xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x3 = xindex
x1 = xindex // 4 % 4
tmp0 = tl.load(in_out_ptr0 + x3, xmask)
tmp1 = tl.load(in_ptr0 + x1, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr1 + x3, xmask)
tmp4 = tl.load(in_ptr2 + x1, xmask, eviction_policy='evict_last')
tmp7 = tl.load(in_ptr3 + x3, xmask)
tmp2 = tmp0 + tmp1
tmp5 = tmp3 + tmp4
tmp6 = tmp5 - tmp2
tmp8 = tmp6 * tmp7
tmp9 = tmp2 + tmp8
tl.store(in_out_ptr0 + x3, tmp9, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6 = args
args.clear()
assert_size_stride(primals_1, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4, 3, 3), (36, 9, 3, 1))
assert_size_stride(primals_5, (4,), (1,))
assert_size_stride(primals_6, (4, 4, 2, 2), (16, 4, 2, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = extern_kernels.convolution(primals_3, primals_1, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf0, (4, 4, 2, 2), (16, 4, 2, 1))
buf1 = extern_kernels.convolution(primals_3, primals_4, stride=(1,
1), padding=(0, 0), dilation=(1, 1), transposed=False,
output_padding=(0, 0), groups=1, bias=None)
assert_size_stride(buf1, (4, 4, 2, 2), (16, 4, 2, 1))
buf2 = buf0
del buf0
get_raw_stream(0)
triton_poi_fused_add_convolution_mul_sub_0[grid(64)](buf2,
primals_2, buf1, primals_5, primals_6, 64, XBLOCK=64, num_warps
=1, num_stages=1)
del buf1
del primals_2
del primals_5
return buf2, primals_1, primals_3, primals_4, primals_6
class BlendConv2dNew(nn.Module):
def __init__(self, dim_in, dim_out, ksize=3, stride=1, padding=0,
dilation=1, groups=1, bias=True, transpose=False, **unused_kwargs):
super(BlendConv2dNew, self).__init__()
module = nn.ConvTranspose2d if transpose else nn.Conv2d
self._layer0 = module(dim_in, dim_out, kernel_size=ksize, stride=
stride, padding=padding, dilation=dilation, groups=groups, bias
=bias)
self._layer1 = module(dim_in, dim_out, kernel_size=ksize, stride=
stride, padding=padding, dilation=dilation, groups=groups, bias
=bias)
def forward(self, input_0, input_1):
primals_1 = self._layer0.weight
primals_2 = self._layer0.bias
primals_4 = self._layer1.weight
primals_5 = self._layer1.bias
primals_6 = input_0
primals_3 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6])
return output[0]
|
D-hash-code/ffjord-rnode-finalweek-mnist
|
BlendConv2d
| false | 2,150 |
[
"MIT"
] | 0 |
4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
https://github.com/D-hash-code/ffjord-rnode-finalweek-mnist/tree/4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
GatedLinear
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/j6/cj63ypsp5wd4xpbcgdrjj2sjbi74adsw4ajccnbd2ift6xmplwm2.py
# Topologically Sorted Source Nodes: [g, mul], Original ATen: [aten.sigmoid, aten.mul]
# Source node to ATen node mapping:
# g => sigmoid
# mul => mul
# Graph fragment:
# %sigmoid : [num_users=1] = call_function[target=torch.ops.aten.sigmoid.default](args = (%view_3,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%view_1, %sigmoid), kwargs = {})
triton_poi_fused_mul_sigmoid_0 = async_compile.triton('triton_poi_fused_mul_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_mul_sigmoid_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_mul_sigmoid_0(in_ptr0, in_ptr1, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = tl.load(in_ptr1 + (x0), xmask)
tmp2 = tl.sigmoid(tmp1)
tmp3 = tmp0 * tmp2
tl.store(out_ptr0 + (x0), tmp3, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [f], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_2, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_1], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf1)
del primals_4
del primals_5
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [g, mul], Original ATen: [aten.sigmoid, aten.mul]
stream0 = get_raw_stream(0)
triton_poi_fused_mul_sigmoid_0.run(buf0, buf1, buf2, 256, grid=grid(256), stream=stream0)
return (buf2, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), buf0, buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
class GatedLinear(nn.Module):
def __init__(self, in_features, out_features):
super(GatedLinear, self).__init__()
self.layer_f = nn.Linear(in_features, out_features)
self.layer_g = nn.Linear(in_features, out_features)
def forward(self, x):
f = self.layer_f(x)
g = torch.sigmoid(self.layer_g(x))
return f * g
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'in_features': 4, 'out_features': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
import torch.nn as nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_mul_sigmoid_0(in_ptr0, in_ptr1, out_ptr0, xnumel,
XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = tl.load(in_ptr1 + x0, xmask)
tmp2 = tl.sigmoid(tmp1)
tmp3 = tmp0 * tmp2
tl.store(out_ptr0 + x0, tmp3, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_2, reinterpret_tensor(primals_3, (64,
4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_3, (64,
4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf1)
del primals_4
del primals_5
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_mul_sigmoid_0[grid(256)](buf0, buf1, buf2, 256,
XBLOCK=128, num_warps=4, num_stages=1)
return buf2, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), buf0, buf1
class GatedLinearNew(nn.Module):
def __init__(self, in_features, out_features):
super(GatedLinearNew, self).__init__()
self.layer_f = nn.Linear(in_features, out_features)
self.layer_g = nn.Linear(in_features, out_features)
def forward(self, input_0):
primals_1 = self.layer_f.weight
primals_2 = self.layer_f.bias
primals_4 = self.layer_g.weight
primals_5 = self.layer_g.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
D-hash-code/ffjord-rnode-finalweek-mnist
|
GatedLinear
| false | 2,151 |
[
"MIT"
] | 0 |
4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
https://github.com/D-hash-code/ffjord-rnode-finalweek-mnist/tree/4cabcbadda79c68df53ec25f1f8fe03cfeee78f9
|
GAT
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/we/cweawzwtvphxcyygwqwl2rgor3b67kwpw4sfhtbdilb5jjqkm5zg.py
# Topologically Sorted Source Nodes: [all_combinations_matrix], Original ATen: [aten.cat]
# Source node to ATen node mapping:
# all_combinations_matrix => cat
# Graph fragment:
# %cat : [num_users=1] = call_function[target=torch.ops.aten.cat.default](args = ([%view, %repeat], 1), kwargs = {})
triton_poi_fused_cat_0 = async_compile.triton('triton_poi_fused_cat_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[128],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 2, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_0(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 8
x1 = (xindex // 8)
x2 = xindex
tmp0 = x0
tmp1 = tl.full([1], 0, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + ((4*(x1 // 4)) + x0), tmp4 & xmask, eviction_policy='evict_last', other=0.0)
tmp6 = tmp0 >= tmp3
tmp7 = tl.full([1], 8, tl.int64)
tmp8 = tmp0 < tmp7
tmp9 = tl.load(in_ptr0 + ((4*(x1 % 4)) + ((-4) + x0)), tmp6 & xmask, eviction_policy='evict_last', other=0.0)
tmp10 = tl.where(tmp4, tmp5, tmp9)
tl.store(out_ptr0 + (x2), tmp10, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/rs/crsikvivgof4u6qcelh3gov7oade5uaprup6quh2r4qjgsssen7k.py
# Topologically Sorted Source Nodes: [e], Original ATen: [aten.leaky_relu]
# Source node to ATen node mapping:
# e => gt
# Graph fragment:
# %gt : [num_users=2] = call_function[target=torch.ops.aten.gt.Scalar](args = (%squeeze, 0), kwargs = {})
triton_poi_fused_leaky_relu_1 = async_compile.triton('triton_poi_fused_leaky_relu_1', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*i1', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_leaky_relu_1', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 1, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_leaky_relu_1(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp1 = 0.0
tmp2 = tmp0 > tmp1
tl.store(out_ptr0 + (x0), tmp2, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/2k/c2k6idl77paa5lpvj6v4mi3dzsgbzy45voclv5jrtwxnvtfb6k4v.py
# Topologically Sorted Source Nodes: [e, zero_vec, attention, attention_1, e_1, attention_3, attention_4, e_2, attention_6, attention_7, e_3, attention_9, attention_10], Original ATen: [aten.leaky_relu, aten.mul, aten.where, aten._softmax]
# Source node to ATen node mapping:
# attention => where_1
# attention_1 => amax, exp, sub, sum_1
# attention_10 => amax_3, exp_3, sub_3, sum_4
# attention_3 => where_4
# attention_4 => amax_1, exp_1, sub_1, sum_2
# attention_6 => where_7
# attention_7 => amax_2, exp_2, sub_2, sum_3
# attention_9 => where_10
# e => mul, where
# e_1 => mul_5, where_3
# e_2 => mul_10, where_6
# e_3 => mul_15, where_9
# zero_vec => full_default
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze, 4), kwargs = {})
# %where : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt, %squeeze, %mul), kwargs = {})
# %full_default : [num_users=5] = call_function[target=torch.ops.aten.full.default](args = ([4, 4], -8999999815811072.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %where_1 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where, %full_default), kwargs = {})
# %amax : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%where_1, [1], True), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_1, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %sum_1 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp, [1], True), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_1, 4), kwargs = {})
# %where_3 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt_3, %squeeze_1, %mul_5), kwargs = {})
# %where_4 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where_3, %full_default), kwargs = {})
# %amax_1 : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%where_4, [1], True), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_4, %amax_1), kwargs = {})
# %exp_1 : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_1,), kwargs = {})
# %sum_2 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp_1, [1], True), kwargs = {})
# %mul_10 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_2, 4), kwargs = {})
# %where_6 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt_6, %squeeze_2, %mul_10), kwargs = {})
# %where_7 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where_6, %full_default), kwargs = {})
# %amax_2 : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%where_7, [1], True), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_7, %amax_2), kwargs = {})
# %exp_2 : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_2,), kwargs = {})
# %sum_3 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp_2, [1], True), kwargs = {})
# %mul_15 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_3, 4), kwargs = {})
# %where_9 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt_9, %squeeze_3, %mul_15), kwargs = {})
# %where_10 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where_9, %full_default), kwargs = {})
# %amax_3 : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%where_10, [1], True), kwargs = {})
# %sub_3 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_10, %amax_3), kwargs = {})
# %exp_3 : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_3,), kwargs = {})
# %sum_4 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp_3, [1], True), kwargs = {})
triton_poi_fused__softmax_leaky_relu_mul_where_2 = async_compile.triton('triton_poi_fused__softmax_leaky_relu_mul_where_2', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4],
filename=__file__,
triton_meta={'signature': {0: '*i1', 1: '*i1', 2: '*fp32', 3: '*i1', 4: '*fp32', 5: '*i1', 6: '*fp32', 7: '*i1', 8: '*fp32', 9: '*fp32', 10: '*fp32', 11: '*fp32', 12: '*fp32', 13: '*fp32', 14: '*fp32', 15: '*fp32', 16: '*fp32', 17: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_leaky_relu_mul_where_2', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 36, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_leaky_relu_mul_where_2(in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, in_ptr5, in_ptr6, in_ptr7, in_ptr8, out_ptr0, out_ptr1, out_ptr2, out_ptr3, out_ptr4, out_ptr5, out_ptr6, out_ptr7, xnumel, XBLOCK : tl.constexpr):
xnumel = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (4*x0), xmask, eviction_policy='evict_last').to(tl.int1)
tmp1 = tl.load(in_ptr1 + (4*x0), xmask, eviction_policy='evict_last').to(tl.int1)
tmp2 = tl.load(in_ptr2 + (4*x0), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr0 + (1 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp9 = tl.load(in_ptr1 + (1 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp10 = tl.load(in_ptr2 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp15 = tl.load(in_ptr0 + (2 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp16 = tl.load(in_ptr1 + (2 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp17 = tl.load(in_ptr2 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp22 = tl.load(in_ptr0 + (3 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp23 = tl.load(in_ptr1 + (3 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp24 = tl.load(in_ptr2 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp40 = tl.load(in_ptr3 + (4*x0), xmask, eviction_policy='evict_last').to(tl.int1)
tmp41 = tl.load(in_ptr4 + (4*x0), xmask, eviction_policy='evict_last')
tmp45 = tl.load(in_ptr3 + (1 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp46 = tl.load(in_ptr4 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp51 = tl.load(in_ptr3 + (2 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp52 = tl.load(in_ptr4 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp57 = tl.load(in_ptr3 + (3 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp58 = tl.load(in_ptr4 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp74 = tl.load(in_ptr5 + (4*x0), xmask, eviction_policy='evict_last').to(tl.int1)
tmp75 = tl.load(in_ptr6 + (4*x0), xmask, eviction_policy='evict_last')
tmp79 = tl.load(in_ptr5 + (1 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp80 = tl.load(in_ptr6 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp85 = tl.load(in_ptr5 + (2 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp86 = tl.load(in_ptr6 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp91 = tl.load(in_ptr5 + (3 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp92 = tl.load(in_ptr6 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp108 = tl.load(in_ptr7 + (4*x0), xmask, eviction_policy='evict_last').to(tl.int1)
tmp109 = tl.load(in_ptr8 + (4*x0), xmask, eviction_policy='evict_last')
tmp113 = tl.load(in_ptr7 + (1 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp114 = tl.load(in_ptr8 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp119 = tl.load(in_ptr7 + (2 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp120 = tl.load(in_ptr8 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp125 = tl.load(in_ptr7 + (3 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp126 = tl.load(in_ptr8 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp3 = 4.0
tmp4 = tmp2 * tmp3
tmp5 = tl.where(tmp1, tmp2, tmp4)
tmp6 = -8999999815811072.0
tmp7 = tl.where(tmp0, tmp5, tmp6)
tmp11 = tmp10 * tmp3
tmp12 = tl.where(tmp9, tmp10, tmp11)
tmp13 = tl.where(tmp8, tmp12, tmp6)
tmp14 = triton_helpers.maximum(tmp7, tmp13)
tmp18 = tmp17 * tmp3
tmp19 = tl.where(tmp16, tmp17, tmp18)
tmp20 = tl.where(tmp15, tmp19, tmp6)
tmp21 = triton_helpers.maximum(tmp14, tmp20)
tmp25 = tmp24 * tmp3
tmp26 = tl.where(tmp23, tmp24, tmp25)
tmp27 = tl.where(tmp22, tmp26, tmp6)
tmp28 = triton_helpers.maximum(tmp21, tmp27)
tmp29 = tmp7 - tmp28
tmp30 = tl_math.exp(tmp29)
tmp31 = tmp13 - tmp28
tmp32 = tl_math.exp(tmp31)
tmp33 = tmp30 + tmp32
tmp34 = tmp20 - tmp28
tmp35 = tl_math.exp(tmp34)
tmp36 = tmp33 + tmp35
tmp37 = tmp27 - tmp28
tmp38 = tl_math.exp(tmp37)
tmp39 = tmp36 + tmp38
tmp42 = tmp41 * tmp3
tmp43 = tl.where(tmp40, tmp41, tmp42)
tmp44 = tl.where(tmp0, tmp43, tmp6)
tmp47 = tmp46 * tmp3
tmp48 = tl.where(tmp45, tmp46, tmp47)
tmp49 = tl.where(tmp8, tmp48, tmp6)
tmp50 = triton_helpers.maximum(tmp44, tmp49)
tmp53 = tmp52 * tmp3
tmp54 = tl.where(tmp51, tmp52, tmp53)
tmp55 = tl.where(tmp15, tmp54, tmp6)
tmp56 = triton_helpers.maximum(tmp50, tmp55)
tmp59 = tmp58 * tmp3
tmp60 = tl.where(tmp57, tmp58, tmp59)
tmp61 = tl.where(tmp22, tmp60, tmp6)
tmp62 = triton_helpers.maximum(tmp56, tmp61)
tmp63 = tmp44 - tmp62
tmp64 = tl_math.exp(tmp63)
tmp65 = tmp49 - tmp62
tmp66 = tl_math.exp(tmp65)
tmp67 = tmp64 + tmp66
tmp68 = tmp55 - tmp62
tmp69 = tl_math.exp(tmp68)
tmp70 = tmp67 + tmp69
tmp71 = tmp61 - tmp62
tmp72 = tl_math.exp(tmp71)
tmp73 = tmp70 + tmp72
tmp76 = tmp75 * tmp3
tmp77 = tl.where(tmp74, tmp75, tmp76)
tmp78 = tl.where(tmp0, tmp77, tmp6)
tmp81 = tmp80 * tmp3
tmp82 = tl.where(tmp79, tmp80, tmp81)
tmp83 = tl.where(tmp8, tmp82, tmp6)
tmp84 = triton_helpers.maximum(tmp78, tmp83)
tmp87 = tmp86 * tmp3
tmp88 = tl.where(tmp85, tmp86, tmp87)
tmp89 = tl.where(tmp15, tmp88, tmp6)
tmp90 = triton_helpers.maximum(tmp84, tmp89)
tmp93 = tmp92 * tmp3
tmp94 = tl.where(tmp91, tmp92, tmp93)
tmp95 = tl.where(tmp22, tmp94, tmp6)
tmp96 = triton_helpers.maximum(tmp90, tmp95)
tmp97 = tmp78 - tmp96
tmp98 = tl_math.exp(tmp97)
tmp99 = tmp83 - tmp96
tmp100 = tl_math.exp(tmp99)
tmp101 = tmp98 + tmp100
tmp102 = tmp89 - tmp96
tmp103 = tl_math.exp(tmp102)
tmp104 = tmp101 + tmp103
tmp105 = tmp95 - tmp96
tmp106 = tl_math.exp(tmp105)
tmp107 = tmp104 + tmp106
tmp110 = tmp109 * tmp3
tmp111 = tl.where(tmp108, tmp109, tmp110)
tmp112 = tl.where(tmp0, tmp111, tmp6)
tmp115 = tmp114 * tmp3
tmp116 = tl.where(tmp113, tmp114, tmp115)
tmp117 = tl.where(tmp8, tmp116, tmp6)
tmp118 = triton_helpers.maximum(tmp112, tmp117)
tmp121 = tmp120 * tmp3
tmp122 = tl.where(tmp119, tmp120, tmp121)
tmp123 = tl.where(tmp15, tmp122, tmp6)
tmp124 = triton_helpers.maximum(tmp118, tmp123)
tmp127 = tmp126 * tmp3
tmp128 = tl.where(tmp125, tmp126, tmp127)
tmp129 = tl.where(tmp22, tmp128, tmp6)
tmp130 = triton_helpers.maximum(tmp124, tmp129)
tmp131 = tmp112 - tmp130
tmp132 = tl_math.exp(tmp131)
tmp133 = tmp117 - tmp130
tmp134 = tl_math.exp(tmp133)
tmp135 = tmp132 + tmp134
tmp136 = tmp123 - tmp130
tmp137 = tl_math.exp(tmp136)
tmp138 = tmp135 + tmp137
tmp139 = tmp129 - tmp130
tmp140 = tl_math.exp(tmp139)
tmp141 = tmp138 + tmp140
tl.store(out_ptr0 + (x0), tmp28, xmask)
tl.store(out_ptr1 + (x0), tmp39, xmask)
tl.store(out_ptr2 + (x0), tmp62, xmask)
tl.store(out_ptr3 + (x0), tmp73, xmask)
tl.store(out_ptr4 + (x0), tmp96, xmask)
tl.store(out_ptr5 + (x0), tmp107, xmask)
tl.store(out_ptr6 + (x0), tmp130, xmask)
tl.store(out_ptr7 + (x0), tmp141, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/hw/chwxxijpaa43oudupbua5ibrakqm6zclctq55ppd6yvy4nqixzjb.py
# Topologically Sorted Source Nodes: [e, zero_vec, attention, attention_1, e_1, attention_3, attention_4, e_2, attention_6, attention_7, e_3, attention_9, attention_10], Original ATen: [aten.leaky_relu, aten.mul, aten.where, aten._softmax]
# Source node to ATen node mapping:
# attention => where_1
# attention_1 => div, exp, sub
# attention_10 => div_3, exp_3, sub_3
# attention_3 => where_4
# attention_4 => div_1, exp_1, sub_1
# attention_6 => where_7
# attention_7 => div_2, exp_2, sub_2
# attention_9 => where_10
# e => mul, where
# e_1 => mul_5, where_3
# e_2 => mul_10, where_6
# e_3 => mul_15, where_9
# zero_vec => full_default
# Graph fragment:
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze, 4), kwargs = {})
# %where : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt, %squeeze, %mul), kwargs = {})
# %full_default : [num_users=5] = call_function[target=torch.ops.aten.full.default](args = ([4, 4], -8999999815811072.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %where_1 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where, %full_default), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_1, %amax), kwargs = {})
# %exp : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub,), kwargs = {})
# %div : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp, %sum_1), kwargs = {})
# %mul_5 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_1, 4), kwargs = {})
# %where_3 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt_3, %squeeze_1, %mul_5), kwargs = {})
# %where_4 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where_3, %full_default), kwargs = {})
# %sub_1 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_4, %amax_1), kwargs = {})
# %exp_1 : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_1,), kwargs = {})
# %div_1 : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp_1, %sum_2), kwargs = {})
# %mul_10 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_2, 4), kwargs = {})
# %where_6 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt_6, %squeeze_2, %mul_10), kwargs = {})
# %where_7 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where_6, %full_default), kwargs = {})
# %sub_2 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_7, %amax_2), kwargs = {})
# %exp_2 : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_2,), kwargs = {})
# %div_2 : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp_2, %sum_3), kwargs = {})
# %mul_15 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_3, 4), kwargs = {})
# %where_9 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt_9, %squeeze_3, %mul_15), kwargs = {})
# %where_10 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where_9, %full_default), kwargs = {})
# %sub_3 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_10, %amax_3), kwargs = {})
# %exp_3 : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_3,), kwargs = {})
# %div_3 : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp_3, %sum_4), kwargs = {})
triton_poi_fused__softmax_leaky_relu_mul_where_3 = async_compile.triton('triton_poi_fused__softmax_leaky_relu_mul_where_3', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*i1', 5: '*i1', 6: '*fp32', 7: '*fp32', 8: '*i1', 9: '*fp32', 10: '*fp32', 11: '*i1', 12: '*fp32', 13: '*fp32', 14: '*i1', 15: '*fp32', 16: '*fp32', 17: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_leaky_relu_mul_where_3', 'mutated_arg_names': ['in_out_ptr0', 'in_out_ptr1', 'in_out_ptr2', 'in_out_ptr3'], 'no_x_dim': False, 'num_load': 17, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_leaky_relu_mul_where_3(in_out_ptr0, in_out_ptr1, in_out_ptr2, in_out_ptr3, in_ptr0, in_ptr1, in_ptr2, in_ptr3, in_ptr4, in_ptr5, in_ptr6, in_ptr7, in_ptr8, in_ptr9, in_ptr10, in_ptr11, in_ptr12, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask).to(tl.int1)
tmp1 = tl.load(in_ptr1 + (x2), xmask).to(tl.int1)
tmp2 = tl.load(in_out_ptr0 + (x2), xmask)
tmp8 = tl.load(in_ptr2 + (x1), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr3 + (x1), xmask, eviction_policy='evict_last')
tmp13 = tl.load(in_ptr4 + (x2), xmask).to(tl.int1)
tmp14 = tl.load(in_out_ptr1 + (x2), xmask)
tmp18 = tl.load(in_ptr5 + (x1), xmask, eviction_policy='evict_last')
tmp21 = tl.load(in_ptr6 + (x1), xmask, eviction_policy='evict_last')
tmp23 = tl.load(in_ptr7 + (x2), xmask).to(tl.int1)
tmp24 = tl.load(in_out_ptr2 + (x2), xmask)
tmp28 = tl.load(in_ptr8 + (x1), xmask, eviction_policy='evict_last')
tmp31 = tl.load(in_ptr9 + (x1), xmask, eviction_policy='evict_last')
tmp33 = tl.load(in_ptr10 + (x2), xmask).to(tl.int1)
tmp34 = tl.load(in_out_ptr3 + (x2), xmask)
tmp38 = tl.load(in_ptr11 + (x1), xmask, eviction_policy='evict_last')
tmp41 = tl.load(in_ptr12 + (x1), xmask, eviction_policy='evict_last')
tmp3 = 4.0
tmp4 = tmp2 * tmp3
tmp5 = tl.where(tmp1, tmp2, tmp4)
tmp6 = -8999999815811072.0
tmp7 = tl.where(tmp0, tmp5, tmp6)
tmp9 = tmp7 - tmp8
tmp10 = tl_math.exp(tmp9)
tmp12 = tmp10 / tmp11
tmp15 = tmp14 * tmp3
tmp16 = tl.where(tmp13, tmp14, tmp15)
tmp17 = tl.where(tmp0, tmp16, tmp6)
tmp19 = tmp17 - tmp18
tmp20 = tl_math.exp(tmp19)
tmp22 = tmp20 / tmp21
tmp25 = tmp24 * tmp3
tmp26 = tl.where(tmp23, tmp24, tmp25)
tmp27 = tl.where(tmp0, tmp26, tmp6)
tmp29 = tmp27 - tmp28
tmp30 = tl_math.exp(tmp29)
tmp32 = tmp30 / tmp31
tmp35 = tmp34 * tmp3
tmp36 = tl.where(tmp33, tmp34, tmp35)
tmp37 = tl.where(tmp0, tmp36, tmp6)
tmp39 = tmp37 - tmp38
tmp40 = tl_math.exp(tmp39)
tmp42 = tmp40 / tmp41
tl.store(in_out_ptr0 + (x2), tmp12, xmask)
tl.store(in_out_ptr1 + (x2), tmp22, xmask)
tl.store(in_out_ptr2 + (x2), tmp32, xmask)
tl.store(in_out_ptr3 + (x2), tmp42, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/6f/c6fg755hkzgmiizoydcu7wlmcvduiztugqjkietqkvpoph4vrtad.py
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten.cat]
# Source node to ATen node mapping:
# x_1 => cat_4
# Graph fragment:
# %cat_4 : [num_users=2] = call_function[target=torch.ops.aten.cat.default](args = ([%where_2, %where_5, %where_8, %where_11], 1), kwargs = {})
triton_poi_fused_cat_4 = async_compile.triton('triton_poi_fused_cat_4', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[64],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_cat_4', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 4, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_cat_4(in_ptr0, in_ptr1, in_ptr2, in_ptr3, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 16
x1 = (xindex // 16)
x2 = xindex
tmp0 = x0
tmp1 = tl.full([1], 0, tl.int64)
tmp2 = tmp0 >= tmp1
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + ((4*x1) + x0), tmp4 & xmask, eviction_policy='evict_last', other=0.0)
tmp6 = 0.0
tmp7 = tmp5 > tmp6
tmp8 = 1.0
tmp9 = tmp5 * tmp8
tmp10 = libdevice.expm1(tmp9)
tmp11 = tmp10 * tmp8
tmp12 = tl.where(tmp7, tmp9, tmp11)
tmp13 = tl.full(tmp12.shape, 0.0, tmp12.dtype)
tmp14 = tl.where(tmp4, tmp12, tmp13)
tmp15 = tmp0 >= tmp3
tmp16 = tl.full([1], 8, tl.int64)
tmp17 = tmp0 < tmp16
tmp18 = tmp15 & tmp17
tmp19 = tl.load(in_ptr1 + ((4*x1) + ((-4) + x0)), tmp18 & xmask, eviction_policy='evict_last', other=0.0)
tmp20 = tmp19 > tmp6
tmp21 = tmp19 * tmp8
tmp22 = libdevice.expm1(tmp21)
tmp23 = tmp22 * tmp8
tmp24 = tl.where(tmp20, tmp21, tmp23)
tmp25 = tl.full(tmp24.shape, 0.0, tmp24.dtype)
tmp26 = tl.where(tmp18, tmp24, tmp25)
tmp27 = tmp0 >= tmp16
tmp28 = tl.full([1], 12, tl.int64)
tmp29 = tmp0 < tmp28
tmp30 = tmp27 & tmp29
tmp31 = tl.load(in_ptr2 + ((4*x1) + ((-8) + x0)), tmp30 & xmask, eviction_policy='evict_last', other=0.0)
tmp32 = tmp31 > tmp6
tmp33 = tmp31 * tmp8
tmp34 = libdevice.expm1(tmp33)
tmp35 = tmp34 * tmp8
tmp36 = tl.where(tmp32, tmp33, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp30, tmp36, tmp37)
tmp39 = tmp0 >= tmp28
tmp40 = tl.full([1], 16, tl.int64)
tmp41 = tmp0 < tmp40
tmp42 = tl.load(in_ptr3 + ((4*x1) + ((-12) + x0)), tmp39 & xmask, eviction_policy='evict_last', other=0.0)
tmp43 = tmp42 > tmp6
tmp44 = tmp42 * tmp8
tmp45 = libdevice.expm1(tmp44)
tmp46 = tmp45 * tmp8
tmp47 = tl.where(tmp43, tmp44, tmp46)
tmp48 = tl.full(tmp47.shape, 0.0, tmp47.dtype)
tmp49 = tl.where(tmp39, tmp47, tmp48)
tmp50 = tl.where(tmp30, tmp38, tmp49)
tmp51 = tl.where(tmp18, tmp26, tmp50)
tmp52 = tl.where(tmp4, tmp14, tmp51)
tl.store(out_ptr0 + (x2), tmp52, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/6q/c6qm3bsuqnbgmfnlkkyiezkvruidr5w4kgvxblmhqrkljef5u2ab.py
# Topologically Sorted Source Nodes: [zero_vec, e_4, attention_12, attention_13], Original ATen: [aten.mul, aten.leaky_relu, aten.where, aten._softmax]
# Source node to ATen node mapping:
# attention_12 => where_13
# attention_13 => amax_4, exp_4, sub_4, sum_5
# e_4 => mul_20, where_12
# zero_vec => full_default
# Graph fragment:
# %full_default : [num_users=5] = call_function[target=torch.ops.aten.full.default](args = ([4, 4], -8999999815811072.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %mul_20 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_4, 4), kwargs = {})
# %where_12 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt_12, %squeeze_4, %mul_20), kwargs = {})
# %where_13 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where_12, %full_default), kwargs = {})
# %amax_4 : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%where_13, [1], True), kwargs = {})
# %sub_4 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_13, %amax_4), kwargs = {})
# %exp_4 : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_4,), kwargs = {})
# %sum_5 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp_4, [1], True), kwargs = {})
triton_poi_fused__softmax_leaky_relu_mul_where_5 = async_compile.triton('triton_poi_fused__softmax_leaky_relu_mul_where_5', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[4],
filename=__file__,
triton_meta={'signature': {0: '*i1', 1: '*i1', 2: '*fp32', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_leaky_relu_mul_where_5', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 12, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_leaky_relu_mul_where_5(in_ptr0, in_ptr1, in_ptr2, out_ptr0, out_ptr1, xnumel, XBLOCK : tl.constexpr):
xnumel = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (4*x0), xmask, eviction_policy='evict_last').to(tl.int1)
tmp1 = tl.load(in_ptr1 + (4*x0), xmask, eviction_policy='evict_last').to(tl.int1)
tmp2 = tl.load(in_ptr2 + (4*x0), xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr0 + (1 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp9 = tl.load(in_ptr1 + (1 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp10 = tl.load(in_ptr2 + (1 + (4*x0)), xmask, eviction_policy='evict_last')
tmp15 = tl.load(in_ptr0 + (2 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp16 = tl.load(in_ptr1 + (2 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp17 = tl.load(in_ptr2 + (2 + (4*x0)), xmask, eviction_policy='evict_last')
tmp22 = tl.load(in_ptr0 + (3 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp23 = tl.load(in_ptr1 + (3 + (4*x0)), xmask, eviction_policy='evict_last').to(tl.int1)
tmp24 = tl.load(in_ptr2 + (3 + (4*x0)), xmask, eviction_policy='evict_last')
tmp3 = 4.0
tmp4 = tmp2 * tmp3
tmp5 = tl.where(tmp1, tmp2, tmp4)
tmp6 = -8999999815811072.0
tmp7 = tl.where(tmp0, tmp5, tmp6)
tmp11 = tmp10 * tmp3
tmp12 = tl.where(tmp9, tmp10, tmp11)
tmp13 = tl.where(tmp8, tmp12, tmp6)
tmp14 = triton_helpers.maximum(tmp7, tmp13)
tmp18 = tmp17 * tmp3
tmp19 = tl.where(tmp16, tmp17, tmp18)
tmp20 = tl.where(tmp15, tmp19, tmp6)
tmp21 = triton_helpers.maximum(tmp14, tmp20)
tmp25 = tmp24 * tmp3
tmp26 = tl.where(tmp23, tmp24, tmp25)
tmp27 = tl.where(tmp22, tmp26, tmp6)
tmp28 = triton_helpers.maximum(tmp21, tmp27)
tmp29 = tmp7 - tmp28
tmp30 = tl_math.exp(tmp29)
tmp31 = tmp13 - tmp28
tmp32 = tl_math.exp(tmp31)
tmp33 = tmp30 + tmp32
tmp34 = tmp20 - tmp28
tmp35 = tl_math.exp(tmp34)
tmp36 = tmp33 + tmp35
tmp37 = tmp27 - tmp28
tmp38 = tl_math.exp(tmp37)
tmp39 = tmp36 + tmp38
tl.store(out_ptr0 + (x0), tmp28, xmask)
tl.store(out_ptr1 + (x0), tmp39, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/4f/c4fpasprzjcely6grqxmcycpm24taaowwba6rqvchhupdivgc3gx.py
# Topologically Sorted Source Nodes: [zero_vec, e_4, attention_12, attention_13], Original ATen: [aten.mul, aten.leaky_relu, aten.where, aten._softmax]
# Source node to ATen node mapping:
# attention_12 => where_13
# attention_13 => div_4, exp_4, sub_4
# e_4 => mul_20, where_12
# zero_vec => full_default
# Graph fragment:
# %full_default : [num_users=5] = call_function[target=torch.ops.aten.full.default](args = ([4, 4], -8999999815811072.0), kwargs = {dtype: torch.float32, layout: torch.strided, device: cuda:0, pin_memory: False})
# %mul_20 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%squeeze_4, 4), kwargs = {})
# %where_12 : [num_users=1] = call_function[target=torch.ops.aten.where.self](args = (%gt_12, %squeeze_4, %mul_20), kwargs = {})
# %where_13 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_1, %where_12, %full_default), kwargs = {})
# %sub_4 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_13, %amax_4), kwargs = {})
# %exp_4 : [num_users=2] = call_function[target=torch.ops.aten.exp.default](args = (%sub_4,), kwargs = {})
# %div_4 : [num_users=2] = call_function[target=torch.ops.aten.div.Tensor](args = (%exp_4, %sum_5), kwargs = {})
triton_poi_fused__softmax_leaky_relu_mul_where_6 = async_compile.triton('triton_poi_fused__softmax_leaky_relu_mul_where_6', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*i1', 2: '*i1', 3: '*fp32', 4: '*fp32', 5: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4, 5), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__softmax_leaky_relu_mul_where_6', 'mutated_arg_names': ['in_out_ptr0'], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__softmax_leaky_relu_mul_where_6(in_out_ptr0, in_ptr0, in_ptr1, in_ptr2, in_ptr3, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask).to(tl.int1)
tmp1 = tl.load(in_ptr1 + (x2), xmask).to(tl.int1)
tmp2 = tl.load(in_out_ptr0 + (x2), xmask)
tmp8 = tl.load(in_ptr2 + (x1), xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr3 + (x1), xmask, eviction_policy='evict_last')
tmp3 = 4.0
tmp4 = tmp2 * tmp3
tmp5 = tl.where(tmp1, tmp2, tmp4)
tmp6 = -8999999815811072.0
tmp7 = tl.where(tmp0, tmp5, tmp6)
tmp9 = tmp7 - tmp8
tmp10 = tl_math.exp(tmp9)
tmp12 = tmp10 / tmp11
tl.store(in_out_ptr0 + (x2), tmp12, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/kh/ckhqmfqvhnwvyhbpb3iprnlwi2pqyf7jm2xk5yxlguo5jfsog2io.py
# Topologically Sorted Source Nodes: [x_3, log_softmax], Original ATen: [aten.elu, aten._log_softmax]
# Source node to ATen node mapping:
# log_softmax => amax_5, sub_5
# x_3 => expm1_4, gt_14, mul_22, mul_24, where_14
# Graph fragment:
# %gt_14 : [num_users=1] = call_function[target=torch.ops.aten.gt.Scalar](args = (%mm_14, 0), kwargs = {})
# %mul_22 : [num_users=2] = call_function[target=torch.ops.aten.mul.Tensor](args = (%mm_14, 1.0), kwargs = {})
# %expm1_4 : [num_users=1] = call_function[target=torch.ops.aten.expm1.default](args = (%mul_22,), kwargs = {})
# %mul_24 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%expm1_4, 1.0), kwargs = {})
# %where_14 : [num_users=2] = call_function[target=torch.ops.aten.where.self](args = (%gt_14, %mul_22, %mul_24), kwargs = {})
# %amax_5 : [num_users=1] = call_function[target=torch.ops.aten.amax.default](args = (%where_14, [1], True), kwargs = {})
# %sub_5 : [num_users=2] = call_function[target=torch.ops.aten.sub.Tensor](args = (%where_14, %amax_5), kwargs = {})
triton_poi_fused__log_softmax_elu_7 = async_compile.triton('triton_poi_fused__log_softmax_elu_7', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__log_softmax_elu_7', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__log_softmax_elu_7(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp8 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp21 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp28 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp1 = 0.0
tmp2 = tmp0 > tmp1
tmp3 = 1.0
tmp4 = tmp0 * tmp3
tmp5 = libdevice.expm1(tmp4)
tmp6 = tmp5 * tmp3
tmp7 = tl.where(tmp2, tmp4, tmp6)
tmp9 = tmp8 > tmp1
tmp10 = tmp8 * tmp3
tmp11 = libdevice.expm1(tmp10)
tmp12 = tmp11 * tmp3
tmp13 = tl.where(tmp9, tmp10, tmp12)
tmp15 = tmp14 > tmp1
tmp16 = tmp14 * tmp3
tmp17 = libdevice.expm1(tmp16)
tmp18 = tmp17 * tmp3
tmp19 = tl.where(tmp15, tmp16, tmp18)
tmp20 = triton_helpers.maximum(tmp13, tmp19)
tmp22 = tmp21 > tmp1
tmp23 = tmp21 * tmp3
tmp24 = libdevice.expm1(tmp23)
tmp25 = tmp24 * tmp3
tmp26 = tl.where(tmp22, tmp23, tmp25)
tmp27 = triton_helpers.maximum(tmp20, tmp26)
tmp29 = tmp28 > tmp1
tmp30 = tmp28 * tmp3
tmp31 = libdevice.expm1(tmp30)
tmp32 = tmp31 * tmp3
tmp33 = tl.where(tmp29, tmp30, tmp32)
tmp34 = triton_helpers.maximum(tmp27, tmp33)
tmp35 = tmp7 - tmp34
tl.store(out_ptr0 + (x2), tmp35, xmask)
''', device_str='cuda')
# kernel path: runs/run_shard_7/inductor_cache/wb/cwb6yk7fx4digcmhrmo6tjyge2t73fzx437t3vl5lroa6x7t6fem.py
# Topologically Sorted Source Nodes: [log_softmax], Original ATen: [aten._log_softmax]
# Source node to ATen node mapping:
# log_softmax => exp_5, log, sub_6, sum_6
# Graph fragment:
# %exp_5 : [num_users=1] = call_function[target=torch.ops.aten.exp.default](args = (%sub_5,), kwargs = {})
# %sum_6 : [num_users=1] = call_function[target=torch.ops.aten.sum.dim_IntList](args = (%exp_5, [1], True), kwargs = {})
# %log : [num_users=1] = call_function[target=torch.ops.aten.log.default](args = (%sum_6,), kwargs = {})
# %sub_6 : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (%sub_5, %log), kwargs = {})
triton_poi_fused__log_softmax_8 = async_compile.triton('triton_poi_fused__log_softmax_8', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[16],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused__log_softmax_8', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 5, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused__log_softmax_8(in_ptr0, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = (xindex // 4)
tmp0 = tl.load(in_ptr0 + (x2), xmask)
tmp1 = tl.load(in_ptr0 + (4*x1), xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (1 + (4*x1)), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (2 + (4*x1)), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (3 + (4*x1)), xmask, eviction_policy='evict_last')
tmp2 = tl_math.exp(tmp1)
tmp4 = tl_math.exp(tmp3)
tmp5 = tmp2 + tmp4
tmp7 = tl_math.exp(tmp6)
tmp8 = tmp5 + tmp7
tmp10 = tl_math.exp(tmp9)
tmp11 = tmp8 + tmp10
tmp12 = tl_math.log(tmp11)
tmp13 = tmp0 - tmp12
tl.store(out_ptr0 + (x2), tmp13, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (8, 1), (1, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, 4), (4, 1))
assert_size_stride(primals_6, (8, 1), (1, 1))
assert_size_stride(primals_7, (4, 4), (4, 1))
assert_size_stride(primals_8, (8, 1), (1, 1))
assert_size_stride(primals_9, (4, 4), (4, 1))
assert_size_stride(primals_10, (8, 1), (1, 1))
assert_size_stride(primals_11, (16, 4), (4, 1))
assert_size_stride(primals_12, (8, 1), (1, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [Wh], Original ATen: [aten.mm]
extern_kernels.mm(primals_1, primals_2, out=buf0)
del primals_2
buf1 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
# Topologically Sorted Source Nodes: [all_combinations_matrix], Original ATen: [aten.cat]
stream0 = get_raw_stream(0)
triton_poi_fused_cat_0.run(buf0, buf1, 128, grid=grid(128), stream=stream0)
buf2 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul], Original ATen: [aten.mm]
extern_kernels.mm(buf1, primals_3, out=buf2)
buf3 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
# Topologically Sorted Source Nodes: [e], Original ATen: [aten.leaky_relu]
triton_poi_fused_leaky_relu_1.run(buf2, buf3, 16, grid=grid(16), stream=stream0)
buf4 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
# Topologically Sorted Source Nodes: [gt], Original ATen: [aten.gt]
triton_poi_fused_leaky_relu_1.run(primals_4, buf4, 16, grid=grid(16), stream=stream0)
del primals_4
buf9 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [Wh_1], Original ATen: [aten.mm]
extern_kernels.mm(primals_1, primals_5, out=buf9)
del primals_5
buf10 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
# Topologically Sorted Source Nodes: [all_combinations_matrix_1], Original ATen: [aten.cat]
triton_poi_fused_cat_0.run(buf9, buf10, 128, grid=grid(128), stream=stream0)
buf11 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul_2], Original ATen: [aten.mm]
extern_kernels.mm(buf10, primals_6, out=buf11)
buf12 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
# Topologically Sorted Source Nodes: [e_1], Original ATen: [aten.leaky_relu]
triton_poi_fused_leaky_relu_1.run(buf11, buf12, 16, grid=grid(16), stream=stream0)
buf17 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [Wh_2], Original ATen: [aten.mm]
extern_kernels.mm(primals_1, primals_7, out=buf17)
del primals_7
buf18 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
# Topologically Sorted Source Nodes: [all_combinations_matrix_2], Original ATen: [aten.cat]
triton_poi_fused_cat_0.run(buf17, buf18, 128, grid=grid(128), stream=stream0)
buf19 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul_4], Original ATen: [aten.mm]
extern_kernels.mm(buf18, primals_8, out=buf19)
buf20 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
# Topologically Sorted Source Nodes: [e_2], Original ATen: [aten.leaky_relu]
triton_poi_fused_leaky_relu_1.run(buf19, buf20, 16, grid=grid(16), stream=stream0)
buf25 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [Wh_3], Original ATen: [aten.mm]
extern_kernels.mm(primals_1, primals_9, out=buf25)
del primals_9
buf26 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
# Topologically Sorted Source Nodes: [all_combinations_matrix_3], Original ATen: [aten.cat]
triton_poi_fused_cat_0.run(buf25, buf26, 128, grid=grid(128), stream=stream0)
buf27 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul_6], Original ATen: [aten.mm]
extern_kernels.mm(buf26, primals_10, out=buf27)
buf28 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
# Topologically Sorted Source Nodes: [e_3], Original ATen: [aten.leaky_relu]
triton_poi_fused_leaky_relu_1.run(buf27, buf28, 16, grid=grid(16), stream=stream0)
buf5 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf6 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf13 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf14 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf21 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf22 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf29 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf30 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
# Topologically Sorted Source Nodes: [e, zero_vec, attention, attention_1, e_1, attention_3, attention_4, e_2, attention_6, attention_7, e_3, attention_9, attention_10], Original ATen: [aten.leaky_relu, aten.mul, aten.where, aten._softmax]
triton_poi_fused__softmax_leaky_relu_mul_where_2.run(buf4, buf3, buf2, buf12, buf11, buf20, buf19, buf28, buf27, buf5, buf6, buf13, buf14, buf21, buf22, buf29, buf30, 4, grid=grid(4), stream=stream0)
buf7 = reinterpret_tensor(buf2, (4, 4), (4, 1), 0); del buf2 # reuse
buf15 = reinterpret_tensor(buf11, (4, 4), (4, 1), 0); del buf11 # reuse
buf23 = reinterpret_tensor(buf19, (4, 4), (4, 1), 0); del buf19 # reuse
buf31 = reinterpret_tensor(buf27, (4, 4), (4, 1), 0); del buf27 # reuse
# Topologically Sorted Source Nodes: [e, zero_vec, attention, attention_1, e_1, attention_3, attention_4, e_2, attention_6, attention_7, e_3, attention_9, attention_10], Original ATen: [aten.leaky_relu, aten.mul, aten.where, aten._softmax]
triton_poi_fused__softmax_leaky_relu_mul_where_3.run(buf7, buf15, buf23, buf31, buf4, buf3, buf5, buf6, buf12, buf13, buf14, buf20, buf21, buf22, buf28, buf29, buf30, 16, grid=grid(16), stream=stream0)
del buf13
del buf14
del buf21
del buf22
del buf29
del buf30
buf8 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [h_prime], Original ATen: [aten.mm]
extern_kernels.mm(buf7, buf0, out=buf8)
buf16 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [h_prime_1], Original ATen: [aten.mm]
extern_kernels.mm(buf15, buf9, out=buf16)
buf24 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [h_prime_2], Original ATen: [aten.mm]
extern_kernels.mm(buf23, buf17, out=buf24)
buf32 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [h_prime_3], Original ATen: [aten.mm]
extern_kernels.mm(buf31, buf25, out=buf32)
buf33 = empty_strided_cuda((4, 16), (16, 1), torch.float32)
# Topologically Sorted Source Nodes: [x_1], Original ATen: [aten.cat]
triton_poi_fused_cat_4.run(buf8, buf16, buf24, buf32, buf33, 64, grid=grid(64), stream=stream0)
buf34 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [Wh_4], Original ATen: [aten.mm]
extern_kernels.mm(buf33, primals_11, out=buf34)
buf35 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
# Topologically Sorted Source Nodes: [all_combinations_matrix_4], Original ATen: [aten.cat]
triton_poi_fused_cat_0.run(buf34, buf35, 128, grid=grid(128), stream=stream0)
buf36 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
# Topologically Sorted Source Nodes: [matmul_8], Original ATen: [aten.mm]
extern_kernels.mm(buf35, primals_12, out=buf36)
buf37 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
# Topologically Sorted Source Nodes: [e_4], Original ATen: [aten.leaky_relu]
triton_poi_fused_leaky_relu_1.run(buf36, buf37, 16, grid=grid(16), stream=stream0)
buf38 = buf6; del buf6 # reuse
buf39 = buf5; del buf5 # reuse
# Topologically Sorted Source Nodes: [zero_vec, e_4, attention_12, attention_13], Original ATen: [aten.mul, aten.leaky_relu, aten.where, aten._softmax]
triton_poi_fused__softmax_leaky_relu_mul_where_5.run(buf4, buf37, buf36, buf38, buf39, 4, grid=grid(4), stream=stream0)
buf40 = reinterpret_tensor(buf36, (4, 4), (4, 1), 0); del buf36 # reuse
# Topologically Sorted Source Nodes: [zero_vec, e_4, attention_12, attention_13], Original ATen: [aten.mul, aten.leaky_relu, aten.where, aten._softmax]
triton_poi_fused__softmax_leaky_relu_mul_where_6.run(buf40, buf4, buf37, buf38, buf39, 16, grid=grid(16), stream=stream0)
del buf38
del buf39
buf41 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [h_prime_4], Original ATen: [aten.mm]
extern_kernels.mm(buf40, buf34, out=buf41)
buf42 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x_3, log_softmax], Original ATen: [aten.elu, aten._log_softmax]
triton_poi_fused__log_softmax_elu_7.run(buf41, buf42, 16, grid=grid(16), stream=stream0)
buf43 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [log_softmax], Original ATen: [aten._log_softmax]
triton_poi_fused__log_softmax_8.run(buf42, buf43, 16, grid=grid(16), stream=stream0)
del buf42
return (buf43, buf3, buf4, buf7, buf8, buf12, buf15, buf16, buf20, buf23, buf24, buf28, buf31, buf32, buf37, buf40, buf41, buf43, reinterpret_tensor(buf34, (4, 4), (1, 4), 0), reinterpret_tensor(buf35, (8, 16), (1, 8), 0), reinterpret_tensor(primals_12, (1, 8), (1, 1), 0), reinterpret_tensor(buf33, (16, 4), (1, 16), 0), reinterpret_tensor(primals_11, (4, 16), (1, 4), 0), reinterpret_tensor(buf25, (4, 4), (1, 4), 0), reinterpret_tensor(buf26, (8, 16), (1, 8), 0), reinterpret_tensor(primals_10, (1, 8), (1, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), reinterpret_tensor(buf17, (4, 4), (1, 4), 0), reinterpret_tensor(buf18, (8, 16), (1, 8), 0), reinterpret_tensor(primals_8, (1, 8), (1, 1), 0), reinterpret_tensor(buf9, (4, 4), (1, 4), 0), reinterpret_tensor(buf10, (8, 16), (1, 8), 0), reinterpret_tensor(primals_6, (1, 8), (1, 1), 0), reinterpret_tensor(buf0, (4, 4), (1, 4), 0), reinterpret_tensor(buf1, (8, 16), (1, 8), 0), reinterpret_tensor(primals_3, (1, 8), (1, 1), 0), )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((8, 1), (1, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_6 = rand_strided((8, 1), (1, 1), device='cuda:0', dtype=torch.float32)
primals_7 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_8 = rand_strided((8, 1), (1, 1), device='cuda:0', dtype=torch.float32)
primals_9 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_10 = rand_strided((8, 1), (1, 1), device='cuda:0', dtype=torch.float32)
primals_11 = rand_strided((16, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_12 = rand_strided((8, 1), (1, 1), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5, primals_6, primals_7, primals_8, primals_9, primals_10, primals_11, primals_12])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
import torch.nn as nn
import torch.nn.functional as F
class GraphAttentionLayer(nn.Module):
"""
Simple GAT layer, similar to https://arxiv.org/abs/1710.10903
"""
def __init__(self, in_features, out_features, dropout, alpha, concat=True):
super(GraphAttentionLayer, self).__init__()
self.dropout = dropout
self.in_features = in_features
self.out_features = out_features
self.alpha = alpha
self.concat = concat
self.W = nn.Parameter(torch.empty(size=(in_features, out_features)))
nn.init.xavier_uniform_(self.W.data, gain=1.414)
self.a = nn.Parameter(torch.empty(size=(2 * out_features, 1)))
nn.init.xavier_uniform_(self.a.data, gain=1.414)
self.leakyrelu = nn.LeakyReLU(self.alpha)
def forward(self, h, adj):
Wh = torch.mm(h, self.W)
a_input = self._prepare_attentional_mechanism_input(Wh)
e = self.leakyrelu(torch.matmul(a_input, self.a).squeeze(2))
zero_vec = -9000000000000000.0 * torch.ones_like(e)
attention = torch.where(adj > 0, e, zero_vec)
attention = F.softmax(attention, dim=1)
attention = F.dropout(attention, self.dropout, training=self.training)
h_prime = torch.matmul(attention, Wh)
if self.concat:
return F.elu(h_prime)
else:
return h_prime
def _prepare_attentional_mechanism_input(self, Wh):
N = Wh.size()[0]
Wh_repeated_in_chunks = Wh.repeat_interleave(N, dim=0)
Wh_repeated_alternating = Wh.repeat(N, 1)
all_combinations_matrix = torch.cat([Wh_repeated_in_chunks,
Wh_repeated_alternating], dim=1)
return all_combinations_matrix.view(N, N, 2 * self.out_features)
def __repr__(self):
return self.__class__.__name__ + ' (' + str(self.in_features
) + ' -> ' + str(self.out_features) + ')'
class GAT(nn.Module):
def __init__(self, nfeat, nhid, nclass, dropout, alpha, nheads):
"""Dense version of GAT."""
super(GAT, self).__init__()
self.dropout = dropout
self.attentions = [GraphAttentionLayer(nfeat, nhid, dropout=dropout,
alpha=alpha, concat=True) for _ in range(nheads)]
for i, attention in enumerate(self.attentions):
self.add_module('attention_{}'.format(i), attention)
self.out_att = GraphAttentionLayer(nhid * nheads, nclass, dropout=
dropout, alpha=alpha, concat=False)
def forward(self, x, adj):
x = F.dropout(x, self.dropout, training=self.training)
x = torch.cat([att(x, adj) for att in self.attentions], dim=1)
x = F.dropout(x, self.dropout, training=self.training)
x = F.elu(self.out_att(x, adj))
return F.log_softmax(x, dim=1)
def get_inputs():
return [torch.rand([4, 4]), torch.rand([4, 4])]
def get_init_inputs():
return [[], {'nfeat': 4, 'nhid': 4, 'nclass': 4, 'dropout': 0.5,
'alpha': 4, 'nheads': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
import torch.nn as nn
import torch.nn.functional as F
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_cat_0(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 128
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 8
x1 = xindex // 8
x2 = xindex
tmp0 = x0
tl.full([1], 0, tl.int64)
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + (4 * (x1 // 4) + x0), tmp4 & xmask,
eviction_policy='evict_last', other=0.0)
tmp6 = tmp0 >= tmp3
tl.full([1], 8, tl.int64)
tmp9 = tl.load(in_ptr0 + (4 * (x1 % 4) + (-4 + x0)), tmp6 & xmask,
eviction_policy='evict_last', other=0.0)
tmp10 = tl.where(tmp4, tmp5, tmp9)
tl.store(out_ptr0 + x2, tmp10, xmask)
@triton.jit
def triton_poi_fused_leaky_relu_1(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp1 = 0.0
tmp2 = tmp0 > tmp1
tl.store(out_ptr0 + x0, tmp2, xmask)
@triton.jit
def triton_poi_fused__softmax_leaky_relu_mul_where_2(in_ptr0, in_ptr1,
in_ptr2, in_ptr3, in_ptr4, in_ptr5, in_ptr6, in_ptr7, in_ptr8, out_ptr0,
out_ptr1, out_ptr2, out_ptr3, out_ptr4, out_ptr5, out_ptr6, out_ptr7,
xnumel, XBLOCK: tl.constexpr):
xnumel = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + 4 * x0, xmask, eviction_policy='evict_last').to(tl
.int1)
tmp1 = tl.load(in_ptr1 + 4 * x0, xmask, eviction_policy='evict_last').to(tl
.int1)
tmp2 = tl.load(in_ptr2 + 4 * x0, xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr0 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp9 = tl.load(in_ptr1 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp10 = tl.load(in_ptr2 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp15 = tl.load(in_ptr0 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp16 = tl.load(in_ptr1 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp17 = tl.load(in_ptr2 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp22 = tl.load(in_ptr0 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp23 = tl.load(in_ptr1 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp24 = tl.load(in_ptr2 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp40 = tl.load(in_ptr3 + 4 * x0, xmask, eviction_policy='evict_last').to(
tl.int1)
tmp41 = tl.load(in_ptr4 + 4 * x0, xmask, eviction_policy='evict_last')
tmp45 = tl.load(in_ptr3 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp46 = tl.load(in_ptr4 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp51 = tl.load(in_ptr3 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp52 = tl.load(in_ptr4 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp57 = tl.load(in_ptr3 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp58 = tl.load(in_ptr4 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp74 = tl.load(in_ptr5 + 4 * x0, xmask, eviction_policy='evict_last').to(
tl.int1)
tmp75 = tl.load(in_ptr6 + 4 * x0, xmask, eviction_policy='evict_last')
tmp79 = tl.load(in_ptr5 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp80 = tl.load(in_ptr6 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp85 = tl.load(in_ptr5 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp86 = tl.load(in_ptr6 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp91 = tl.load(in_ptr5 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp92 = tl.load(in_ptr6 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp108 = tl.load(in_ptr7 + 4 * x0, xmask, eviction_policy='evict_last').to(
tl.int1)
tmp109 = tl.load(in_ptr8 + 4 * x0, xmask, eviction_policy='evict_last')
tmp113 = tl.load(in_ptr7 + (1 + 4 * x0), xmask, eviction_policy=
'evict_last').to(tl.int1)
tmp114 = tl.load(in_ptr8 + (1 + 4 * x0), xmask, eviction_policy=
'evict_last')
tmp119 = tl.load(in_ptr7 + (2 + 4 * x0), xmask, eviction_policy=
'evict_last').to(tl.int1)
tmp120 = tl.load(in_ptr8 + (2 + 4 * x0), xmask, eviction_policy=
'evict_last')
tmp125 = tl.load(in_ptr7 + (3 + 4 * x0), xmask, eviction_policy=
'evict_last').to(tl.int1)
tmp126 = tl.load(in_ptr8 + (3 + 4 * x0), xmask, eviction_policy=
'evict_last')
tmp3 = 4.0
tmp4 = tmp2 * tmp3
tmp5 = tl.where(tmp1, tmp2, tmp4)
tmp6 = -8999999815811072.0
tmp7 = tl.where(tmp0, tmp5, tmp6)
tmp11 = tmp10 * tmp3
tmp12 = tl.where(tmp9, tmp10, tmp11)
tmp13 = tl.where(tmp8, tmp12, tmp6)
tmp14 = triton_helpers.maximum(tmp7, tmp13)
tmp18 = tmp17 * tmp3
tmp19 = tl.where(tmp16, tmp17, tmp18)
tmp20 = tl.where(tmp15, tmp19, tmp6)
tmp21 = triton_helpers.maximum(tmp14, tmp20)
tmp25 = tmp24 * tmp3
tmp26 = tl.where(tmp23, tmp24, tmp25)
tmp27 = tl.where(tmp22, tmp26, tmp6)
tmp28 = triton_helpers.maximum(tmp21, tmp27)
tmp29 = tmp7 - tmp28
tmp30 = tl_math.exp(tmp29)
tmp31 = tmp13 - tmp28
tmp32 = tl_math.exp(tmp31)
tmp33 = tmp30 + tmp32
tmp34 = tmp20 - tmp28
tmp35 = tl_math.exp(tmp34)
tmp36 = tmp33 + tmp35
tmp37 = tmp27 - tmp28
tmp38 = tl_math.exp(tmp37)
tmp39 = tmp36 + tmp38
tmp42 = tmp41 * tmp3
tmp43 = tl.where(tmp40, tmp41, tmp42)
tmp44 = tl.where(tmp0, tmp43, tmp6)
tmp47 = tmp46 * tmp3
tmp48 = tl.where(tmp45, tmp46, tmp47)
tmp49 = tl.where(tmp8, tmp48, tmp6)
tmp50 = triton_helpers.maximum(tmp44, tmp49)
tmp53 = tmp52 * tmp3
tmp54 = tl.where(tmp51, tmp52, tmp53)
tmp55 = tl.where(tmp15, tmp54, tmp6)
tmp56 = triton_helpers.maximum(tmp50, tmp55)
tmp59 = tmp58 * tmp3
tmp60 = tl.where(tmp57, tmp58, tmp59)
tmp61 = tl.where(tmp22, tmp60, tmp6)
tmp62 = triton_helpers.maximum(tmp56, tmp61)
tmp63 = tmp44 - tmp62
tmp64 = tl_math.exp(tmp63)
tmp65 = tmp49 - tmp62
tmp66 = tl_math.exp(tmp65)
tmp67 = tmp64 + tmp66
tmp68 = tmp55 - tmp62
tmp69 = tl_math.exp(tmp68)
tmp70 = tmp67 + tmp69
tmp71 = tmp61 - tmp62
tmp72 = tl_math.exp(tmp71)
tmp73 = tmp70 + tmp72
tmp76 = tmp75 * tmp3
tmp77 = tl.where(tmp74, tmp75, tmp76)
tmp78 = tl.where(tmp0, tmp77, tmp6)
tmp81 = tmp80 * tmp3
tmp82 = tl.where(tmp79, tmp80, tmp81)
tmp83 = tl.where(tmp8, tmp82, tmp6)
tmp84 = triton_helpers.maximum(tmp78, tmp83)
tmp87 = tmp86 * tmp3
tmp88 = tl.where(tmp85, tmp86, tmp87)
tmp89 = tl.where(tmp15, tmp88, tmp6)
tmp90 = triton_helpers.maximum(tmp84, tmp89)
tmp93 = tmp92 * tmp3
tmp94 = tl.where(tmp91, tmp92, tmp93)
tmp95 = tl.where(tmp22, tmp94, tmp6)
tmp96 = triton_helpers.maximum(tmp90, tmp95)
tmp97 = tmp78 - tmp96
tmp98 = tl_math.exp(tmp97)
tmp99 = tmp83 - tmp96
tmp100 = tl_math.exp(tmp99)
tmp101 = tmp98 + tmp100
tmp102 = tmp89 - tmp96
tmp103 = tl_math.exp(tmp102)
tmp104 = tmp101 + tmp103
tmp105 = tmp95 - tmp96
tmp106 = tl_math.exp(tmp105)
tmp107 = tmp104 + tmp106
tmp110 = tmp109 * tmp3
tmp111 = tl.where(tmp108, tmp109, tmp110)
tmp112 = tl.where(tmp0, tmp111, tmp6)
tmp115 = tmp114 * tmp3
tmp116 = tl.where(tmp113, tmp114, tmp115)
tmp117 = tl.where(tmp8, tmp116, tmp6)
tmp118 = triton_helpers.maximum(tmp112, tmp117)
tmp121 = tmp120 * tmp3
tmp122 = tl.where(tmp119, tmp120, tmp121)
tmp123 = tl.where(tmp15, tmp122, tmp6)
tmp124 = triton_helpers.maximum(tmp118, tmp123)
tmp127 = tmp126 * tmp3
tmp128 = tl.where(tmp125, tmp126, tmp127)
tmp129 = tl.where(tmp22, tmp128, tmp6)
tmp130 = triton_helpers.maximum(tmp124, tmp129)
tmp131 = tmp112 - tmp130
tmp132 = tl_math.exp(tmp131)
tmp133 = tmp117 - tmp130
tmp134 = tl_math.exp(tmp133)
tmp135 = tmp132 + tmp134
tmp136 = tmp123 - tmp130
tmp137 = tl_math.exp(tmp136)
tmp138 = tmp135 + tmp137
tmp139 = tmp129 - tmp130
tmp140 = tl_math.exp(tmp139)
tmp141 = tmp138 + tmp140
tl.store(out_ptr0 + x0, tmp28, xmask)
tl.store(out_ptr1 + x0, tmp39, xmask)
tl.store(out_ptr2 + x0, tmp62, xmask)
tl.store(out_ptr3 + x0, tmp73, xmask)
tl.store(out_ptr4 + x0, tmp96, xmask)
tl.store(out_ptr5 + x0, tmp107, xmask)
tl.store(out_ptr6 + x0, tmp130, xmask)
tl.store(out_ptr7 + x0, tmp141, xmask)
@triton.jit
def triton_poi_fused__softmax_leaky_relu_mul_where_3(in_out_ptr0,
in_out_ptr1, in_out_ptr2, in_out_ptr3, in_ptr0, in_ptr1, in_ptr2,
in_ptr3, in_ptr4, in_ptr5, in_ptr6, in_ptr7, in_ptr8, in_ptr9, in_ptr10,
in_ptr11, in_ptr12, xnumel, XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask).to(tl.int1)
tmp1 = tl.load(in_ptr1 + x2, xmask).to(tl.int1)
tmp2 = tl.load(in_out_ptr0 + x2, xmask)
tmp8 = tl.load(in_ptr2 + x1, xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr3 + x1, xmask, eviction_policy='evict_last')
tmp13 = tl.load(in_ptr4 + x2, xmask).to(tl.int1)
tmp14 = tl.load(in_out_ptr1 + x2, xmask)
tmp18 = tl.load(in_ptr5 + x1, xmask, eviction_policy='evict_last')
tmp21 = tl.load(in_ptr6 + x1, xmask, eviction_policy='evict_last')
tmp23 = tl.load(in_ptr7 + x2, xmask).to(tl.int1)
tmp24 = tl.load(in_out_ptr2 + x2, xmask)
tmp28 = tl.load(in_ptr8 + x1, xmask, eviction_policy='evict_last')
tmp31 = tl.load(in_ptr9 + x1, xmask, eviction_policy='evict_last')
tmp33 = tl.load(in_ptr10 + x2, xmask).to(tl.int1)
tmp34 = tl.load(in_out_ptr3 + x2, xmask)
tmp38 = tl.load(in_ptr11 + x1, xmask, eviction_policy='evict_last')
tmp41 = tl.load(in_ptr12 + x1, xmask, eviction_policy='evict_last')
tmp3 = 4.0
tmp4 = tmp2 * tmp3
tmp5 = tl.where(tmp1, tmp2, tmp4)
tmp6 = -8999999815811072.0
tmp7 = tl.where(tmp0, tmp5, tmp6)
tmp9 = tmp7 - tmp8
tmp10 = tl_math.exp(tmp9)
tmp12 = tmp10 / tmp11
tmp15 = tmp14 * tmp3
tmp16 = tl.where(tmp13, tmp14, tmp15)
tmp17 = tl.where(tmp0, tmp16, tmp6)
tmp19 = tmp17 - tmp18
tmp20 = tl_math.exp(tmp19)
tmp22 = tmp20 / tmp21
tmp25 = tmp24 * tmp3
tmp26 = tl.where(tmp23, tmp24, tmp25)
tmp27 = tl.where(tmp0, tmp26, tmp6)
tmp29 = tmp27 - tmp28
tmp30 = tl_math.exp(tmp29)
tmp32 = tmp30 / tmp31
tmp35 = tmp34 * tmp3
tmp36 = tl.where(tmp33, tmp34, tmp35)
tmp37 = tl.where(tmp0, tmp36, tmp6)
tmp39 = tmp37 - tmp38
tmp40 = tl_math.exp(tmp39)
tmp42 = tmp40 / tmp41
tl.store(in_out_ptr0 + x2, tmp12, xmask)
tl.store(in_out_ptr1 + x2, tmp22, xmask)
tl.store(in_out_ptr2 + x2, tmp32, xmask)
tl.store(in_out_ptr3 + x2, tmp42, xmask)
@triton.jit
def triton_poi_fused_cat_4(in_ptr0, in_ptr1, in_ptr2, in_ptr3, out_ptr0,
xnumel, XBLOCK: tl.constexpr):
xnumel = 64
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex % 16
x1 = xindex // 16
x2 = xindex
tmp0 = x0
tl.full([1], 0, tl.int64)
tmp3 = tl.full([1], 4, tl.int64)
tmp4 = tmp0 < tmp3
tmp5 = tl.load(in_ptr0 + (4 * x1 + x0), tmp4 & xmask, eviction_policy=
'evict_last', other=0.0)
tmp6 = 0.0
tmp7 = tmp5 > tmp6
tmp8 = 1.0
tmp9 = tmp5 * tmp8
tmp10 = libdevice.expm1(tmp9)
tmp11 = tmp10 * tmp8
tmp12 = tl.where(tmp7, tmp9, tmp11)
tmp13 = tl.full(tmp12.shape, 0.0, tmp12.dtype)
tmp14 = tl.where(tmp4, tmp12, tmp13)
tmp15 = tmp0 >= tmp3
tmp16 = tl.full([1], 8, tl.int64)
tmp17 = tmp0 < tmp16
tmp18 = tmp15 & tmp17
tmp19 = tl.load(in_ptr1 + (4 * x1 + (-4 + x0)), tmp18 & xmask,
eviction_policy='evict_last', other=0.0)
tmp20 = tmp19 > tmp6
tmp21 = tmp19 * tmp8
tmp22 = libdevice.expm1(tmp21)
tmp23 = tmp22 * tmp8
tmp24 = tl.where(tmp20, tmp21, tmp23)
tmp25 = tl.full(tmp24.shape, 0.0, tmp24.dtype)
tmp26 = tl.where(tmp18, tmp24, tmp25)
tmp27 = tmp0 >= tmp16
tmp28 = tl.full([1], 12, tl.int64)
tmp29 = tmp0 < tmp28
tmp30 = tmp27 & tmp29
tmp31 = tl.load(in_ptr2 + (4 * x1 + (-8 + x0)), tmp30 & xmask,
eviction_policy='evict_last', other=0.0)
tmp32 = tmp31 > tmp6
tmp33 = tmp31 * tmp8
tmp34 = libdevice.expm1(tmp33)
tmp35 = tmp34 * tmp8
tmp36 = tl.where(tmp32, tmp33, tmp35)
tmp37 = tl.full(tmp36.shape, 0.0, tmp36.dtype)
tmp38 = tl.where(tmp30, tmp36, tmp37)
tmp39 = tmp0 >= tmp28
tl.full([1], 16, tl.int64)
tmp42 = tl.load(in_ptr3 + (4 * x1 + (-12 + x0)), tmp39 & xmask,
eviction_policy='evict_last', other=0.0)
tmp43 = tmp42 > tmp6
tmp44 = tmp42 * tmp8
tmp45 = libdevice.expm1(tmp44)
tmp46 = tmp45 * tmp8
tmp47 = tl.where(tmp43, tmp44, tmp46)
tmp48 = tl.full(tmp47.shape, 0.0, tmp47.dtype)
tmp49 = tl.where(tmp39, tmp47, tmp48)
tmp50 = tl.where(tmp30, tmp38, tmp49)
tmp51 = tl.where(tmp18, tmp26, tmp50)
tmp52 = tl.where(tmp4, tmp14, tmp51)
tl.store(out_ptr0 + x2, tmp52, xmask)
@triton.jit
def triton_poi_fused__softmax_leaky_relu_mul_where_5(in_ptr0, in_ptr1,
in_ptr2, out_ptr0, out_ptr1, xnumel, XBLOCK: tl.constexpr):
xnumel = 4
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + 4 * x0, xmask, eviction_policy='evict_last').to(tl
.int1)
tmp1 = tl.load(in_ptr1 + 4 * x0, xmask, eviction_policy='evict_last').to(tl
.int1)
tmp2 = tl.load(in_ptr2 + 4 * x0, xmask, eviction_policy='evict_last')
tmp8 = tl.load(in_ptr0 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp9 = tl.load(in_ptr1 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp10 = tl.load(in_ptr2 + (1 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp15 = tl.load(in_ptr0 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp16 = tl.load(in_ptr1 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp17 = tl.load(in_ptr2 + (2 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp22 = tl.load(in_ptr0 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp23 = tl.load(in_ptr1 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
).to(tl.int1)
tmp24 = tl.load(in_ptr2 + (3 + 4 * x0), xmask, eviction_policy='evict_last'
)
tmp3 = 4.0
tmp4 = tmp2 * tmp3
tmp5 = tl.where(tmp1, tmp2, tmp4)
tmp6 = -8999999815811072.0
tmp7 = tl.where(tmp0, tmp5, tmp6)
tmp11 = tmp10 * tmp3
tmp12 = tl.where(tmp9, tmp10, tmp11)
tmp13 = tl.where(tmp8, tmp12, tmp6)
tmp14 = triton_helpers.maximum(tmp7, tmp13)
tmp18 = tmp17 * tmp3
tmp19 = tl.where(tmp16, tmp17, tmp18)
tmp20 = tl.where(tmp15, tmp19, tmp6)
tmp21 = triton_helpers.maximum(tmp14, tmp20)
tmp25 = tmp24 * tmp3
tmp26 = tl.where(tmp23, tmp24, tmp25)
tmp27 = tl.where(tmp22, tmp26, tmp6)
tmp28 = triton_helpers.maximum(tmp21, tmp27)
tmp29 = tmp7 - tmp28
tmp30 = tl_math.exp(tmp29)
tmp31 = tmp13 - tmp28
tmp32 = tl_math.exp(tmp31)
tmp33 = tmp30 + tmp32
tmp34 = tmp20 - tmp28
tmp35 = tl_math.exp(tmp34)
tmp36 = tmp33 + tmp35
tmp37 = tmp27 - tmp28
tmp38 = tl_math.exp(tmp37)
tmp39 = tmp36 + tmp38
tl.store(out_ptr0 + x0, tmp28, xmask)
tl.store(out_ptr1 + x0, tmp39, xmask)
@triton.jit
def triton_poi_fused__softmax_leaky_relu_mul_where_6(in_out_ptr0, in_ptr0,
in_ptr1, in_ptr2, in_ptr3, xnumel, XBLOCK: tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask).to(tl.int1)
tmp1 = tl.load(in_ptr1 + x2, xmask).to(tl.int1)
tmp2 = tl.load(in_out_ptr0 + x2, xmask)
tmp8 = tl.load(in_ptr2 + x1, xmask, eviction_policy='evict_last')
tmp11 = tl.load(in_ptr3 + x1, xmask, eviction_policy='evict_last')
tmp3 = 4.0
tmp4 = tmp2 * tmp3
tmp5 = tl.where(tmp1, tmp2, tmp4)
tmp6 = -8999999815811072.0
tmp7 = tl.where(tmp0, tmp5, tmp6)
tmp9 = tmp7 - tmp8
tmp10 = tl_math.exp(tmp9)
tmp12 = tmp10 / tmp11
tl.store(in_out_ptr0 + x2, tmp12, xmask)
@triton.jit
def triton_poi_fused__log_softmax_elu_7(in_ptr0, out_ptr0, xnumel, XBLOCK:
tl.constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp8 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp14 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last'
)
tmp21 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last'
)
tmp28 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last'
)
tmp1 = 0.0
tmp2 = tmp0 > tmp1
tmp3 = 1.0
tmp4 = tmp0 * tmp3
tmp5 = libdevice.expm1(tmp4)
tmp6 = tmp5 * tmp3
tmp7 = tl.where(tmp2, tmp4, tmp6)
tmp9 = tmp8 > tmp1
tmp10 = tmp8 * tmp3
tmp11 = libdevice.expm1(tmp10)
tmp12 = tmp11 * tmp3
tmp13 = tl.where(tmp9, tmp10, tmp12)
tmp15 = tmp14 > tmp1
tmp16 = tmp14 * tmp3
tmp17 = libdevice.expm1(tmp16)
tmp18 = tmp17 * tmp3
tmp19 = tl.where(tmp15, tmp16, tmp18)
tmp20 = triton_helpers.maximum(tmp13, tmp19)
tmp22 = tmp21 > tmp1
tmp23 = tmp21 * tmp3
tmp24 = libdevice.expm1(tmp23)
tmp25 = tmp24 * tmp3
tmp26 = tl.where(tmp22, tmp23, tmp25)
tmp27 = triton_helpers.maximum(tmp20, tmp26)
tmp29 = tmp28 > tmp1
tmp30 = tmp28 * tmp3
tmp31 = libdevice.expm1(tmp30)
tmp32 = tmp31 * tmp3
tmp33 = tl.where(tmp29, tmp30, tmp32)
tmp34 = triton_helpers.maximum(tmp27, tmp33)
tmp35 = tmp7 - tmp34
tl.store(out_ptr0 + x2, tmp35, xmask)
@triton.jit
def triton_poi_fused__log_softmax_8(in_ptr0, out_ptr0, xnumel, XBLOCK: tl.
constexpr):
xnumel = 16
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x2 = xindex
x1 = xindex // 4
tmp0 = tl.load(in_ptr0 + x2, xmask)
tmp1 = tl.load(in_ptr0 + 4 * x1, xmask, eviction_policy='evict_last')
tmp3 = tl.load(in_ptr0 + (1 + 4 * x1), xmask, eviction_policy='evict_last')
tmp6 = tl.load(in_ptr0 + (2 + 4 * x1), xmask, eviction_policy='evict_last')
tmp9 = tl.load(in_ptr0 + (3 + 4 * x1), xmask, eviction_policy='evict_last')
tmp2 = tl_math.exp(tmp1)
tmp4 = tl_math.exp(tmp3)
tmp5 = tmp2 + tmp4
tmp7 = tl_math.exp(tmp6)
tmp8 = tmp5 + tmp7
tmp10 = tl_math.exp(tmp9)
tmp11 = tmp8 + tmp10
tmp12 = tl_math.log(tmp11)
tmp13 = tmp0 - tmp12
tl.store(out_ptr0 + x2, tmp13, xmask)
def call(args):
(primals_1, primals_2, primals_3, primals_4, primals_5, primals_6,
primals_7, primals_8, primals_9, primals_10, primals_11, primals_12
) = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, 4), (4, 1))
assert_size_stride(primals_3, (8, 1), (1, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, 4), (4, 1))
assert_size_stride(primals_6, (8, 1), (1, 1))
assert_size_stride(primals_7, (4, 4), (4, 1))
assert_size_stride(primals_8, (8, 1), (1, 1))
assert_size_stride(primals_9, (4, 4), (4, 1))
assert_size_stride(primals_10, (8, 1), (1, 1))
assert_size_stride(primals_11, (16, 4), (4, 1))
assert_size_stride(primals_12, (8, 1), (1, 1))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(primals_1, primals_2, out=buf0)
del primals_2
buf1 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_cat_0[grid(128)](buf0, buf1, 128, XBLOCK=128,
num_warps=4, num_stages=1)
buf2 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
extern_kernels.mm(buf1, primals_3, out=buf2)
buf3 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
triton_poi_fused_leaky_relu_1[grid(16)](buf2, buf3, 16, XBLOCK=16,
num_warps=1, num_stages=1)
buf4 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
triton_poi_fused_leaky_relu_1[grid(16)](primals_4, buf4, 16, XBLOCK
=16, num_warps=1, num_stages=1)
del primals_4
buf9 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(primals_1, primals_5, out=buf9)
del primals_5
buf10 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
triton_poi_fused_cat_0[grid(128)](buf9, buf10, 128, XBLOCK=128,
num_warps=4, num_stages=1)
buf11 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
extern_kernels.mm(buf10, primals_6, out=buf11)
buf12 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
triton_poi_fused_leaky_relu_1[grid(16)](buf11, buf12, 16, XBLOCK=16,
num_warps=1, num_stages=1)
buf17 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(primals_1, primals_7, out=buf17)
del primals_7
buf18 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
triton_poi_fused_cat_0[grid(128)](buf17, buf18, 128, XBLOCK=128,
num_warps=4, num_stages=1)
buf19 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
extern_kernels.mm(buf18, primals_8, out=buf19)
buf20 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
triton_poi_fused_leaky_relu_1[grid(16)](buf19, buf20, 16, XBLOCK=16,
num_warps=1, num_stages=1)
buf25 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(primals_1, primals_9, out=buf25)
del primals_9
buf26 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
triton_poi_fused_cat_0[grid(128)](buf25, buf26, 128, XBLOCK=128,
num_warps=4, num_stages=1)
buf27 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
extern_kernels.mm(buf26, primals_10, out=buf27)
buf28 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
triton_poi_fused_leaky_relu_1[grid(16)](buf27, buf28, 16, XBLOCK=16,
num_warps=1, num_stages=1)
buf5 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf6 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf13 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf14 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf21 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf22 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf29 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
buf30 = empty_strided_cuda((4, 1), (1, 4), torch.float32)
triton_poi_fused__softmax_leaky_relu_mul_where_2[grid(4)](buf4,
buf3, buf2, buf12, buf11, buf20, buf19, buf28, buf27, buf5,
buf6, buf13, buf14, buf21, buf22, buf29, buf30, 4, XBLOCK=4,
num_warps=1, num_stages=1)
buf7 = reinterpret_tensor(buf2, (4, 4), (4, 1), 0)
del buf2
buf15 = reinterpret_tensor(buf11, (4, 4), (4, 1), 0)
del buf11
buf23 = reinterpret_tensor(buf19, (4, 4), (4, 1), 0)
del buf19
buf31 = reinterpret_tensor(buf27, (4, 4), (4, 1), 0)
del buf27
triton_poi_fused__softmax_leaky_relu_mul_where_3[grid(16)](buf7,
buf15, buf23, buf31, buf4, buf3, buf5, buf6, buf12, buf13,
buf14, buf20, buf21, buf22, buf28, buf29, buf30, 16, XBLOCK=16,
num_warps=1, num_stages=1)
del buf13
del buf14
del buf21
del buf22
del buf29
del buf30
buf8 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(buf7, buf0, out=buf8)
buf16 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(buf15, buf9, out=buf16)
buf24 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(buf23, buf17, out=buf24)
buf32 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(buf31, buf25, out=buf32)
buf33 = empty_strided_cuda((4, 16), (16, 1), torch.float32)
triton_poi_fused_cat_4[grid(64)](buf8, buf16, buf24, buf32, buf33,
64, XBLOCK=64, num_warps=1, num_stages=1)
buf34 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(buf33, primals_11, out=buf34)
buf35 = empty_strided_cuda((16, 8), (8, 1), torch.float32)
triton_poi_fused_cat_0[grid(128)](buf34, buf35, 128, XBLOCK=128,
num_warps=4, num_stages=1)
buf36 = empty_strided_cuda((16, 1), (1, 1), torch.float32)
extern_kernels.mm(buf35, primals_12, out=buf36)
buf37 = empty_strided_cuda((4, 4), (4, 1), torch.bool)
triton_poi_fused_leaky_relu_1[grid(16)](buf36, buf37, 16, XBLOCK=16,
num_warps=1, num_stages=1)
buf38 = buf6
del buf6
buf39 = buf5
del buf5
triton_poi_fused__softmax_leaky_relu_mul_where_5[grid(4)](buf4,
buf37, buf36, buf38, buf39, 4, XBLOCK=4, num_warps=1, num_stages=1)
buf40 = reinterpret_tensor(buf36, (4, 4), (4, 1), 0)
del buf36
triton_poi_fused__softmax_leaky_relu_mul_where_6[grid(16)](buf40,
buf4, buf37, buf38, buf39, 16, XBLOCK=16, num_warps=1, num_stages=1
)
del buf38
del buf39
buf41 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
extern_kernels.mm(buf40, buf34, out=buf41)
buf42 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
triton_poi_fused__log_softmax_elu_7[grid(16)](buf41, buf42, 16,
XBLOCK=16, num_warps=1, num_stages=1)
buf43 = empty_strided_cuda((4, 4), (4, 1), torch.float32)
triton_poi_fused__log_softmax_8[grid(16)](buf42, buf43, 16, XBLOCK=
16, num_warps=1, num_stages=1)
del buf42
return (buf43, buf3, buf4, buf7, buf8, buf12, buf15, buf16, buf20,
buf23, buf24, buf28, buf31, buf32, buf37, buf40, buf41, buf43,
reinterpret_tensor(buf34, (4, 4), (1, 4), 0), reinterpret_tensor(
buf35, (8, 16), (1, 8), 0), reinterpret_tensor(primals_12, (1, 8),
(1, 1), 0), reinterpret_tensor(buf33, (16, 4), (1, 16), 0),
reinterpret_tensor(primals_11, (4, 16), (1, 4), 0),
reinterpret_tensor(buf25, (4, 4), (1, 4), 0), reinterpret_tensor(
buf26, (8, 16), (1, 8), 0), reinterpret_tensor(primals_10, (1, 8),
(1, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0),
reinterpret_tensor(buf17, (4, 4), (1, 4), 0), reinterpret_tensor(
buf18, (8, 16), (1, 8), 0), reinterpret_tensor(primals_8, (1, 8), (
1, 1), 0), reinterpret_tensor(buf9, (4, 4), (1, 4), 0),
reinterpret_tensor(buf10, (8, 16), (1, 8), 0), reinterpret_tensor(
primals_6, (1, 8), (1, 1), 0), reinterpret_tensor(buf0, (4, 4), (1,
4), 0), reinterpret_tensor(buf1, (8, 16), (1, 8), 0),
reinterpret_tensor(primals_3, (1, 8), (1, 1), 0))
class GraphAttentionLayer(nn.Module):
"""
Simple GAT layer, similar to https://arxiv.org/abs/1710.10903
"""
def __init__(self, in_features, out_features, dropout, alpha, concat=True):
super(GraphAttentionLayer, self).__init__()
self.dropout = dropout
self.in_features = in_features
self.out_features = out_features
self.alpha = alpha
self.concat = concat
self.W = nn.Parameter(torch.empty(size=(in_features, out_features)))
nn.init.xavier_uniform_(self.W.data, gain=1.414)
self.a = nn.Parameter(torch.empty(size=(2 * out_features, 1)))
nn.init.xavier_uniform_(self.a.data, gain=1.414)
self.leakyrelu = nn.LeakyReLU(self.alpha)
def forward(self, h, adj):
Wh = torch.mm(h, self.W)
a_input = self._prepare_attentional_mechanism_input(Wh)
e = self.leakyrelu(torch.matmul(a_input, self.a).squeeze(2))
zero_vec = -9000000000000000.0 * torch.ones_like(e)
attention = torch.where(adj > 0, e, zero_vec)
attention = F.softmax(attention, dim=1)
attention = F.dropout(attention, self.dropout, training=self.training)
h_prime = torch.matmul(attention, Wh)
if self.concat:
return F.elu(h_prime)
else:
return h_prime
def _prepare_attentional_mechanism_input(self, Wh):
N = Wh.size()[0]
Wh_repeated_in_chunks = Wh.repeat_interleave(N, dim=0)
Wh_repeated_alternating = Wh.repeat(N, 1)
all_combinations_matrix = torch.cat([Wh_repeated_in_chunks,
Wh_repeated_alternating], dim=1)
return all_combinations_matrix.view(N, N, 2 * self.out_features)
def __repr__(self):
return self.__class__.__name__ + ' (' + str(self.in_features
) + ' -> ' + str(self.out_features) + ')'
class GATNew(nn.Module):
def __init__(self, nfeat, nhid, nclass, dropout, alpha, nheads):
"""Dense version of GAT."""
super(GATNew, self).__init__()
self.dropout = dropout
self.attentions = [GraphAttentionLayer(nfeat, nhid, dropout=dropout,
alpha=alpha, concat=True) for _ in range(nheads)]
for i, attention in enumerate(self.attentions):
self.add_module('attention_{}'.format(i), attention)
self.out_att = GraphAttentionLayer(nhid * nheads, nclass, dropout=
dropout, alpha=alpha, concat=False)
def forward(self, input_0, input_1):
primals_1 = self.attention_0.W
primals_3 = self.attention_0.a
primals_2 = self.attention_1.W
primals_6 = self.attention_1.a
primals_4 = self.attention_2.W
primals_8 = self.attention_2.a
primals_5 = self.attention_3.W
primals_10 = self.attention_3.a
primals_11 = self.out_att.W
primals_12 = self.out_att.a
primals_7 = input_0
primals_9 = input_1
output = call([primals_1, primals_2, primals_3, primals_4,
primals_5, primals_6, primals_7, primals_8, primals_9,
primals_10, primals_11, primals_12])
return output[0]
|
CxzPink/polyGAT
|
GAT
| false | 2,153 |
[
"MIT"
] | 0 |
95ee1414dd721567f321a7a6271ce518964688ac
|
https://github.com/CxzPink/polyGAT/tree/95ee1414dd721567f321a7a6271ce518964688ac
|
Highway
|
# AOT ID: ['0_forward']
from ctypes import c_void_p, c_long, c_int
import torch
import math
import random
import os
import tempfile
from math import inf, nan
from torch._inductor.hooks import run_intermediate_hooks
from torch._inductor.utils import maybe_profile
from torch._inductor.codegen.memory_planning import _align as align
from torch import device, empty_strided
from torch._inductor.async_compile import AsyncCompile
from torch._inductor.select_algorithm import extern_kernels
from torch._inductor.codegen.multi_kernel import MultiKernelCall
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid, split_scan_grid, grid_combo_kernels, start_graph, end_graph
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
aten = torch.ops.aten
inductor_ops = torch.ops.inductor
_quantized = torch.ops._quantized
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cpu = torch._C._dynamo.guards._empty_strided_cpu
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
empty_strided_xpu = torch._C._dynamo.guards._empty_strided_xpu
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
alloc_from_pool = torch.ops.inductor._alloc_from_pool
async_compile = AsyncCompile()
# kernel path: runs/run_shard_7/inductor_cache/ii/ciitic7gw336jmjrzv6vnyt7nggf2elteacsju5rdvniywfl7erg.py
# Topologically Sorted Source Nodes: [x0, x1, mul, sub, mul_1, add], Original ATen: [aten.relu, aten.sigmoid, aten.mul, aten.rsub, aten.add]
# Source node to ATen node mapping:
# add => add
# mul => mul
# mul_1 => mul_1
# sub => sub
# x0 => relu
# x1 => sigmoid
# Graph fragment:
# %relu : [num_users=1] = call_function[target=torch.ops.aten.relu.default](args = (%view_1,), kwargs = {})
# %sigmoid : [num_users=2] = call_function[target=torch.ops.aten.sigmoid.default](args = (%view_3,), kwargs = {})
# %mul : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%relu, %sigmoid), kwargs = {})
# %sub : [num_users=1] = call_function[target=torch.ops.aten.sub.Tensor](args = (1.0, %sigmoid), kwargs = {})
# %mul_1 : [num_users=1] = call_function[target=torch.ops.aten.mul.Tensor](args = (%primals_3, %sub), kwargs = {})
# %add : [num_users=1] = call_function[target=torch.ops.aten.add.Tensor](args = (%mul, %mul_1), kwargs = {})
triton_poi_fused_add_mul_relu_rsub_sigmoid_0 = async_compile.triton('triton_poi_fused_add_mul_relu_rsub_sigmoid_0', '''
import triton
import triton.language as tl
from triton.compiler.compiler import AttrsDescriptor
from torch._inductor.runtime import triton_helpers, triton_heuristics
from torch._inductor.runtime.triton_helpers import libdevice, math as tl_math
from torch._inductor.runtime.hints import AutotuneHint, ReductionHint, TileHint, instance_descriptor, DeviceProperties
@triton_heuristics.pointwise(
size_hints=[256],
filename=__file__,
triton_meta={'signature': {0: '*fp32', 1: '*fp32', 2: '*fp32', 3: '*fp32', 4: 'i32'}, 'device': DeviceProperties(type='cuda', index=0, cc=80, major=8, regs_per_multiprocessor=65536, max_threads_per_multi_processor=2048, multi_processor_count=108), 'constants': {}, 'configs': [AttrsDescriptor(divisible_by_16=(0, 1, 2, 3, 4), equal_to_1=())]},
inductor_meta={'autotune_hints': set(), 'kernel_name': 'triton_poi_fused_add_mul_relu_rsub_sigmoid_0', 'mutated_arg_names': [], 'no_x_dim': False, 'num_load': 3, 'num_reduction': 0, 'backend_hash': 'A9C866B4A14FD3277824029365D703C2427B2E685E54EC9B3EF4ADC8D1EEAC1D', 'are_deterministic_algorithms_enabled': False, 'assert_indirect_indexing': True, 'autotune_local_cache': True, 'autotune_pointwise': True, 'autotune_remote_cache': None, 'force_disable_caches': False, 'dynamic_scale_rblock': True, 'max_autotune': False, 'max_autotune_pointwise': False, 'min_split_scan_rblock': 256, 'spill_threshold': 16, 'store_cubin': False},
min_elem_per_thread=0
)
@triton.jit
def triton_poi_fused_add_mul_relu_rsub_sigmoid_0(in_ptr0, in_ptr1, in_ptr2, out_ptr0, xnumel, XBLOCK : tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + (x0), xmask)
tmp3 = tl.load(in_ptr1 + (x0), xmask)
tmp6 = tl.load(in_ptr2 + (x0), xmask)
tmp1 = tl.full([1], 0, tl.int32)
tmp2 = triton_helpers.maximum(tmp1, tmp0)
tmp4 = tl.sigmoid(tmp3)
tmp5 = tmp2 * tmp4
tmp7 = 1.0
tmp8 = tmp7 - tmp4
tmp9 = tmp6 * tmp8
tmp10 = tmp5 + tmp9
tl.store(out_ptr0 + (x0), tmp10, xmask)
''', device_str='cuda')
async_compile.wait(globals())
del async_compile
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4, ), (1, ))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4, ), (1, ))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_2, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
# Topologically Sorted Source Nodes: [linear_1], Original ATen: [aten.addmm]
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_3, (64, 4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0), alpha=1, beta=1, out=buf1)
del primals_4
del primals_5
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
# Topologically Sorted Source Nodes: [x0, x1, mul, sub, mul_1, add], Original ATen: [aten.relu, aten.sigmoid, aten.mul, aten.rsub, aten.add]
stream0 = get_raw_stream(0)
triton_poi_fused_add_mul_relu_rsub_sigmoid_0.run(buf0, buf1, primals_3, buf2, 256, grid=grid(256), stream=stream0)
return (buf2, primals_3, buf0, buf1, )
def benchmark_compiled_module(times=10, repeat=10):
from torch._dynamo.testing import rand_strided
from torch._inductor.utils import print_performance
primals_1 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_2 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
primals_3 = rand_strided((4, 4, 4, 4), (64, 16, 4, 1), device='cuda:0', dtype=torch.float32)
primals_4 = rand_strided((4, 4), (4, 1), device='cuda:0', dtype=torch.float32)
primals_5 = rand_strided((4, ), (1, ), device='cuda:0', dtype=torch.float32)
fn = lambda: call([primals_1, primals_2, primals_3, primals_4, primals_5])
return print_performance(fn, times=times, repeat=repeat)
if __name__ == "__main__":
from torch._inductor.wrapper_benchmark import compiled_module_main
compiled_module_main('None', benchmark_compiled_module)
|
import torch
from torch import nn
import torch.nn.functional as F
class Highway(nn.Module):
def __init__(self, size):
super(Highway, self).__init__()
self.one = nn.Linear(size, size)
self.two = nn.Linear(size, size)
def forward(self, x):
x0 = F.relu(self.one(x))
x1 = torch.sigmoid(self.two(x))
return x0 * x1 + x * (1.0 - x1)
def get_inputs():
return [torch.rand([4, 4, 4, 4])]
def get_init_inputs():
return [[], {'size': 4}]
|
import torch
from torch._inductor.select_algorithm import extern_kernels
import triton
import triton.language as tl
from torch._inductor.runtime.triton_heuristics import grid
from torch._C import _cuda_getCurrentRawStream as get_raw_stream
from torch._inductor.runtime import triton_helpers
from torch import nn
assert_size_stride = torch._C._dynamo.guards.assert_size_stride
empty_strided_cuda = torch._C._dynamo.guards._empty_strided_cuda
reinterpret_tensor = torch._C._dynamo.guards._reinterpret_tensor
@triton.jit
def triton_poi_fused_add_mul_relu_rsub_sigmoid_0(in_ptr0, in_ptr1, in_ptr2,
out_ptr0, xnumel, XBLOCK: tl.constexpr):
xnumel = 256
xoffset = tl.program_id(0) * XBLOCK
xindex = xoffset + tl.arange(0, XBLOCK)[:]
xmask = xindex < xnumel
x0 = xindex
tmp0 = tl.load(in_ptr0 + x0, xmask)
tmp3 = tl.load(in_ptr1 + x0, xmask)
tmp6 = tl.load(in_ptr2 + x0, xmask)
tmp1 = tl.full([1], 0, tl.int32)
tmp2 = triton_helpers.maximum(tmp1, tmp0)
tmp4 = tl.sigmoid(tmp3)
tmp5 = tmp2 * tmp4
tmp7 = 1.0
tmp8 = tmp7 - tmp4
tmp9 = tmp6 * tmp8
tmp10 = tmp5 + tmp9
tl.store(out_ptr0 + x0, tmp10, xmask)
def call(args):
primals_1, primals_2, primals_3, primals_4, primals_5 = args
args.clear()
assert_size_stride(primals_1, (4, 4), (4, 1))
assert_size_stride(primals_2, (4,), (1,))
assert_size_stride(primals_3, (4, 4, 4, 4), (64, 16, 4, 1))
assert_size_stride(primals_4, (4, 4), (4, 1))
assert_size_stride(primals_5, (4,), (1,))
with torch.cuda._DeviceGuard(0):
torch.cuda.set_device(0)
buf0 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_2, reinterpret_tensor(primals_3, (64,
4), (4, 1), 0), reinterpret_tensor(primals_1, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf0)
del primals_1
del primals_2
buf1 = empty_strided_cuda((64, 4), (4, 1), torch.float32)
extern_kernels.addmm(primals_5, reinterpret_tensor(primals_3, (64,
4), (4, 1), 0), reinterpret_tensor(primals_4, (4, 4), (1, 4), 0
), alpha=1, beta=1, out=buf1)
del primals_4
del primals_5
buf2 = empty_strided_cuda((4, 4, 4, 4), (64, 16, 4, 1), torch.float32)
get_raw_stream(0)
triton_poi_fused_add_mul_relu_rsub_sigmoid_0[grid(256)](buf0, buf1,
primals_3, buf2, 256, XBLOCK=128, num_warps=4, num_stages=1)
return buf2, primals_3, buf0, buf1
class HighwayNew(nn.Module):
def __init__(self, size):
super(HighwayNew, self).__init__()
self.one = nn.Linear(size, size)
self.two = nn.Linear(size, size)
def forward(self, input_0):
primals_1 = self.one.weight
primals_2 = self.one.bias
primals_4 = self.two.weight
primals_5 = self.two.bias
primals_3 = input_0
output = call([primals_1, primals_2, primals_3, primals_4, primals_5])
return output[0]
|
DennisMagnusson/voice2voice
|
Highway
| false | 2,154 |
[
"MIT"
] | 0 |
cee95b3eda8c2159f6b85e1733652ff8b7a537ce
|
https://github.com/DennisMagnusson/voice2voice/tree/cee95b3eda8c2159f6b85e1733652ff8b7a537ce
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.